Best popular movies like Ginger Snaps:

Do you need specific genre & keyword selection to find films similar to Ginger Snaps?
<< FIND THEM HERE! >>

Ginger Snaps (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Ginger Snaps (2000)

Is becoming a woman analogous, in some deep psychological way, to becoming a werewolf? Ginger is 16, edgy, tough, and, with her younger sister, into staging and photographing scenes of death. They've made a pact about dying together. In early October, on the night she has her first period, which is  …also the night of a full moon, a werewolf bites Ginger. Within a few days, some serious changes happen to her body and her temperament. Her sister Brigitte, 15, tries to find a cure with the help of Sam, a local doper. As Brigitte races against the clock, Halloween and another full moon approach, Ginger gets scarier, and it isn't just local dogs that begin to die. (Read More)

Subgenre:
creature featuredark comedyblack comedycoming of agecult filmindependent film
Themes:
photographycancerdrug usesupernatural powerobsessiondrunkennesstorturedrinkingpregnancyrapesuicidedeathmurder
Mood:
social satirehigh schoolnightmaresatiregore
Locations:
school nursewoodsbathtubforestschool
Characters:
girl fightself cuttingwitchteenage boysister sister relationshipphotographerdancerstudentnurseteacherfemale protagonistteenage girlboyboyfriend girlfriend relationshipfather daughter relationship …mother daughter relationshippoliceteenager (See All)
Story:
suicide pactsilver bulletclaw markeating a wormbelly button piercingnavel piercinghair curlerkicking a doggoth girlhalloween partyspilled milkcanadian gothicfemale werewolfinjection into one's neckaccidental stabbing …testicular cancergrowing marijuanadrinking bloodschool lockerdead boytea partyfake suicideobsessed with deathurinating bloodblood sisterwhite blood cellhit with a hockey stickscrewdriver the toolteaching someone how to drivebitten by an animalsuspected paedophilesanitary napkindeep freezerathletic fielddiet pillsfield hockeyfake bloodlocked in a bathroomstreet hockeycheckout clerkraking leavespicket fencegasoline canwolfsbanepawmetabolismhomeopathyovulationcrampgirls' bathroomspinesandboxpmslycanthropefingernailboys' bathroomdetoxbleachwatching a movie on tvrocking horsesupernovaguidance counselorlearning to drivestdneon lighthockey sticklaxativepactmenarchefield triplycanthropyvowentrailscanuxploitationtailslide projectorsilvercoughing bloodroadkilldark heroineface ripped offhowlinghuman becoming an animalflickering lightlawn mowerbitten in the throatoathtampondrugstoreslide showx rayed skeletonfurbludgeoningbechdel test passedpitchforkshapeshiftingclawloss of sistercuremicroscopesense of smellteethbiologybleedingkilling a dogworm16 year oldgreenhousepiercingurinebeastpolaroiddead dogpubertyporn magazinehairmenstruationdead girlgothfamily dinnerbroken armmutationswinginfectionstabbed in the throatshovelkickingsevered fingerplaygroundcovered in bloodjanitorfull moondrug dealingpromiseanimal attackmilkburialwatching a moviestabbed in the stomachvirushypodermic needleinjurygothicwoundfalling down stairspot smokingloyaltywolfwerewolfchainsawgarageredheadobscene finger gesturefireworksclassfirst partexploding bodybasementinjectionbaseball bathangingflowersmissing personpoisonfirst of serieslocker roomsuburbvirgincurselatex glovespainvanhit by a cartoiletthroat slittingimpalementdrug dealerstabbingcandleflashlighthalloweenclassroommarijuanadead bodyrunningshowdownvomitingcondomdrinkcamerawatching tvurinationblood splattercorpsebeatingpantiesknifepartyphotographdancingcigarette smokingcharacter name in titlef ratedviolencefightgunbloodsexmasturbationkissdog (See All)

Cursed (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Cursed (2005)

Ellie has been taking care of her younger brother Jimmy since their parents death. One night after picking him up from a party they are involved in a car accident on Mullholland Drive. While trying to rescue a woman from the other car a creature attacks and kills her, also injuring both Ellie and Ji …mmy. After some research Jimmy realizes the creature could only have been a werewolf. (Read More)

Subgenre:
creature featureblack comedycult filmindependent filmsuspenseabsurdismteen movieteen horrormonster movielgbt horror
Themes:
supernatural powerdrunkennessdeathmurderrevengesurrealismjealousyfearescapemonsterseductionparanoiawrestlingrivalryhome invasion
Mood:
high schoolnightmaresatire
Locations:
barlos angeles californianightclubelevatorpolice carofficemuseumfire truck
Characters:
boyfriend girlfriend relationshippoliceteenagerhomosexualtattoobrother sister relationshippolice officerlove trianglebullysecurity guardgay teenagergay friendmythical creature
Period:
2000s
Story:
female werewolflycanthropelycanthropysilverhuman becoming an animalhowlingshapeshiftingsense of smellstabbed in the throatfull moonanimal attackwolfwerewolfgarageobscene finger gesture …basementcursehit by a cardead bodyshowdowncorpsebeatingknifepartyphotographdogfightbloodviolencekissnuditymale nudityone word titlemale rear nuditybare chested malefemale rear nuditytitle spoken by characterchasesurprise endingpistolcell phoneshot to deathfistfightcar accidentshot in the chestshot in the headshotgunrescueslow motion scenepunched in the faceswordbrawlbare buttfalling from heightcar crashbathroomdecapitationfoot chasegay slurorphanambushcaliforniamassacreambulancestabbed to deathdinerstabbed in the chestinternetsevered headcreaturenews reporttransformationshot in the foreheadpublic nuditylimousinecoming outelectrocutionattackproduct placementknocked outkicked in the faceshot in the shoulderscargymhigh school studentcheerleadercharacter says i love youcult directorpizzaactor playing himselflooking at oneself in a mirrorscene during opening creditscatfightcomic bookhollywood californiakicked in the stomachvillainessnosebleedclubparking garagecarnivaleaten aliverampagecameoblood on facepower outagegash in the faceevacuationco workerescape attemptpunched in the chestthrown through a windowbody landing on a carcanepierfortune tellergeekwrestlerfirefighterwebsitesuper strengthpicturebully comeuppancehearing voicescostume partyexhibitionistferris wheelhollywood signwoman kills a manjockhead cut offhit with a shovelwoman fights a mancut into piecesvending machinepentagramdog attackoff screen murdercar rolloveranimal killinglifting person in airglowing eyesexhibitiontv stationwomen's bathroomtalk show hostcar wreckfairgroundrescue attemptpepper sprayhomophobedead parentsgalawoman hits a mangay joketroubled productiongay athletepublicistpalm readingcuckoo clockwolfmanraw meatbroken dishbathroom stallhall of mirrorsgoogling for informationburning bodycar off bridgewerewolf bitebitten in the handhigh school wrestlingwalking on the ceilingbitten in the armbroken elevatormulholland driveevil markcoming out to girlfriendbloody scratchescapitol records building hollywood (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Lat Den Ratte Komma In (2008)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Lat Den Ratte Komma In (2008)

Oskar, a bullied 12-year old, dreams of revenge. He falls in love with Eli, a peculiar girl. She can't stand the sun or food and to come into a room she needs to be invited. Eli gives Oskar the strength to hit back but when he realizes that Eli needs to drink other people's blood to live he's faced  …with a choice. How much can love forgive? Set in the Stockholm suburb of Blackeberg in 1982. (Read More)

Subgenre:
creature featurecoming of agecult film
Themes:
drinkingsuicidedeathmurderfriendshiprevengefeardivorcebrutalitybullyingcrueltychildhoodfalling in lovecourage
Mood:
gorenight
Locations:
woodsbathtubforestschoolhospitalbartrainswimming poolsnowtaxiapartmentpolice carlakeschool bullyblood on snow
Characters:
teacherboyboyfriend girlfriend relationshippolicefather son relationshipmother son relationshipfriendchildrengirlserial killerpolicemanvampirebullysingle motheralcoholic …ex husband ex wife relationshipdeath of girlfriendvampire girl (See All)
Period:
1980swinter
Story:
dead boyboys' bathroomfield tripbitten in the throatsense of smellbleedingpubertyinfectioncovered in bloodanimal attackmilkgothicfalling down stairschainsawclass …locker roomsuburbthroat slittingflashlightclassroomdead bodyvomitingdrinkurinationcorpseknifecigarette smokingblooddogkissfemale nuditybased on novelnudityfemale frontal nuditybare chested maletelephone callfireunderwearfoodmirrorcatarrestundressingfalling from heightbookliebeerbathroomneighborswimmingdecapitationnewspapergangbridgeeatingfemale pubic hairsubwaydinnersevered headradiounderwater scenedrowningattempted murdertreeperson on fireliarreadingringneck breakingtied upthreatened with a knifesevered armwhippingnewspaper headlinesingle parentrecord playereavesdroppinghuggingburned aliveaddictionlooking at oneself in a mirrorlistening to musictape recorderrecordingloss of friendswimsuitgas maskbarefootswitchbladechild's point of viewattempted suicidewhipchild protagonistgash in the facehit on the headdark heroice skatingice hockeyblood on shirtmurder of a childsnowinggasolinecellarnewspaper clippingvodka12 year oldcandyhit in the faceimperative in titlereading alouddead childrenlooking out a windowacidbully comeuppancedisposing of a dead bodyweightliftingclimbing through a windowfemale vampiresolitudemisfitcowboy bootslistening to a radiobitten in the neckdeath penaltydripping bloodscandinaviaurinalgurneykiller childdisfigured facegame playingsnowmobilepencilglowing eyesstarvingstockholm swedenhead ripped offandrogynybloody body of a childblond boyhung upside downsledmultiple murdersscreenplay adapted by authorfrozen bodyrubik's cubefrozen lakelooking in a windowpuzzle solvingraincoatsunlightfinger cutcold the temperaturevampire bitemorse codedragging a dead bodyband aidearvampire human lovemelting facestampsitting in a treeclimbing up a walldivorced coupleear bleedingbleeding from eyesolder brotherweather reportcry for helpdangerous friendunderpasshandprintchild vampiretransistor radiobrushing one's teethcat loverdecapitated childtape deckthrown out a windowfunnelsleeping in a bathtubblood drainingwet hairdaughter murders fathergolden eggblindsclimbing up a buildingmislaid truststamp collectionwet pantssneaking intriple child murdercat attacksledgefrench poodlecutting one's handscare involving catbursting into flamesclass tripowning many catscutting the palm of one's handviaductdrained of bloodphysical education classphysical education teacheranimal senses evilbeating with a stickburning womanlistening through the wall (See All)

Teeth (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Teeth (2007)

Dawn grows up in the shadow of a nuclear power plant. In high school, while her biology class studies evolution, she realizes she may have a hidden curse, an "adaptation." She lives with her mom, step-father, and hard-edged step-brother. She likes Tobey, a guy at school, and he likes her. She takes  …a pledge to remain chaste until marriage, so they date in groups, watch G-rated films, and don't kiss, but the power of teen hormones is great, so temptation beckons. Dawn has an admirer in Ryan, and when when things have an unexpected twist with Tobey, she turns to Ryan for help. Will he be her mythical hero and rescue her? Or can she find her way as her own hero, turning the curse into an asset? (Read More)

Subgenre:
black comedycoming of ageindependent filmpunk
Themes:
rapedeathmurderloverevengereligiondeceptionseductionlonelinessdysfunctional familyguiltsexualityillnessevilvengeance …police investigationmythologyevolutionfear of sex (See All)
Mood:
high schoolnightmaregorerainmythblood and goreancient myth
Locations:
bathtubschoolhospitalbicyclepolice carcavegas station
Characters:
teenage boydancerstudentnurseteacherteenage girlboyboyfriend girlfriend relationshipmother daughter relationshippolicehusband wife relationshipfather son relationshipfrienddoctortattoo …girlstepfather stepdaughter relationshipstepbrother stepsister relationshipstepmother stepson relationship (See All)
Story:
teethbiologypiercingmutationsevered fingerpromisewatching a moviepot smokingclasslocker roomvirgincursecandleflashlightclassroom …condomwatching tvblood splattercorpsedancingcigarette smokingviolencefightdogkissbloodmasturbationnudityfemale frontal nudityflashbackmale frontal nuditymale rear nuditysex scenefingeringtitle spoken by charactershowercell phonedreammirrorpunched in the facecomputerbookbeervibratorbedmale pubic hairguitarswimmingbedroomdrawingbathsearchmicrophonechampagnelightningringattempted rapescargymspeechhigh school studentgiftdatepremarital sexwaterfallprofanitydismembermentteenage sexsexual fantasysurgeryjeeplistening to musicpropagandamutantmutilationmorgueswimsuitvirginityhitchhikingmoralitymovie theatrepillsresearchdark humorlove at first sightfirst kissperversiondeceitturtlesexual humorcliffbetcastrationclassmatelooking at self in mirrorsexual assaultstolen carsexual awakeningbonghigh school teachermetaphortemptationsexual perversionvulgarityself defensemaking outsex educationknocking on a doorbubble bathgiving a toastbitten in the neckbody baghorninesspondbleeding to deathfilling stationgropinghigh school girlsexual repressionrattlesnakedeath by drowningtoy gunhymntalking about sexgynecologistdog attackgrudgebitecandlelightsurgical operationbitingsexual arousalsexual intercoursefingerstrobe lightfemale studentnuclear power plantstepsisterfemale sexualityoverheard conversationgynecological examadolescent boyfemale empowermentserpentsevered penisadolescent girldog bitefinger cutconservatismhigh school boyindoctrinationchastity beltscuba diverfinger bitten offteenage rapestepbrotherblood spurtingintelligent designbb gunchastitypurityschool assemblyheavy metal musicill motherpledgeclimbing a ropevoice over readingrebellious sondysfunctionalitygynecologyspilling a drinkself disciplinevagina dentatafemale classmatemale sexualitysexual abstinenceneck woundtoy rabbitself repressionsex education bookwatching a cartoonfinger bite (See All)

Suspiria (1977) is one of the best movies like Ginger Snaps (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Suspiria (1977)

Suzy Bannion travels to Germany to perfect her ballet skills. She arrives at the Tanz dance academy in the pouring rain and is refused admission after another woman is seen fleeing the school. She returns the next morning and this time is let in. She learns that the young woman she saw fleeing the p …revious evening, Pat Hingle, has been found dead. Strange things soon begin to occur. Suzy becomes ill and is put on a special diet; the school becomes infested with maggots; odd sounds abound; and Daniel, the pianist, is killed by his own dog. A bit of research indicates that the ballet school was once a witches' coven - and as Suzy learns, still is. (Read More)

Subgenre:
coming of agecult filmindependent filmsuspenseconspiracysupernaturalfish out of waterarthouseart horrorpsychological thrillersupernatural horroritalian horror
Themes:
supernatural powerdrunkennessdeathmurderfriendshipsurrealismfearescapedancedeceptionvoyeurismbrutalityparanoiaillnesssadism …evilunrequited lovecrueltypanicblindnessself sacrificemysterious death (See All)
Mood:
gorerainnightavant gardeslasherdarknessstylization
Locations:
woodsforestschoolswimming pooltaxiairportapartmentgermanytaxi driver
Characters:
witchsister sister relationshipstudentteacherfemale protagonistteenage girlboyteenagerfrienddoctorgirlpolice officerkillerpsychiatristprofessor …germanamericanamerican abroadself mutilationaunt nephew relationshipevil witchmysterious killernew student (See All)
Period:
1970syear 1977
Story:
drinking bloodcoughing bloodflickering lightbitten in the throatwormstabbed in the throatcovered in bloodfull moonanimal attackhypodermic needlegothicfirst partinjectionhangingmissing person …locker roomtoiletthroat slittingimpalementstabbingshowdownblood splattercorpseknifedancingcigarette smokingdogbloodviolenceone word titleflashbackexplosionchasesurprise endingtelephone callfirevoice over narrationslow motion scenesecretfalling from heightbathroompianodemonhallucinationvoyeurtelephonesubjective cameraswimminggood versus evilfoot chasewineambushstrangulationdeath of friendstabbed to deathstabbed in the chestcoffinritualattempted murderlegendcharacter repeating someone else's dialoguedangerprologuescreamingcharacter's point of view camera shotcover upcollege studentlightningscreamdisappearancesuspicionmurdererthreatened with a knifeballetcult directorpubeuropekillingitalianocculteavesdroppingburned alivekilling an animalnipples visible through clothingelectronic music scoreheavy rainlooking at oneself in a mirrorfaintingcookexploding buildingwitchcraftnosebleedgossipservantvisitgrindhousevictimdead womanschizophreniareverse footagebloody noseblood on facefemale leadmercilessnesspower outagestabbed in the neckmutebroken glasspsychotronicescape attemptcigarette lighterheartaerial shotatticshadowblood on shirttitle at the endrainstormdisfigurementnotedressing roomblind manopening a doorroomdead woman with eyes openlightbatpiano playerpsychopathic killerbarbed wireinvisibilityspiral staircasegerman shepherdmetaphorevil spiritpiano playingclimbing through a windowslashingsleepschool principalwhisperinghearing voiceswhistlingrazoroffscreen killingbitten in the neckmacguffinpsychiatryrazor bladebreaking a windowhallwaygraphic violencemaggotknife murderbloody violencedog attacklocked in a roomsecret passageheadmasterhouse on firesilhouetteanimal killingfade to blackghoulglowing eyesgrindhouse filmnoiseextreme close upzippo lightersinisterwethorror artblond boythroat rippingacademyleotardtaxi ridehidden doorexterminatorgargoyleevil powerfragments of glasshanged womanitalian cinemademonicmale dancerremadedrive in classicstabbed in the heartknife woundprogressive rockfiendwiredance instructorcovengory violencesatanichanged girlindoor swimming poolhell on earthrotting corpseunknown killerhole in chestdrugged foodemployee dismissalreanimated corpsestabbed with glassfootstepsseeing eye dogballet schoolballet teacherbitten by a dognauseahallucinogenicwall paintingmultiple stabbingshiding behind a doorballet shoesfalling through a glass roofrotten foodattacked by a dogmusical sceneguide dogstained glassstudy abroadcolor blindnesspsychiatric treatmentknife in throatserving traywoman hangedraspy voiceblind musiciandance academypainting fingernailsempty worldthematic cinema (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Battle Royale (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Battle Royale (2000)

Forty-two students, three days, one deserted Island: welcome to Battle Royale. A group of ninth-grade students from a Japanese high school have been forced by legislation to compete in a Battle Royale. The students are each given a bag with a randomly selected weapon and a few rations of food and wa …ter and sent off to kill each other in a no-holds-barred (with a few minor rules) game to the death, which means that the students have three days to kill each other until one survives--or they all die. The movie focuses on a few of the students and how they cope. Some decide to play the game like the psychotic Kiriyama or the sexual Mitsuko, while others like the heroes of the movie--Shuya, Noriko, and Kawada--are trying to find a way to get off the Island without violence. However, as the numbers dwell down lower and lower on an hourly basis, is there any way for Shuya and his classmates to survive? (Read More)

Subgenre:
dark comedyblack comedycult filmmartial artstragedydystopiaepicteen moviejapanese horror filmcult classic
Themes:
photographydrug usesuicidedeathmurderlovefriendshiprevengesurrealismkidnappingdrugsjealousyescapeheromemory …lonelinessdeath of fatherbrutalitydeath of motherguiltunrequited lovecrueltydyingunemploymentblindnesscheatingself sacrificesuicide of father (See All)
Mood:
high schoolnightmaresatiregorerainambiguous ending
Locations:
schoolbeachrestauranttraincarhelicopterboatbusbicyclewaterkitchenjapanseatruckbaseball …cavejungletunnel (See All)
Characters:
teenage boyphotographerstudentteacherteenage girlboyfather daughter relationshipmother daughter relationshipteenagerfather son relationshipmother son relationshipfrienddoctorchildrengirl …soldieraction heroreference to godwaitressjapanesealcoholicteacher student relationshipuncle nephew relationshippimpfishermansuicide by hangingalcoholic motherjapanese soldierkiller dogjapanese teenagersuicide by jumping off a cliff (See All)
Period:
futurethe future
Story:
girls' bathroomtamponbleedingpolaroidkickingpromisewoundobscene finger gestureclassfirst parthangingpoisonvirginthroat slittingstabbing …candleflashlightclassroomdead bodyrunningshowdownvomitingcamerablood splattercorpsebeatingknifephotographcigarette smokingf ratedgunviolencedogbloodfightbased on novelflashbacktwo word titlesex scenetitle spoken by characterexplosionchasepistoltelephone callfirecryingcell phoneshootoutdreamshot to deathfistfightfoodmachine gunmirrorshot in the headshotguncomputercatbattleswordgunfightbrawlshootingpaintingheld at gunpointtearshand to hand combatbombcafehallucinationislandrevolverguitartelevisionfightingcombatshot in the backdecapitationgood versus evilsurvivalsword fightaxemassacrebasketballarmysuicide attemptweaponmapaccidentexploding carsevered headanti herodisarming someonedrawingchild in perilcontroversyroommatefemme fataleshot in the legprincessnecklacegunshotone against manybinocularsmicrophonestabbed in the backprologuefugitiveumbrellastorytellingpresidentpursuittragic eventgovernmentautomobiletrapschoolgirlmurderersemiautomatic pistolshot in the armsleepingtrustprincestylized violencemaniacwaiteruzihand grenadegamespearmass murderjeeppropagandahelmetsurvivorwristwatchgossipdesperationclassical musicgenocidemexican standoffgun fusocial commentaryclockgas maskpump action shotgunswitchbladecrossbowbackpackfight to the deathanimated sequence3 dimensionalgash in the facestabbed in the neckdark humormutehungerdespaircigarette lighterhit on the headexploding headschool uniformdead childdisembowelmentknife fightfascismyoung lovemurder of a childcaptureschoolgirl uniformyakuzabulletproof vestcliffcastrationclassmatebody countpatriotismlaptop computerasialighthousekatanakendomolotov cocktailshot in the neckbandagelocal blockbusterhead blown offpostcardlotterytwist endinggun held to headmakeovermegalomaniactv reporterinsomniaflaskjapanese schoolgirlmegaphonepoisoninggeneration gaparenadruggedcookiebunk bedmushroomshort skirtvolunteerluckfight the systemtitle in titlehigh school girltitle same as bookgladiatorfacial scarstabbed in the facegame playingnationalismpsychotronic filmteen suicidetelevision reportermass murdererloudspeakercompassautomatic weaponbloody body of a childretreatjapanese high school girltragic villainricejumping out a windowalternate versiondeath by hangingcomputer virusshort shortsaxe fightvoice over inner thoughtsstun guncliquemoral ambiguitycontestantfoster homejumping off a cliff3 dheadbandsicklemost dangerous gamesleeping pillsmarchingends with freeze framejapanese armychild murders a childhanged boywashing hairgame of deathbuilding on firepopsiclestabbed in the crotchanti conformityschool classpesticidespear throwingbad breathbullhornvomiting bloodblood vomitingmilitary dictatorshipmillenniumminefieldhanged girlkilled with a swordchild suicideginpain killerknee socksdouble suicidelast man standinganti authoritymass child killingcult favoriteticking clockknife through the neckanesthesiadeath by poisonmachine pistolhuman hunting a humanbreaking a glass windowbutterfly knifelying in waitslitting the throat of a childgallows humorchild shot in the foreheadtransfer studentdesolate islandroll callfemale gladiatorgame of survivalschoolgirl costumelovebirdnecklace bombsexy legsclass trippropane tankcalesthenicsexplosive collarjapanese governmentburned out carself survivalleg cutwanted for murdermonitoring device (See All)

Juno (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Juno (2007)

A tale told over four seasons, starting in autumn when Juno, a 16-year-old high-school junior in Minnesota, discovers she's pregnant after one event in a chair with her best friend, Bleeker. In the waiting room of an abortion clinic, the quirky and whip-sharp Juno decides to give birth and to place  …the child with an adoptive couple. She finds one in the PennySaver personals, contacts them, tells her dad and step-mother, and carries on with school. The chosen parents, upscale yuppies (one of whom is cool and laid back, the other meticulous and uptight), meet Juno, sign papers, and the year unfolds. Will Juno's plan work, can she improvise, and what about Bleeker? (Read More)

Subgenre:
dark comedycult filmindependent filmteen movieteen comedy
Themes:
drug usepregnancyfriendshipmarriagejealousydivorcebullyingadoptionabortionmythology
Mood:
high school
Locations:
schoolhospitalsnowbicyclewheelchair
Characters:
teenage boysister sister relationshipdancerstudentteacherfemale protagonistteenage girlboyfriend girlfriend relationshipfather daughter relationshipteenagerhusband wife relationshipmother son relationshipfrienddoctorsinger …musicianbabylawyerbest friendbullysingle motherstepmother stepdaughter relationshippregnant teenager (See All)
Period:
wintersummer
Story:
school lockerdrugstorebechdel test passed16 year oldobscene finger gestureclassbasementsuburbtoiletclassroomrunningvomitingcondomurinationpanties …dancingcharacter name in titlef ratedkisssexdogone word titleflashbacktitle spoken by charactersingingtelephone callvoice over narrationcryingsongunderwearslow motion scenecomputertearsbathroomguitartelephonenewspaperbandmontagescantily clad femaleprologueprotestpay phonehigh school studentchildbirthflowerteenage sexstrong female characterteen angstloss of virginitylistening to musiccomic bookguitaristdemonstrationcomposerstrong female leadvirginitycommercialattorneyconvenience storeshopping malltitle appears in writingbanananotebenchmarital problemwilhelm screampostervideo tapeteenage pregnancyforename as titlebicyclingpregnancy testponytailclinicreceptionistautumncdmailboxpipeguitar playerpromcactusnewborn babysewing machineallergyfilm starts with sexunwanted pregnancywatching a videoanimated creditsminnesotaclerkfurnituredressingkeyboardrunnerpanties hit the floorcheerleader uniformduetunwed pregnancypapertrack and fieldultrasoundtruth or daremicrowaveorange juicehigh school athletewoman in laborunwed mothereffeminacyreference to woody allensuicide contemplationteenage motherabortion clinicfolk songhigh school promconvenience store clerkreference to kurt cobainschool cafeteriafingernailsconsidering abortionpositive pregnancy testspring the seasonreference to diana rossdeodorantfour seasonswoman holding a babydiscovering one is pregnantreference to iggy poptrack meetmoving furniturelounge chairnail salonpregnant schoolgirlfolk singingneedlepointtic tacsinfant in cast creditsanti abortion demonstrationreference to the carpenters (See All)

An American Werewolf In London (1981)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

An American Werewolf In London (1981)

Two American college students are on a walking tour of Britain and are attacked by a werewolf. One is killed, the other is mauled. The werewolf is killed but reverts to its human form, and the local townspeople are unwilling to acknowledge its existence. The surviving student begins to have nightmar …es of hunting on four feet at first but then finds that his friend and other recent victims appear to him, demanding that he commit suicide to release them from their curse, being trapped between worlds because of their unnatural deaths. (Read More)

Subgenre:
creature featureblack comedycult filmsuspensesupernaturaltragedypunkfish out of watermonster movie
Themes:
supernatural powersuicidemurderdeathfriendshiprevengesurrealismfearescapemonstervoyeurismtheftbrutalityparanoiapanic …homelessnessmurder of a police officermurder of family (See All)
Mood:
nightmaresatiregoremurder of a boy
Locations:
woodsforesthospitaltraincemeterybuslondon englandtaxivillagerural settingapartmentpolice carenglandtrucktaxi driver …laboratorysex in shower (See All)
Characters:
studentnursepolicedoctorzombiepolice officerjewishlittle boyterroramericanamerican abroadtruck driverhomeless mantalking to oneself in a mirror …police sergeantjewish americanamerican in the ukmythical creatureamerican in englandamerican in europeamerican in great britainmurder of a girl (See All)
Period:
1980s
Story:
dead boylycanthropelycanthropyhuman becoming an animalclawdead girlcovered in bloodfull moonanimal attackgothicwolfwerewolffirst partcursevan …hit by a carthroat slittingwatching tvurinationblood splattercorpseknifecigarette smokingbloodsexdogviolencefemale nuditynuditymale nuditybare breastsfemale frontal nuditymale frontal nuditymale rear nuditybare chested malesex scenefemale rear nuditychasesurprise endingshowertopless female nuditydreamshot to deathmachine guncar accidentshot in the chestblondeslow motion scenecatwritten by directorsex in bedbare buttrifleplace name in titleanimal in titlebedcar crashvoyeurtelephonef wordsubjective cameradecapitationcleavagegay slurambulancedeath of friendmontagesuicide attemptsubwayjokesevered headdream sequencescantily clad femalenews reporttransformationfive word titleracial slurpublic nuditylegenddangerfantasy sequencepay phoneumbrellacharacter's point of view camera shotproduct placementrace against timestatuecover upknocked outcollege studentlightningactor shares first name with charactercity name in titlelong takescarhairy chesttragic eventfilm within a filmpremarital sexsuspicioncharacter says i love youthreatened with a knifeprofanitylove interestpubnewspaper headlineundeadmonkeychessuziundergroundsupermarketno pantiesballoonheavy rainlooking at oneself in a mirrorcomared dressmutilationloss of friendelephantbuttockscaucasianswat teamphone boothsevered handsheepcoitushitchhikerhitchhikingrealityindianeaten aliverampagebarefootattempted suicidemercilessnessgash in the facezooevacuationpsychotronicmedicationassault riflerainstormdeertigerbody landing on a carpassionate kissethnic slurpolice inspectorkilling spreesirencopulationclose up of eyesmemory lossbriberyliving deaddirector cameoalleyapparitionjunkyardhomagesubway stationnudephysicianjukeboxnurse uniformbus stopdenialjacketnude girltavernkiss on the lipsambassadormetamorphosisoffscreen killingcrashing through a windowbitten in the necknurse outfithomeless persontragic endingmagnifying glassfemale bartenderreference to john waynepentagramdeath by gunshotmetromurder spreeanimal killingdeath of loverglowing eyesgiraffeinnocent person killedhead ripped off555 phone numberbitebloody body of a childloss of memorynurse hatwoman in showerdecomposing bodyreference to winston churchillthick accenttelling a jokefemale nursethrown through a windshielddartsedativetalking to the deadshared showerbackpackingscotland yardends with deathbackpackercontemplating suicideseclusionlondon undergroundlorrydoomed lovedream within a dreamenglish countrysidereference to queen elizabeth iiscottish highlandswaking up from a comatower bridge londontwo friendsquestioned by policereanimated corpseporno theaterhowlreference to prince charlesalmost hit by a carpiccadilly circus londoncar crashing through a windowmoorsnightmare sequencecontemporary settingmonster as victimmoor the landscapedream sequence within a dream sequencetunnel chase scenewatching a porno moviedartboardhospital patientwerewolf transformationwerewolf bitetongue in cheek humortrafalgar square londonyorkshire englandchannel surfingknock knock jokechild killed by animallondon busreference to bela lugosihackney carriagereference to the queen of englandcar pileupmonster in mirrorred jacketshooting a childreference to the alamochest ripped openporn theaterreference to claude rains (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Bride Of Chucky (1998) is one of the best movies like Ginger Snaps (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Bride Of Chucky (1998)

Chucky hooks up with another murderous doll, the bridal gown-clad Tiffany, for a Route 66 murder spree with their unwitting hosts, two eloping high-school graduates.

Subgenre:
black comedycult filmconspiracysupernatural
Themes:
supernatural powerpregnancymurderdeathloverevengesurrealismkidnappingmarriagemoneybetrayalfearescapeweddingdeception …seductionrobberypsychopathbrutalityparanoiaredemptionsadismunrequited lovepanicpolice brutalitymurder of a police officerpolice corruptionnear death experienceregret (See All)
Mood:
high schoolgorecar chaseslasherpoetic justice
Locations:
bathtubschoolhotelcemeterywaterkitchenpolice stationpolice carroad tripmotel
Characters:
teenage boyteenage girlboyfriend girlfriend relationshipteenagerpolicehomosexualtattoopolice officerserial killerdetectivepriesthostagethiefpolice detective …maidgay teenagerex boyfriend ex girlfriend relationshipuncle niece relationshipgay friendself referentialmurder of girlfriend (See All)
Period:
1990s
Story:
gothsevered fingergothicpot smokingchainsawobscene finger gestureexploding bodybaseball batlocker roomvanhit by a carthroat slittingimpalementflashlightmarijuana …dead bodyshowdownwatching tvblood splattercorpsebeatingknifephotographcigarette smokingcharacter name in titlebloodgunsexkissfightviolencesequelbare chested malechasesurprise endingpistolfirecryingcell phoneshot to deathcar accidentmirrorshot in the chestrescueslow motion scenebare buttletterheld at gunpointrock musiccar crashhandcuffsrevolvertelephonef wordorphanambushstrangulationmansionmontagebridgestabbed in the chesttied to a chairexploding carfalse accusationdisarming someonecoffindrawingdouble crossritualpolice officer killedfemme fatalegraveyardnews reportmarriage proposalon the runattempted murderargumentstalkercharacter repeating someone else's dialoguedangerstabbed in the backscreamingelectrocutionpay phonefugitiveumbrellarace against timedollknocked outlightningskeletonringscarfishnet stockingsstalkingfilm within a filmchildbirthpremarital sexratsuspiciontied upnewspaper headlinearsoncorrupt copmaniacprivate detectiveflirtingsabotagefireplacehead buttheavy rainsociopathscene during opening creditsragemutilationtoyfourth partspiderphone boothskullbirthblack humormexican standofffemale killerback from the deadmale underwearpresumed deadwoman in jeopardydamsel in distressnicknamenew jerseyblood on facemisunderstandingdual wieldgash in the faceresurrectionconvenience storedark humorshot in the faceescape attemptcigarette lighterframe upcon artistlaughterthrown through a windowbooby trapwisecrack humortitle at the endrainstormdisfigurementknife throwingraised middle fingertrailertied feetdead woman with eyes opensequel to cult favoritevoodooframed for murderprivate investigatorengagement ringclose up of eyesspellmarijuana jointabandoned buildingblood on camera lenssuffocationharassmenthysteriaface maskfinal showdownteenage lovescene before opening creditsabuse of powerpicturelighterpolice chieftelling someone to shut uphomicidal maniacdisposing of a dead bodytrailer homeframedmasturbation referenceburnt facebody in a trunkhit by a truckcookietrailer parkmacguffinwoman kills a mandomestic abusecleaning ladyburnt bodycar set on firechapeldisfigured facehit with a shovelrepeated linemultiple murderamuletknife murderrecreational vehiclepillowhandymantongue in cheekpentagrammurder of a nude womanmass murdererstupid victimvillain not really dead clicheinnocent person killedproposalgrave diggingovenasphyxiationdecomposing bodyabusive relationshipevil dollnail polishfemale serial killernailwine bottlereference to frankensteinchange of heartdead parentshockey maskfragments of glassanti villainfemale thiefstabbed in the heartknife wounddeath of unclewaterbedplanting evidenceevil laughterfalse accusation of murderhandcuffed to a bedkiller dollairbagsoul transferencedumb policereference to martha stewartincantationlovers on the lamsee you in helltwo killersaccused of murdermultiple stabbingrunaway teensmothered with a pillowknife in backchief of policesmothered to deathwoman electrocutedexploding trailerfemale sociopathreference to jerry springerhunkbreaking a plateburnedtalking dollbig nosebiting handpiercing ripped outcleaning up bloodelectrocuted in bathtublegal guardianalpha maleelectrical firereference to bonnie and clydetight dressbreathalyzernose piercinghidden bodycriminal duoerieloss of unclemeatballspushed through a windowshot through the headbindsuitebiting an earelopingtreatcrayon drawinglip piercingreference to christian slatersinister coupleplanting drugswater bed (See All)

Thirteen (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Thirteen (2003)

At the edge of adolescence, Tracy is a smart straight-A student--if not a little naive (it seems...she smokes and she cuts to alleviate the emotional pain she suffers from having a broken home and hating her mom's boyfriend, Brady.) When she befriends Evie, the most popular and beautiful girl in sch …ool, Evie leads Tracy down a path of sex, drugs and petty crime (like stealing money from purses and from stores). As Tracy transforms herself and her identity, her world becomes a boiling, emotional cauldron fueled by new tensions between her and her mother--as well as, teachers and old friends. (Read More)

Subgenre:
coming of ageindependent film
Themes:
drug usedrunkennessdrinkingdeathfriendshiplesbianismseductionrobberydivorcetheftdeath of motherdysfunctional familyhollywoodadoptiondrug addiction …cheatingself harm (See All)
Locations:
schoollos angeles californiaurban setting
Characters:
teenage boydancerstudentteacherfemale protagonistteenage girlmother daughter relationshipfather daughter relationshipfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfriendtattoobrother sister relationship …thiefactresssingle motherinterracial relationshipteacher student relationshipself mutilationself destructivenessself injury (See All)
Story:
belly button piercinggirls' bathroomhockey stickpubertydrug dealingwatching a movieobscene finger gestureclasspainvancandleclassroommarijuanadrinkpanties …dancingcigarette smokingf rateddogkisssexfightbloodfemale nuditynumber in titleone word titlethreesomefemale frontal nudityflashbacksex scenelesbian kissshowertelephone callcell phonetitle directed by femaleunderwearface slapthongliesunglassesbisexualbracocainenonlinear timelinechild abusemodeljeansliarpay phonedomestic violencechickenteen angsteggbabysitterdrug abusemovie theaterskateboardstreet lifedrug overdosehaircutshopliftingrap musicunderage drinkingshoppingdeceitclassmategrowing upjuvenile delinquenttank tophairdressermarijuana jointsexual awakeningtriple f ratedbongneedleplastic surgeryadolescencechild molestationmakeovermasochismpeer pressure13 year oldlsdteenage daughterpopularityrazor bladeexamchewing gumunderage smokingsurrogate mothereating disorderclothinglifeguardspoonjunior high schooljuvenile delinquencyabsent motherhomeworkflashingpinball machinetattoo parlorrecovering alcoholicreference to frankensteinshoe storefake idlawn sprinklerteenage rebellionbody piercingpiggy back rideearsurrogate familyhollywood boulevardvenice beach californiadress shoppromiscuous mothertongue piercingglue sniffingbad influencelatenessstashephebophiliastuffed toy animalchildhood sexual abusehuffingoverachievermorley cigarettescutting selfflunking out of schoolskating ramp (See All)

Disturbia (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Disturbia (2007)

After his father is killed in a car accident, things unravel for Kale Brecht and he is placed under house-arrest for punching his Spanish teacher. Having nothing better to do, Kale occupies himself by spying on his neighbors. But one night, he witnesses what appears to be a murder going on in Mr. Tu …rner's house. Kale becomes obsessed with uncovering the truth behind these murders but, after a few unsettling run-ins with Mr. Turner, it becomes a matter of life and death. And the ominous question: Who is watching whom? (Read More)

Subgenre:
black comedysuspense
Themes:
photographydrinkingdeathmurderfriendshiprevengekidnappingbetrayaljealousyescapeinvestigationvoyeurismpsychopathdeath of fatherparanoia …panicmurder of a police officer (See All)
Mood:
high schoolneo noirslasher
Locations:
swimming poolcarbicyclepolice carcourtroomrooftopstormfishing boat
Characters:
teenage boydancerstudentteacherboyfather daughter relationshipmother daughter relationshippoliceteenagerfather son relationshipmother son relationshipfriendserial killerpolicemanwriter …police detectivevillainterrorcousin cousin relationship (See All)
Story:
lawn mowershovelgarageobscene finger gestureclassbasementbaseball batmissing personsuburbimpalementclassroomdead bodyrunningdrinkwatching tv …blood splattercorpseknifepartydancingfightviolencegunbloodkissdogone word titletitle spoken by characterchasetelephone callcell phonefoodcar accidentpunched in the facecomputerarrestbikinibookplace name in titlebathroomneighborhandcuffsvoyeurswimmingnewspapervideo camerawomaneatingstabbed to deathstabbed in the chestjudgesevered headtrialfishingduelflash forwardbinocularsevil manreadingrabbitlightningskeletonpranklong takescarwighigh school studentstalkingwitnessneck breakinggardensubtitled scenemaniacflirtingtv newsteen angstbreaking and enteringlistening to musicsociopathcaptiveassaultpsychoskullparking garagebroken legrampagebarefootwoman in jeopardywindtelescopethunderspanishbroken glassscissorsstabbed in the legyoung lovedeerduct tapeextortioncellarkilling spreereckless drivingchocolatexboxpsychopathic killerbad guyearphonesmadmanboredomclosetlaundryhuman monsterhomicidal maniaccoca colalistening to a radiostakeoutxbox 360bunk bedplaying a video gamereference to youtubemercedes benzshirtford mustanghitchcockianbmwcamera phonenewlywedbutcher knifeleg injurysecret roomcurtainfictional cityfordhardware storetv hostchevroletsnorricamwatching someoneipoddishwashermissing womanpeanut butterhouse arrestmoving vanpsphdtvdead deerred bullgarden shearswet jeanslawn mowingporch swingoverturned carcarcasscocoonjaguar cardecomposed bodyplaystation portablefelonybagelfelonford crown victoriasurgical toolvolkswagen new beetlelexusmoverankle monitor1 year latervolvo cartwinkiesapple macbookitunesspanish teacherhonda accordlove seekingapple macbook proreference to ituneschevrolet tahoeelectronic tagford f150 pickup truckjaguar s type (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Cabin Fever (2002)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Cabin Fever (2002)

The college friends Paul, Karen, Bert, Marcy and Jeff rent an isolated cabin in the woods to spend a week together. When they arrive, a man contaminated with a weird disease asks for help to them, but they get in panic and burn the man, who falls in the water reservoir and dies. The whole group, exc …ept Karen, makes a pact of drinking only beer along the week without knowing where the dead body is. When Karen drinks tap water and gets the disease, the group begins their journey to hell. (Read More)

Subgenre:
black comedycult filmindependent filmsuspenseb movieabsurdismsurvival horrorpsychological thrillerbody horror
Themes:
drunkennessdrinkingmurderdeathfriendshiprevengefearescapebrutalityparanoiaguiltinsanityillnessunrequited lovehome invasion …exploitationpanicpolice brutalityhuntingcamping (See All)
Mood:
goreraincar chaseambiguous ending
Locations:
woodsbathtubforesthospitalbicyclewaterfarmlaketruckcavegas stationcampfirebackwoodsshed
Characters:
boyfriend girlfriend relationshippolicefather son relationshipafrican americandoctorpolice officersheriffself mutilationhomeless mankiller dog
Period:
2000s
Story:
pactdead doginfectionstabbed in the throatcovered in bloodanimal attackvirusobscene finger gesturebaseball batlatex gloveshit by a carimpalementmarijuanadead bodyvomiting …urinationblood splattercorpsebeatingpantiesknifepartyphotographcigarette smokingblooddogviolencemasturbationfemale nudityfemale frontal nudityflashbackbare chested malesex scenefemale rear nudityfingeringchasesurprise endingpistolshowerfirecell phonewoman on topshot to deathhorsecar accidentshot in the chestblondeshot in the headshotgunslow motion scenepunched in the facewritten by directorbikinibrawlbare buttrifleheld at gunpointbeerlow budget filmhallucinationrevolverguitarshot in the backf wordswimmingdecapitationcleavagesurvivalfoot chasegay slurambushaxemassacreambulancedeath of friendstabbed to deathstabbed in the chesttied to a chairbrunettefalse accusationsevered headscantily clad femaleradioshot in the legshot in the foreheadracial slurskinny dippingbinocularsblack pantiesbeaten to deathstabbed in the backkaratescreamingperson on fireproduct placementstorytellingvacationknocked outcollege studentscene during end creditsisolationpigpremarital sexthreatened with a knifedirectorial debutsevered armshot in the armvigilantecult directorcowdismembermentcorrupt copblack americanpickup truckeavesdroppingfireplaceburned aliveshot in the stomachgroup of friendsdiseasehuntereccentricgrindhousetorchpeeping tomeaten alivesexual desireredneckreverse footagetensionstealing a carunderage drinkingstabbed in the neckconvenience storerowboatescape attemptmedical examinationstabbed in the headstabbed in the legscene after end creditspunched in the chestdisembowelmentracistslaughterdeerdisfigurementranchsevered legcharacters killed one by oneflat tiresouthern accenttorso cut in halfwoman in bathtubhit with a baseball batmarijuana jointdirector cameopromiscuous womandrifterdead animalhomagehead blown offepidemiccanoemental retardationabandoned houseraftsquirreldouble barreled shotgunaccidental shootingdeputyhillbillybowling alleycabin in the woodsmercy killingoffscreen killingn wordfevercorrupt policeburnt bodymacabrequarantinehit with a shovelspitting bloodhit with a hammerdog attackimprovised weaponhermitanimal killingsevered footstupid victimcamera focus on female buttblond boyno survivorsbanjodecomposing bodystabbed in the footbitten handposseskatergeneral storeleft for deadlemonadeclicheblood vomitingcampfire storymarshmallowporch swingkilled with a hammerreservoirinfectious diseasecontaminated waterstabbed in the eardead pigstabbed with a screwdrivertoasting marshmallowsrabbit suitreference to shirley templeburning bodyleg shavingball peen hammerhit with a guitarwild dogno cell phone signalbitten in the handdumb copgroup of fivebitten in the armstabbed with a stickhuman eaten by a dogflesh eating virusreference to smokey the bear (See All)

Flatliners (1990) is one of the best movies like Ginger Snaps (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Flatliners (1990)

Medical students begin to explore the realm of near death experiences, hoping for insights. Each has their heart stopped and is revived. They begin having flashes of walking nightmares from their childhood, reflecting sins they committed or had committed against them. The experiences continue to int …ensify, and they begin to be physically beaten by their visions as they try and go deeper into the death experience to find a cure. (Read More)

Subgenre:
black comedycult filmsuspensetragedymedicalpsychological thrillerpsychological horror
Themes:
supernatural powersuicidedeathrevengesurrealismbetrayalfearescapememorydeath of fatherparanoiaredemptionguiltbullyingcruelty …panicchildhoodtraumavengeancedrug addictionforgivenessnear death experienceafterliferegretchildhood traumasuicide of father (See All)
Mood:
nightmareneo noir
Locations:
woodsforestschoolhospitaltrainsnowcemeteryurban settingapartmenttruckchicago illinoismuseumlaboratory
Characters:
nurseboyboyfriend girlfriend relationshipfather daughter relationshipafrican americandoctorchildrengirlsoldierlittle girlbullywaitresslittle boyfiance fiancee relationshipsuicide by gunshot …self surgerystudent nurse (See All)
Period:
1990s
Story:
halloween partydead boyhockey stickcurebiologygreenhouseswingplaygroundhypodermic needlegothicinjectionbaseball batimpalementflashlighthalloween …watching tvcorpsebeatingknifepartyphotographcigarette smokingdogsexbloodkissone word titlebare breastsflashbackbare chested maleinterracial sextitle spoken by characterchasesurprise endingpistoltelephone calltopless female nuditycryingshot in the headrescueslow motion scenepunched in the facefalling from heightbedbathroomhallucinationsciencetelephonef wordsubjective camerafoot chasemountainvideo cameramansionmontagedinersubwayapologyman with glassesgraveyardcigar smokingmarriage proposaltreedrug addictbeaten to deathdangerscreamingpay phonecharacter's point of view camera shotrace against timestatuedeath of childcollege studentuniversityhalloween costumelong takemanipulationscaramerican flagtragic eventdeath of husbandloss of fatherpremarital sexcharacter says i love youheroinfreeze framesurgeryhugginganswering machinesyringerevelationelectronic music scoreheavy rainlooking at oneself in a mirrorcaketape recorderwoman with glassesgroup of friendsvideotapeaccidental deathphone boothwomanizercrushed to deathback from the deadreverse footagehaunted by the pastvisionattempted suicidepower outagegash in the facepunched in the stomachresurrectionconvenience storejunkietaking a picturefalling to deathkicked in the crotchblack and white scenepunched in the chestengagementautopsyaccidental killingaerial shotfemale doctorinsultlooking at self in mirrorfieldloss of husbandsurgeonmoral dilemmachildhood memorypromiscuityatheistfast motion scenehit with a baseball batclose up of eyesintestinesreference to elvis presleyvietnam veteranalleyspit in the faceremorsename callingbully comeuppanceyoung version of characterclimbing through a windowbroken mirrorteasingscalpelmedical studentfrankensteinexperiment gone wronghome videocamcorderoperationmenacehuman experimentheroin addicthoodieswingingbrain damageanimal killingscience runs amoktrenchcoatmedical professionmedical experimentrenovationanswering machine messageel trainfall to deathjumping roperepressed memorycadavercprmedical schoolred lightdefibrillationdefibrillatorvideotaped sexdying womanhit with a rockskeleton costumeremadepickaxefalling from a treescience experimentdissectionout of body experienceneondumped by girlfriendsecret laboratorybelief in the afterlifehorror movie remadeadrenalinebullet holeconfettichildhood flashbacksplit lipswing setinside the mindvirtualitythrowing a rockmullet haircutescalationhopscotchtambourinegrade schoolnitrous oxidepathologybreaking up with boyfriendplaying godtrailer narrated by don lafontainepickup linesecret filmingwelcome home partyblue lightmedical examurban gothicbrain deadfighting with selfsweatshirtwounded dogred hoodpicture of jesusstitching one's own woundreligious imagery (See All)

The Brothers Grimm (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Brothers Grimm (2005)

Folklore collectors and con artists, Jake and Will Grimm, travel from village to village pretending to protect townsfolk from enchanted creatures and performing exorcisms. They are put to the test, however, when they encounter a real magical curse in a haunted forest with real magical beings, requir …ing genuine courage. (Read More)

Subgenre:
black comedycult filmsupernaturalfairy taleslapstick comedydark fantasy
Themes:
supernatural powerdrunkennesstorturedrinkingdeathmurderrevengesurrealismkidnappingmoneybetrayalghostprisonfearescape …monsterdeceptionmagicmilitarynaturedeath of fatherparanoiayouthsadismdyingself sacrificemythologymissing childunlikely hero (See All)
Mood:
nightmarerain
Locations:
woodsforestchurchsnowcemeterysmall townvillagecastlecavegermany
Characters:
witchsister sister relationshipdancerboyfather daughter relationshipmother son relationshipfriendbrother brother relationshipprostitutegirlsoldieractorpriesthostagelove triangle …warriormayorfrench soldier (See All)
Period:
19th century1810s
Story:
rocking horsepitchforkhairfull moongothicwoundwolfwerewolffireworkscursestabbingcandlerunningdrinkcorpse …knifedancingcharacter name in titleviolencedogfightgunkissbloodflashbacktitle spoken by characterexplosionthree word titlepistolfireunderwearfoodhorsemirrorshot in the chestshot in the headrescuecatbattleswordarrestfalling from heightbookriflebedinterrogationhallucinationshot in the backdecapitationbound and gaggedwineold manaxewomaneatingarmystabbed to deathprisonerstabbed in the chestweaponmapsnakesevered headman with glassestrialanti heroanimaldrawingchild in perildouble crossritualkingcreaturefemme fataletransformationgunshotflash forwardattempted murdergravetreestabbed in the backprologuepossessionstorytellingrace against timerabbittough girlwigcrosswitnesspighauntingrattied upsevered armgeneralqueencowtrustitalianropebow and arrowmedicineflyingcagelifting someone into the airhatbarnfraudtorchgoatstreet lifeback from the deadapplecannonfemale warriorguardreverse footagecrossbowresurrectioninsectstairscon artistdungeonshadowarmorsnowinglanternhorse and carriagelaughingsevered legdaggerexorcismpalacecrowhorseback ridingspelltombshowflagmagic trickharbortablefolkloretowerbeggarhuman sacrificeplagueselfishnessanimal crueltycrownwelltheatre productiontavernfantasy worldstablevanityhamburg germanymaggotraveninnfrenchmansorceressbegginghorse and wagonsnailguidepentagramgrim reaperbanquetliquidpitthronehatchetholy waterwoman in dangervillain turns goodgoosesittingtoadeclipsedecomposing bodytorture chamberinquisitionhand kissingcrutchfrench armycandelabratrackercatapultbook burningroyal weddingdobermanburned at the stakereference to cinderellaone legged manevil queenaccentblobcanonwolfman1790seternal youthrotting corpsela marseillaisereference to little red riding hoodturretbird attackfrankfurt germanyhayloftcobwebgingerbread mananimate treeenchantmenttrapperchild eatendeath of kinglong underwearreference to sleeping beautybrought back to lifereference to hansel and gretelhaunted forestwater wheelgrimm's fairy talesgingerbreadwater millman wearing woman's clothingchalicedragged by horsefemale stuck in sticky substancegingerbread housescrubbing floorspinning axeforeign occupationreference to jack and the beanstalkbody torn in halfhanging from heightreference to rapunzel (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Brick (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Brick (2005)

The lonely teenager Brendan finds his former girlfriend Emily dead in the entrance of a tunnel of sewage and recalls her phone call two days ago, when she said to him that she was in trouble. Brendan, who still loved Emily, met bad elements of his high-school trying to contact her, and when he succe …eded, she told him that she was OK. He hides her body in the tunnel and decides to investigate the meaning and connection of four words, including "brick" and "pin", that Emily told him to find who killed her. Using the support of his nerd friend Brain, he successively meets the small time drug dealers Kara, Dode, Brad Bramish, Laura and Tugger, to reach the teenager powerful drug dealer The Pin. Slowly, Brendan unravels the motives why Emily was killed and plots a revenge. (Read More)

Subgenre:
cult filmindependent filmteen movie
Themes:
drug usedrinkingpregnancymurderdeathdrugsmoneybetrayaldeceptionpoetrybreak up
Mood:
high schoolneo noir
Locations:
schoolbeachtunnel
Characters:
teenage boyteenage girlboyfriend girlfriend relationshipteenagermother son relationshipafrican americandetective
Story:
school lockerathletic fielddead girlbasementvandrug dealercandlehalloweenmarijuanadead bodyrunningdrinkblood splattercorpsebeating …knifepartyphotographcigarette smokingviolencegunfightbloodone word titleflashbacktitle spoken by characterchasesurprise endingpistoltelephone callcryingcell phonedreamfistfightmirrorshot in the chestface slappunched in the facetearssunglassespianostrangulationcocainenonlinear timelinesearchfemme fatalecoffeeshot in the foreheadparkattempted murderlibrarydrug addictbeaten to deathpay phonebraceletconvertiblepianistdirectorial debutheroinblack americancrime bosseyeglassespoemnerdfireplaceamerican footballwristwatchphone boothfollowing someonepuzzleclockdrug overdosebloody noseshoesunderage drinkingbackstagegash in the facecanepierdressing roomlens flareparking lotbeing followednotebookhit in the faceinformantboy with glassesdrug dealknocked unconsciousmailboxpiepipeshot point blankcluematchbroken nosesymbolshopping cartbreaking a mirrorbrickrubik's cubehigh school footballplay rehearsalhigh school athletefootball fieldceiling fanaudio flashbackslangalleywaypunched in the gutcarrying a dead bodygarbage binorange county californiawalking on a beachhiding in a car trunktrippingcigarette buttkicked in the shinaqueductletterman jackettogaschoolfightcinder blockpunched on the nosepiano scoresnorting herointeenage detectivehigh school vice principal (See All)

Underworld (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Underworld (2003)

A war has been raging between the Vampires and Lycan for centuries, Selene (Beckinsale) is a death dealer, assigned to hunt down and eradicate the last of the Lycan. When she comes across Michael Corvin (Speedman) who holds the key to end the war she must decide where her allegiances will lie.

Subgenre:
cult film
Themes:
photographysupernatural powerdeathmurderlovekidnappingbetrayaldeceptionmemoryrivalry
Mood:
gorerainnight
Locations:
hospitaltrain
Characters:
female protagonistvampirewarriortalking to oneself in a mirror
Story:
silver bulletlycanthropydark heroinebroken armmutationfull moonhypodermic needlegothicwerewolffirst partexploding bodyfirst of serieshit by a carimpalementcamera …blood splattercorpseknifepartycigarette smokingbloodflashbackbare chested maleexplosionsurprise endingpistolvoice over narrationshot to deathmachine gunshot in the chestface slapshotgunslow motion scenepunched in the facebattleswordfalling from heightrifleheld at gunpointcar crashshot in the backsubjective cameradecapitationfoot chaseambushmansionsubwayunderwater scenetransformationshot in the foreheadbeaten to deathevil manshot in the shoulderneck breakingcharacter says i love youshot in the armwhippingdismembermentstrong female charactertraitorundergroundsyringegrenadeburned alivelooking at oneself in a mirrorladderstrong female leadforbidden loveaction heroinebroken legapartment buildingslavefemale warriortarget practicewhipgash in the faceimmortalityfeudstabbed in the legjumping through a windowlatexhealinglaptop computertorso cut in halftombneedleshot in the necksubway stationstabbed in the armfemale vampirebitten in the neckman punching a womanmedical studentstabbed in the shoulderstar crossed loversopen endedbladein medias resshot through a doorfemale gunfighterkicking in a doorregenerationcamera focus on female buttvampire slayerfalling through the floorsubway trainwoman punching a manthrowing stararsenalbudapest hungaryshurikenlifted by the throatshot through a wallfangsawakeningdowntownhybridvampire bitecovenhead cut in halfchased by a dogmurder of a pregnant womanvampire human lovethrown through a wallclimbing over a fencebreaking through a wallcamera shot from inside human bodyultraviolet lightdeath of pregnant womaneyes different colorsexy female vampirelatex catsuiturban gothicskin torn offtrain depotwerewolf bitedeath of expectant mothermedical internnocturnalvampire versus werewolffather murders daughterhuman allyripped necksubway chaseancient vampirepass out from blood lossvampire driving car (See All)

Dracula 2000 (2000) is one of the best movies like Ginger Snaps (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Dracula 2000 (2000)

In the millenium version of this classic Gothic horror we find Abraham Van Helsing (Plummer), who has tangled with Count Dracula (Butler) in the past, working as an English antiques dealer. Simon (Miller) is a vampire hunter in training under his apprenticeship. Van Helsing and Simon travel from Lon …don to New Orleans to rescue Van Helsing's daughter Mary (Waddell) from the family's life long nemesis - Dracula. (Read More)

Subgenre:
black comedycoming of agecult filmmartial artssuspensesupernaturalheist
Themes:
supernatural powersuicidedeathmurderfriendshiprevengesurrealismkidnappingbetrayalfearescapedeceptionseductionrobberydeath of father …paranoiasurveillanceevilhome invasionpanic (See All)
Mood:
nightmaregore
Locations:
schoolchurchcemeteryairplanelondon englandtaxiairportpolice stationshiprooftopcatholic church
Characters:
father daughter relationshipdoctorpriesthostagethiefvampirewarriorinterracial relationshipchristianitysecurity guardbibleprofessorsecretarycatholiccatholic priest
Period:
2000s
Story:
silver bulletsilvergreenhousegothstabbed in the throathypodermic needlegothicwolfwerewolfinjectionhangingcursethroat slittingimpalementcandle …flashlightshowdownblood splattercorpseknifepartyphotographcharacter name in titlesexgunviolencebloodfightnumber in titleflashbackbare chested maleexplosionlesbian kisschasesurprise endingpistoldreamshot to deathfistfightmirrorshot in the chestshotgunrescueslow motion scenepunched in the faceswordarrestbrawlfalling from heightpaintingheld at gunpointhand to hand combatbedinterrogationhallucinationhandcuffsreference to jesus christshot in the backf worddecapitationgood versus evilsurvivalfoot chasebedroomambushold manstrangulationmassacredisguisedeath of friendstabbed to deathmixed martial artssuicide attemptstabbed in the chestmapsevered headcoffindouble crosspolice officer killedsearchfemme fatalenews reporttransformationracial slurflash forwardattempted murderlibrarypilotstabbed in the backkeyperson on fireproduct placementrace against timeevil manknocked outkicked in the facecollege studentlightningsensualitymanipulationcrossneck breakingpremarital sexthreatened with a knifedirectorial debutsevered armundeadstylized violenceropetraitordestinyburned aliverevelationscene during opening creditssecurity cameracrucifixstealingkicked in the stomachjumping from heightskullmind controlparking garagecarnivalback from the deadrampageinterracial romancereverse footageexplosivecrossbowburglaryhatredmercilessnessnew orleans louisianaresurrectionimmortalityhypnosismentorswamppunched in the chestjumping through a windowairplane crashbooby trapwisecrack humorstabbed in the eyefemale reporterkilling spreeburned to deathtelepathybullet timebatenglishman abroadimpersonating a police officernews reportertomblevitationcrucifixiondraculasuper strengthcomputer crackertelevision newsconfessionalstabbed in the armfemale vampirecameramancomputer hackerpolice interrogationone lineroffscreen killingcrashing through a windowbitten in the necksunrisewoman kills a manbody bagfilmed killingtwo way mirroropen endedwoman fights a manvaultdeath of title charactercockney accentmind readingtelevision reporterfingerprintstupid victimglowing eyesregenerationrecord storevampire slayermistmushroom cloudinvulnerabilitycoming out of retirementman fights a womanstakeblood transfusionweaponryneon signsunlightleechmardi grasstabbed in the heartout of body experienceantique dealerneongarden shearsestranged daughtervoice recording1790sbloodlustmaster apprentice relationshipfangreference to judasblood suckingvan helsingjourney shown on mapreference to judas iscariotturbulenceindestructibilitysexy female vampireretina scanantique gundeath of mentornude female silhouetteantique storeretina scan fakedreference to bram stokerancient vampirestabbed through the backzero gravity sex (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Wolf (1994)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Wolf (1994)

Worn down and out of luck, aging publisher Will Randall is at the end of his rope when a younger co-worker snatches both his job and wife out from under his nose. But after being bitten by a wolf, Will suddenly finds himself energized, more competitive than ever, and possessed with amazingly heighte …ned senses. Meanwhile, the beautiful daughter of his shrewd boss begins to fall for him - without realizing that the man she's begun to love is gradually turning into the creature by which he was bitten. (Read More)

Subgenre:
black comedycult film
Themes:
deathmurderrevengemarriageinfidelitybetrayaladulterypsychopathwealthhuntingpolice investigation
Mood:
satiremyth
Locations:
new york cityhotelsnowelevatorkitchenurban settingpolice stationoffice
Characters:
father daughter relationshippolicehusband wife relationshippolice officerwriterlawyersecurity guardpolice detectivesecretaryolder man younger woman relationshipemployer employee relationshipolder woman younger man relationship
Period:
1990swinter
Story:
lycanthroperoadkillhowlingbitten in the throatpitchforksense of smellhairsevered fingerfull moonhypodermic needlewolfwerewolftoiletshowdownwatching tv …urinationpantiespartyphotographbloodone word titletitle spoken by characterpistolshot to deathhorseslow motion scenecomputerbrawlbookanimal in titleinterrogationhandcuffsrevolvermanhattan new york cityjournalistambulancemansionnews reporttransformationparkfired from the jobattempted rapehorse ridingpremarital sexbarnloss of wifejumping from heightunfaithful wiferejectionzooco workermedical examinationsexy womandeerowllingerie slipphoto albumcontractfire extinguisherloss of jobpublishermetaphorcrisisphysicianeditorbillionaireyuppiemetamorphosisdnastablemuggingcleaning ladywoman wearing only a man's shirtfatal attractionamulethypocritenew york skylinetycoonchrysler building manhattan new york citysnoringeast indianvermontdead brothermuggerpreywolf packinstinctracehorseeyesightpublishing houseriding accidentwerewolf biteprofessionfive senseswolf bite (See All)

Elephant (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Elephant (2003)

A day in the lives of a group of average teenage high school students. The film follows every character and shows their daily routines. However two of the students plan to do something that the student body won't forget.

Subgenre:
independent filmexperimental filmpunkteen movie
Themes:
photographydrunkennesssuicidedeathmurderfriendshiprevengejealousyfearescapeangerbrutalitysadismbullyingcruelty …panicvengeance (See All)
Mood:
high school
Locations:
schoolcarschool shooting
Characters:
teenage boyphotographerstudentteacherteenage girlboyboyfriend girlfriend relationshipfather son relationshipfriendgirlgay kissbullyteacher student relationship
Story:
school lockerpot smokinglocker roomclassroommarijuanarunningcamerawatching tvblood splatterphotographdogviolencebloodgunnudity …explosionpistolshowertelephone callfireshot to deathcar accidentshotgunshootingrifleheld at gunpointbombanimal in titlebathroompianotelephonemassacrevideo cameraweaponnonlinear timelineman with glassesgunshotlibraryargumentscreamingscreamactor shares first name with characterlong takegymhigh school studentlaptopkillingstreetragetimepart of trilogyhomicidegirl with glassesexplosivethunderbackpackmercilessnessdiscussionstairsthunderstormhandheld cameraone dayclassmatepsychoticlaptop computerswastikaoutcasthigh school teachercar drivingcafeteriafirearmfemale teacherstaircaseadvicerestroomdrunk drivingconversationblackboardwalkingwarninghallwaydarkroomrunhigh school girlfrightbloodshedmultiple murderbaglunchdetentionbulimiascaregrudgedelivery manportland oregondisturbed individualcorridormultiple perspectivescity parkblond boycapfrisbeehigh school friendfemale studentmultiple homicidemass killingadolescent boyhigh school principalteenage angstadolescent girlhigh school boydeanmurderer duoschool libraryschool cafeteriafitting introubled teenage boylunchroomdisturbed personfur elisefemale classmatemultiple killingschool gymfirst time actor (See All)

Boy A (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Boy A (2007)

A young man is released from prison after many years and given a new identity in a new town. Aided by a supervisor who becomes like a father to him he finds a job and friends and hesitantly starts a relationship with a compassionate girl. But the secret of the heinous crime he committed as a boy wei …ghs down on him, and he learns that it is not so easy to escape your past. (Read More)

Subgenre:
coming of age
Themes:
cancerdrug usedrunkennessdrinkingrapesuicidedeathmurderlovefriendshipdrugsjealousyprisonfearescape …danceheroincestparanoiadepressiondysfunctional familyredemptionguiltdatingillnessabusebullyingchildhooddyingforgivenessregretdying mother (See All)
Mood:
nightmare
Locations:
bathtubschoolbarbeachrestauranttraincemeterybusnightclubwatertaxicourtroomrooftopcar theftsex in a bathtub
Characters:
photographerdancerstudentteacherboyboyfriend girlfriend relationshippolicefather son relationshipmother son relationshipfriendbrother brother relationshipgirlpolicemanlawyerlittle girl …bullywaitresssecretaryuncle nephew relationship (See All)
Story:
watching a movie on tvwormporn magazinekickingpromiseclasshangingvanclassroomcondomdrinkcamerawatching tvbeatingknife …partyphotographdancingfightviolencebloodkissfemale nuditybased on novelmale nudityflashbackbare chested malesex scenebased on true storytelephone callcryingcell phoneunderwearcar accidentmirrorface slaprescuepunched in the faceundressingbare buttsecretletterliebeertearsbirthdaybedcar crashcafejailhallucinationvoyeurrivercriminalreporternewspaperbraambulancefishchild abuseapologytrialdream sequencedrawingfishingbirthday partygraveyardold womanconfessionprologuescreamingfired from the jobliarscreamcourtgiftthreatdatewitnesslaptopmurdererex convictsleepingpubnewspaper headlinehateapplausetv newsidentityhuggingkilling an animalhead buttwarehouseloss of virginityfriendship between mensexual abusevandalismmale bondingclubfalse identitysocial commentaryembarrassmentremote controlhaunted by the pastnicknameshopliftinginnocenceshoessurveillance camerataking a pictureco workerfather figurefirst kissamusement parkschool uniformpridefriendship between boysmurder of a childbounty hunterpierpublic humiliationrelease from prisonmoral dilemmaadolescentsaving a lifenew jobgatebirthday presentsneakersmen's bathroomfirst datefake identitytowerdvdestatewalletbully comeuppanceroller coasterdiggingmale rapelandladyecstasytrain trackstrain ridebreast cancerrehabilitationsecond chancefather son estrangementparolegravestonecarouselestrangementtabloidreference to the virgin maryshared bathhoodiemerry go rounddelivery manexposechild rapedressingtrespassingfleeingleg injurymcdonald's restaurantsurrogate fatherhappy birthdayhooded figurerascaltrain conductorsaying goodbyemedia frenzynew identitychild's drawingchild murdererfollowingparole officerboardwalkchild murders a childeellimpingname changecuttingmanchestersocial realismbountycuddlingsneaking outwatching news on tvdishonestynewsstandsecret revealedsurrogate sonfootbridgebox cutterused condomearthwormdangerous friendamusement park ridedancing alonebirmingham englandlagerfirst day at worknottingham englandalecrying during sexsaying i love younew shoesrape of girlthrowing a bottletrain ticketviolent youthbrother brother incestreference to steven seagalreference to jean claude van dammebeach chairreference to don juanthank you note (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Harsh Times (2005) is one of the best movies like Ginger Snaps (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Harsh Times (2005)

Jim Davis is an ex-Army Ranger who finds himself slipping back into his old life of petty crime after a job offer from the LAPD evaporates. His best friend is pressured by his girlfriend Sylvia to find a job, but Jim is more interested in hanging out and making cash from small heists, while trying t …o get a law enforcement job so he can marry his Mexican girlfriend. (Read More)

Subgenre:
independent film
Themes:
drug usedrunkennessdrinkingpregnancymurderdeathfriendshipdrugsdeceptionmemoryrobberyangercorruptiontheftpsychopath …datingunemployment (See All)
Mood:
nightmarerain
Locations:
barlos angeles californiaurban settingpolice carmexico
Characters:
dancerboyfriend girlfriend relationshippolicehusband wife relationshipafrican americanfriendtattooprostitutepolice officerpolicemanlawyerthieflatinoex soldier
Story:
milkwatching a moviepot smokinghangingthroat slittingdrug dealermarijuanadead bodyrunningdrinkwatching tvurinationblood splattercorpsebeating …partyphotographdancingcigarette smokingfightgunkissviolencebloodexplosionchasepistolshootoutdreamshot to deathfoodmachine gunshot in the chestshot in the headshotgunpunched in the facecomputerlettershootinglierifleheld at gunpointbeersunglassesshot in the backfoot chasegay slureatingprologuefbiliarreadingcorrupt copblack americantwenty somethinganswering machinegrenademexicanhookermiddle eastgrocery storebreakupmobile phonespanishjob interviewsmugglingpool tablepunched in the stomachconvenience storekicked in the crotchpost traumatic stress disorderspecial forcesdeceitbrushing teethgovernment agentreckless drivingillegal immigrantlyingstreet gangplaying pooldrug smugglingnight visiondrunk drivingdrug dealdrug traffickingmercy killingcolombiainterracial coupleironingbreaking a bottle over someone's headlapdunwed pregnancystealing moneybilingualvisamexican immigrantlatin americanhomeland securityrecruitmilitary veteranlos angeles police departmentsurrogate brotherpolygraphurine samplejob huntingvinegarturkey basterpersian gulf war (See All)

Stir Of Echoes (1999)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Stir Of Echoes (1999)

A man is hypnotized at a party by his sister-in law. He soon has visions and dreams of a ghost of a girl. Trying to avoid this, nearly pushes him to brink of insanity as the ghost wants something from him - to find out how she died. The only way he can get his life back is finding out the truth behi …nd her death. The more he digs, the more he lets her in, the shocking truth behind her death puts his whole family in danger. (Read More)

Subgenre:
independent filmsuspense
Themes:
drug usesupernatural powerobsessiondrunkennessdrinkingpregnancysuicidedeathmurderlovekidnappingghostfearfuneralmemory …paranoiadysfunctional familyguiltafterlife (See All)
Mood:
nightmarerainmurder suicide
Locations:
bathtubcemeterychicago illinois
Characters:
teenage boysister sister relationshipteenage girlboymother daughter relationshippolicefamily relationshipshusband wife relationshipfather son relationshipmother son relationshipchildrenpolicemansuicide by gunshotbrother in law sister in law relationshipsuper hero …seeing a ghost (See All)
Story:
loss of sistershovelcovered in bloodmissing personflashlightmarijuanadead bodyvomitingdrinkwatching tvblood splattercorpseknifepartyblood …sexfightgunbased on novelbare chested malefemale rear nudityerectioncryingsongwoman on topshot to deathshot in the chestsecretshootingheld at gunpointbeerneighborhallucinationguitarshot in the backsubjective camerabandambulancesuicide attempthousenonlinear timelinecoffinsearchgraveyardtalking to the cameragraveproduct placementcover upattempted rapedisappearancesleepinghaunted housepsychicgamebabysitterguitaristamerican footballmovie theaterrailway stationremote controlchild's point of viewblood on faceunderage drinkingdelusionhypnosissuperstitionfoglooking at self in mirrorsexual assaultneighborhoodbrainsuffocationearphonesold dark houseremorsemental retardationdigginghearing voicespremonitionhypnotismbreaking a windowhearsepsychic powerfeatherwakegropingdeath of grandmotherpillowbagpipesheadachethirstmissing girlpick axestabbed in the footpassenger trainel trainextrasensory perceptionrepressed memoryfax machineorange juicegrave side ceremonyred lightclairvoyanceoraclemissing person postertalking to the deadable to see the deadbaby monitortoolyelling for helppill poppingjackhammercompulsionteeth knocked outdisorientationhard onx ray visiontalking to a ghostshooting selfsafety pinpost hypnotic suggestionjack knifemesmerismblue collar workerblock partystreet partyu haul truckswearing in front of childrenmummified bodyreverse negativebody hidden behind a wall (See All)

Scream (1996)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Scream (1996)

1 year after her mother's death, Sydney Prescott (Neve Campbell), and her friends started experiencing some strange phone calls. They later learned the calls were coming from a crazed serial killer, in a white faced mask and a large black robe, looking for revenge. His phone calls usually consist of … many questions, the main one being: Whats your favorite scary movie? Along with many scary movie trivia, ending with bloody pieces of innocent lives scattered around the small town of Woodsboro. (Read More)

Subgenre:
black comedycoming of agecult filmsuspenseconspiracypost modernslasher flickteen movieteen horrorpsychological thrillerhorror spoof
Themes:
drunkennessdeathmurderfriendshiprevengeinfidelitybetrayalfearescapeinvestigationextramarital affairdivorcepsychopathbrutalitydeath of mother …paranoiahome invasionnear death experiencedeath of daughter (See All)
Mood:
high schoolsatiregoreslasherdarkness
Locations:
woodsforestsmall townkitchenpolice stationschool bus
Characters:
teenage boyfemale protagonistteenage girlboyfriend girlfriend relationshipfather daughter relationshipmother daughter relationshipteenagerpolicefamily relationshipshusband wife relationshipfather son relationshipbrother sister relationshipserial killervillainsheriff …single fatherslasher killerself referential (See All)
Period:
1990s
Story:
fake bloodcovered in bloodfalling down stairsgaragefirst parthangingfirst of seriessuburbvirginvanthroat slittingflashlightshowdownwatching tvblood splatter …corpseknifepartycigarette smokingf ratedviolencebloodone word titlebare chested maletitle spoken by characterchasesurprise endingpistolfirecell phoneshot to deathcar accidentshot in the chestblondeface slapshot in the headrescueslow motion scenepunched in the facecomputercatarrestfalling from heightmaskheld at gunpointbeercar crashinterrogationhandcuffstelevisiontelephonef wordsubjective camerasurvivalfoot chasebound and gaggedcaliforniadisguiseambulancedeath of friendstabbed to deathstabbed in the chestweapontied to a chairbrunettefalse accusationno opening creditsdisarming someonenews reportshot in the foreheadstalkerdangerstabbed in the backwidowerelectrocutioncharacter's point of view camera shotproduct placementscreamprankshot in the shoulderamerican flaghigh school studentstalkingcheerleaderpremarital sexsuspicionthreatened with a knifecult directorsingle parentstrong female charactereavesdroppingropeanswering machineteen angstrevelationnipples visible through clothingloss of virginityheroinelifting someone into the airgroup of friendskicked in the stomachvideotapegossipfaked deathstrong female leadcrushed to deathsocial commentaryhomicidemasked manpresumed deadduct tape over mouthcrime scenedamsel in distresscameohaunted by the paststealing a carunderage drinkingpower outageevacuationplot twistescape attemptframe upstabbed in the legfat manjumping through a windowdisembowelmentblood on shirtconvictlens flarefemale reportercharacters killed one by onemasked killerframed for murdermedia coveragenews reporterintestinesanniversaryyellingdirector cameohiding in a closethigh school teacherhomagevideo storediscoverypopcornclimbing through a windowwhodunitcameramandeputycrushed headjockdeath of boyfriendrepeated linetragic pasttabloidpsychological torturewrongful imprisonmenttelevision reporterfamous linevillain not really dead clichewrongful arrestbreaking a bottle over someone's headwoman in dangerquestionred herringwater fountainsittingfalling off a roofdutch anglerookie copmystery killergeneration xcut armcurfewloss of girlfriendaccomplicehigh school principalabandoned cardead teenagerhomoeroticteen violencemurderer duovideo store clerkthreatening telephone callhanged bodyend credits roll callknife in backreflection in eyemotivehit with a doorphone terrorhiding in a bathroomtelephone terrortrailer narrated by don lafontainemetafictionreference to richard gerevoice changerreference to freddy kruegerwatching horror movie on tvintestinereference to meg ryanbeer bongbased on paintingfilm geekreference to anthony perkinsreference to ricki lakewatching a horror moviereference to jamie lee curtis (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Trick 'r Treat (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Trick 'r Treat (2007)

Five interwoven stories that occur on the same block, on the same night. A couple finds what happens when they blow a jack o' lantern out before midnight, a high school principal has a secret life as a serial killer, a college virgin might have met the right guy for her, a group of mean teens play a … prank that they take too far, and a hermit is visited by a special trick or treater. (Read More)

Subgenre:
dark comedyblack comedycult filmsuspenseparanormal phenomenaholiday horror
Themes:
murderfriendshipmonster
Mood:
high schoolgoreone night
Locations:
woodsschoolelevatorschool busbus driverbus accidentkitchen knifeschool bus driver
Characters:
sister sister relationshipzombieserial killervampireself mutilation
Story:
halloween partyface ripped offshovelsevered fingerfull moonfalling down stairswerewolffirst partbasementbaseball batpoisonvirginthroat slittingcandlehalloween …blood splattercorpsebeatingknifepartyphotographdancingdogbloodfemale nuditybare chested maletitle spoken by characterchasethree word titlesurprise endingfirepunctuation in titleshot in the chestshot in the headshotgunpunched in the facemaskheld at gunpointapostrophe in titleneighboralcoholdecapitationcleavagebranonlinear timelinesevered headchild in perilanthologydrowningtransformationgraveattempted rapehalloween costumedisappearancecheerleaderthreatened with a knifesevered armdismembermentundeadkilling an animalloss of virginitycomic bookvandalismsevered handhome moviegenocidepeeping tombroken legeaten alivegirl with glassesstabbed in the legblood on shirtmurder of a childdressing roompumpkinchildhood memorypractical jokeintestinesbarking dogliving deadbag over headhead blown offtrick or treatingdead childrendisposing of a dead bodyamazonfemale vampiredrumdouble barreled shotgunprincipalpoisoninglollipopbitten in the neckdripping bloodfinger cut offrazor bladebased on short filmscarecrowkiller childchainedhit with a shovelnewscastgropingsome scenes in black and whitesexual initiationtricknon statutory female on male rapebutcher knifewitch costumegrim reaperhermitold housecut handshopping cartghoulbreaking a mirrorglowing eyesjack o'lanternarm slingleg woundvolkswagen beetlepirate costumebloody body of a childfalling through the floorwagonchild swearingchanging roomclothes rippinggross out humordental bracesscrollshacklesquarryscreaming in fearstabbed in the footfire breathingchild killerhaving sex with skirt hiked upclown costumehead bandageinterlinked storiesvampire costumecat costumedisembodied handhanged womanhalloween candyhalloween prankmentally challengedpink brastartledcandy barprincess costumeviolent sex911 callangel costumehalloween decorationvomiting bloodreference to snow whitecleaverfat boypornographic videofire eaterchocolate barporno moviedecorationmaulingprank gone wrongburying a dead bodygarden gnomerabbit costumered riding hoodcalling for helpsevered limbbroken glasseschastitysardonictwisted ankleheavy pettingbiting someonefreight elevatorhalloween maskfat kidhowlpumpkin headterriertrippingnews crewdecapitated childrobot costumeburying a bodyrotary phonesmashed pumpkinpredator turns victimplanting a treedriving off a cliffvampire teethchild shot in the foreheadpeeling skinporno tapepush up brasamhainwalking on the ceilingsack maskstudent principal relationshipplaying hard to getbaby costumebloody sheetcrawling handlittle bo peeprock quarrybus falling off a cliffpoisoned candygiant lollipopfive chaptersjumping on someonequarry lake (See All)

Mother (2009) is one of the best movies like Ginger Snaps (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Mother (2009)

A mother lives quietly with her twenty-eight-year-old son, Do-joon, providing herbs and acupuncture to neighbors. One day, a girl is brutally murdered, and Do-joon is charged with the killing. Now, it's his mother's call whether to prove him innocent or to leave him imprisoned.

Subgenre:
black comedysuspense
Themes:
drunkennessdrinkingpregnancydeathmurderfriendshiprevengemoneybetrayalprisonfearfuneralinvestigationmemoryblackmail …guiltbullyingexploitationdisabilitywritingpolice investigation (See All)
Mood:
satirerain
Locations:
woodsforestbarrestaurantcemeterysmall townbuspolice stationrooftopbar hostessrunning after a car
Characters:
dancerfemale protagonistteenage girlboymother daughter relationshippolicehusband wife relationshipmother son relationshipfriendgirlpolice officerdetectivepolicemanlawyermother …professorgrandmother granddaughter relationshipmother love (See All)
Period:
year 2002
Story:
killing a dogmenstruationkickingpainhit by a cartoiletcandleflashlightdead bodyrunningvomitingdrinkwatching tvurinationblood splatter …corpsebeatingpantiesphotographdancingcigarette smokingviolencesexbloodfightdogfemale nudityone word titleflashbackbare chested malesurprise endingfirecryingcell phonewoman on topunderwearfoodcar accidentmirrorface slapcomputerarrestundressingbooktearscar crashinterrogationcafehandcuffssubjective camerabraold maneatingfalse accusationsearchgraveyardpantyhosecoffeeflash forwardconfessionmicrophoneprologueumbrellamissiondebtcountrysideschoolgirlsuspicionsleepingarsonrockgolfteamedicinekilling an animalbreaking and enteringhidingassaultnosebleeddesperationfollowing someoneapplemental institutionwatching televisioncrime sceneprison guardbloody noseinnocencewindsufferingattempted suicidebackpackmisunderstandingsoncigarette lighterhit on the headschool uniformdrunkevidenceatticlipstickone daysuspectfieldframed for murdermannequinmudbeing followedbriberyhit and runface maskneedlegolf clubname callingmental retardationabandoned houseteasingsoupgolf coursesouth koreaponddocumentpsychiatric hospitalfacial scarroofhitchcockianspitting bloodpool of bloodcalendaroverhead shotretreatwrenchriceshackrearview mirrorgolf cartmirror ballwatching sexacupunctureostracismcalling someone an idiotgolf ballforensicspublic urinationscapegoatsanitariumtaking off pantsdragging a dead bodyband aidbludgeoned to deathoverprotective mothermementocyanideherbelderly manprison visitationteeth knocked outfacial bruisewading in waterchief of policeelderly protagonistdog hit by a cartofuman undressing a womanscrubbing a floorping pong ballbus tourcleaning up bloodherbalistvomiting in a toiletmob ruletv antennachestnutmentally handicapped personacupuncturistbuilding a firefinger injuryvirilityseoul south koreavomiting into a toilettampaxattempted filicideclimbing up a hillhit on the back of one's headrice cakeeating from a cankicking a car (See All)

Critters (1986)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Critters (1986)

A massive ball of furry creatures from another world eat their way through a small mid-western town followed by intergalactic bounty hunters opposed only by militant townspeople.

Subgenre:
creature featureblack comedycult filmindependent filmsuspenseb moviesurvival horrormonster movie
Themes:
supernatural powerdrunkennessmurderdeathlovesurrealismkidnappingfearescapemonsterdeceptionparanoiahome invasionpaniccourage …near death experiencespace travel (See All)
Mood:
satirenight
Locations:
barchurchhelicoptersmall townbicyclekitchenpolice stationfarmpolice carrooftopouter spacebicycle accident
Characters:
teenage girlboyfriend girlfriend relationshipfather daughter relationshipmother daughter relationshipteenagerfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipbrother sister relationshippolice officeralienpriesthostagelittle boy …alcoholicsheriffalien monster (See All)
Period:
1980s
Story:
dead boypitchforkbroken armmutationfireworksfirst partexploding bodybaseball batpoisonfirst of seriestoiletimpalementflashlightwatching tvblood splatter …corpseknifephotographcigarette smokingbloodviolenceone word titletitle spoken by characterexplosionsurprise endingfireshot to deathcar accidentshot in the chestshotgunrescueslow motion scenecatrifleheld at gunpointbombcar crashrevolveralcoholtelephonesubjective camerasurvivalbedroomambushaxeradiochild in perilspaceshipcreaturepolice officer killednews reportbartendertreedangerprologuescreamingelectrocutionpay phonefugitivecharacter's point of view camera shotmissionrace against timeknocked outlightningprankcowsubtitled sceneufoarsonpickup trucksabotagedestructionburned aliveelectronic music scoreeggscene during opening creditsbarnjail cellspacecrafteccentricphone boothlasersocial commentarybroken legeaten alivemechanicredneckwhiskeyalien invasionwoman in jeopardydamsel in distressreverse footagestealing a carbraveryimpostormercilessnesspower outagechaospool tableevacuationhousewifepsychotronicescape attemptcigarette lighterhologramone daybounty huntersiegebowlinglaughingcellarburned to deathlaser gunsouthern accenthit with a baseball batclose up of eyesextraterrestrialmolotov cocktailhomageteenage lovescene before opening creditssuper strengthfarmhousebowling alleyreverendasteroidaudio cassetteconsumerismdeath of boyfriendslingshothijackingshockshot in the throatalien contactexploding houseexploding shipkansaspsychotronic filmimprovised weaponprison wardenstupid victimclimbing out a windowglowing eyesalien creaturefirecrackeralien racehostile takeoverearth viewed from spacechild swearingchild with a gunmushroom cloudhuman alienhuman versus alienorganistruralloss of boyfriendenglish subtitles in originalkidnapped girlspikeclichedeus ex machinatranquilizerevil laughterhumanoid alienhovercraftstolen police carshape shiftingshape shifting alienhayloftman eating monsterman with a ponytailreference to john travoltatransmissionhuman duplicationgroundedspray canboy eatengas lampcattle mutilationfictional languageextraterrestrial alienbitten in the armalien versus alienchurch organbitten in the legfiling (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

High Tension (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

High Tension (2003)

Alexia travels with her friend Marie to spend a couple of days with her family in their farm in the country. They arrive late and they are welcomed by Alexia's father. Late in the night, a sadistic and sick killer breaks into the farmhouse, slaughters Alexia's family--including their dog--and kidnap …s Alexia. Marie hides from the criminal and tries to help the hysterical and frightened Alexia, chase the maniac, and disclose his identity in the end. (Read More)

Subgenre:
independent filmsuspenseb movieb horrorindependent horrorsadistic horrorpsychological horrorfrench horrorhorror b movie
Themes:
torturerapedeathmurderfriendshipsurrealismkidnappingfearpsychopathdeath of fatherbrutalitydeath of motherinsanitysadismevil …unrequited lovehome invasionexploitationdeath of wifemadnessmurder of fathermurder of husbandmurder of mothermurder of brothermurder of son (See All)
Mood:
nightmaregorecar chasenightslasherdarknessblood and gore
Locations:
woodsbathtubforesthospitalrural settingroad tripfrancetruckgas stationsinging in a carbackwoodsback country
Characters:
studentfemale protagonistteenage girlboymother daughter relationshipfather daughter relationshippolicefamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfriendbrother sister relationshipserial killerbest friend …killervillainterrorfrenchslasher killerbest friendsmysterious villainserial murderermysterious killerdeath of boy (See All)
Story:
bludgeoningkilling a doggreenhousepiercingdead dogswingstabbed in the stomachchainsawvanthroat slittingimpalementstabbingflashlightdead bodyurination …blood splattercorpseknifephotographcigarette smokingf rateddoggunmasturbationviolencebloodfemale nuditybare breastsfemale frontal nudityflashbacklesbian kisschasesurprise endingshowertelephone calldreamcar accidentmirrorshot in the headshotgunslow motion sceneshootingriflesunglassesbedcar crashlow budget filmbathroomneighborvoyeurtelephoneshot in the backsubjective cameradecapitationsurvivalbound and gaggedaxemassacrestabbed in the chesthousesevered headscantily clad femaleon the rundollevil mandeath of childdeath of brotherpursuitstalkingdeath of sondeath of husbandmurderersleepingeuropekillingblood spattersplatterchild murdermaniacfireplacekilling an animalmass murderlistening to musicsurvivormutilationpsychosevered handgrindhousestrangerrape victimfollowing someonerapistfemale killerrampagerednecktensionsurveillance cameramobile phonegash in the facebroken glassmental hospitalplot twistbutcherperversionmurder of a childslaughterclassmatebody countaxe murdersexual assaultcharacters killed one by onekilling spreeparrotpsycho killerbeing followedpervertblood on camera lensserial murderpsychopathic killersuffocationtaking a showerbarbed wirevideo surveillancebad guyearphonesmadmanclosetnecrophiliaminimal castkillhuman monsterhomicidal maniacfarmhousefemale psychopathslashinglistening to a radiocornfieldrazor bladeurinalexamfemale villainevil womanextreme violencemurder of wifefilling stationgraphic violencemurderessstabbed in the facecar radiohiding under a beddeath of familyfeetcut into pieceslesbian subtextbloody violencebutcher knifefemale victimsadistic psychopathmurder spreevineyardchainsdriving at nightdisturbed individualbutcherygrindhouse filmwalkmanexploitation filmcrime spreestraight razorcreepbloody body of a childdeeply disturbed personserial rapistsexual predatorgas station attendantfemale serial killerplastic bagweirdocircular sawpadlockbreaking a car windowdoor bellmultiple personality disordergiallo esquepolice vanpsychiatric wardgory violencesickoaxe murdererbad girlpreyambient musicunreliable narratorfemale murdererjumpsuitshower curtainnecrophiliacvision of the futureaxe in the cheststabhead in a toiletstabbed with glasskeychainsex with the deadfrench shock cinemapierced belly buttonsadistic killersouthern francefemale victimsfrench cinemalesbian lead charactergas pumpslashed to deathearplugsrear ending a carpsychotic killerserial rapesolarisationfrench manserial killing (See All)

The Lovely Bones (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Lovely Bones (2009)

A 14-year-old girl in suburban 1970's Pennsylvania is murdered by her neighbor. She tells the story from the place between Heaven and Earth, showing the lives of the people around her and how they have changed all while attempting to get someone to find her lost body.

Subgenre:
suspense
Themes:
obsessiondrinkingrapemurderdeathsurrealismfuneralinvestigationvoyeurismmemoryredemptionpoetryhome invasionhopemurder investigation …death of daughterafterlifemissing child (See All)
Mood:
rain
Locations:
bathtubschoolhospitalsnowcemeterybicycletaxifarmpolice carlaketaxi driverschool buskitchen firerunning in water
Characters:
teenage boysister sister relationshipphotographerdancerteenage girlfather daughter relationshipmother daughter relationshippolicefamily relationshipshusband wife relationshipfather son relationshipmother son relationshipdoctorbrother sister relationshipserial killer …detectivepolicemanlittle girllittle boygrandmother granddaughter relationship (See All)
Period:
1970syear 1973
Story:
school lockerdead girlbaseball batflowerssuburbcandleflashlightdead bodyrunningdrinkcamerawatching tvblood splattercorpsebeating …knifephotographdancingcigarette smokingf ratedblooddogkissbased on novelflashbacktitle spoken by characterchasethree word titletelephone callfirevoice over narrationcryingdreamfoodfalling from heightpaintingbooktearsbirthdayneighborvoyeursubjective camerasocceraxemontageeatingno opening creditspainterunderwater scenesearchflash forwardtreestalkerfantasy sequencesuitcaseevil manreadinglightningpursuitsuspicionhatestrong female characterrecord playereyeglassespoembreaking and enteringhatjogginghammerhidingassaultaccidental deathteddy bearladderfollowing someonecrying manrapistbreakfastback from the deadshoesshopping mallfirst kissheavendead childpedophileevidencedeath of sisteralternate realitynotefieldcellarreckless drivingnewspaper clippingphoto albummudhit with a baseball batbeing followedlighthousepervertserial murdersaving a lifebad guypedophiliateenage lovechild molestationshipwrecklost lovevacuum cleanerbroken windowdigging14 year oldfalling into watercornfieldteenage crushwashing machinechild molestertrapdoorpurgatoryreturning homemolestationchild rapediverclimbing out a windowmurder victimcreepscrapbookserial rapistmultiple murderssexual predatorcuriositysnowglobechild killerwatching someonebreaking down a doorbeing watcheddollhousetoy storechild murdererdead teenagergrandfather clocknarration from the gravebased on young adult novelgazebosinkserial child killerfigurinestuffed animal toywall safelock of hairiciclereference to coca colaclubhousesinkholewheat fieldleg in a caststocking capstraight edge razorpainting toenailsrape of a minorelectric trainserial teen killerreference to laurence oliviermodel shipfloating in spacebreaking a glass windowsoda popdelawareroll of filmmodel builderunderground hideoutfruit pickership in a bottlefilm developingcharm braceletbeauty treatmentbicycle bellbreaking glass bottlegirl driving a carhiding under floorboardsinstamatic camerastocking feetbottle openerhammer and nailsdeath of teenage girlvoice over note (See All)

The Basketball Diaries (1995) is one of the best movies like Ginger Snaps (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Basketball Diaries (1995)

Film adaptation of street tough Jim Carroll's epistle about his kaleidoscopic free fall into the harrowing world of drug addiction. As a member of a seemingly unbeatable high school basketball squad, Jim's life centers around the basketball court and the court becomes a metaphor for the world in his … mind. A best friend who is dying of leukemia, a coach ("Swifty") who takes unacceptable liberties with the boys on his team, teenage sexual angst, and an unhealthy appetite for heroin -- all of these begin to encroach on young Jim's dream of becoming a basketball star. Soon, the dark streets of New York become a refuge from his mother's mounting concern for her son. He can't go home and his only escape from the reality of the streets is heroin for which he steals, robs and prostitutes himself. Only with the help of Reggie, an older neighborhood friend with whom Jim "picked up a game" now and then, is he able to begin the long journey back to sanity. (Read More)

Subgenre:
coming of ageindependent filmautobiographicalbased on autobiographyfamily tragedybasketball movie
Themes:
drug usedrunkennessdrinkingmurderdeathfriendshipdrugsreligionmoneyprisonmemoryrobberyangercorruptiontheft …brutalityhumiliationillnessmental illnessabusedyingdrug addiction (See All)
Mood:
high schoolnightmarerainnight
Locations:
bathtubschoolhospitalnew york cityrestaurantchurchhotelsnowbuskitchenwheelchairurban settingapartmentpolice carcity …rooftopcatholic churchcar theftcatholic schoolschool shootingfire escape (See All)
Characters:
teenage boystudentteacherteenage girlteenagerpolicemother son relationshipafrican americanfriendbrother brother relationshipprostitutepolicemanwriterpriest …thiefbest friendbullylatinocatholicself destructiveness (See All)
Story:
dead boydrugstorebroken armkickinghypodermic needleclassbasementinjectionlocker roomtoiletdrug dealerclassroomrunningvomitingcondom …drinkwatching tvurinationbeatingknifephotographcigarette smokingsexfightgunkissbloodmasturbationfemale nuditybased on novelmale nuditymale rear nuditychaseerectionbased on true storytelephone callvoice over narrationcryingbased on bookunderweartesticlesfoodshot in the chestface slapshotgunslow motion scenearrestundressingfalling from heightshootingrifletearscafebathroomneighborprostitutionjailhallucinationprayerrevolvermanhattan new york citystrippertelephoneshot in the backswimmingbragangbasketballdeath of friendeatingcocainedinercoffinspankinglooking at the cameratalking to the cameraracial slurconfessionparkpublic nuditydrug addicthotel roomprologuekeyfantasy sequencestorytellinglightningringdiaryprankscargympursuithigh school studentcrossthreatstagepoetreference to william shakespeareheroinblack americancoachpoemapplausetv newspornographysyringeteen angstathletewhat happened to epilogueaddictionbreaking and enteringdruggroup of friendsice creamloss of friendcrucifixstealingdrug abuseassaultnosebleedwristwatchdesperationjumping from heightaudiencestreet lifeapartment buildingdrug overdosestealing a carbloody nosepillshypocrisyjunkieschool uniformbilliardsraised middle fingerclassmatebigotryjuvenile delinquentferryreckless drivingphysical abusesandwichhigh school teachersports teamsnorting cocainejournalcorporal punishmentskinheadbitternessconfessionalgun held to headdegradationstonedhamburgermooningleukemiaracial prejudicebummale prostitutiondecadencehypocriteanguishsex shopmolestationbasketball playerjuvenile delinquencypool halldoormanfast food restaurantpeep holewhipped creamcasketdrug tripman in a wheelchairends with biographical notesbaldnessaddictfalling off a roofpaddlehigh school friendgodfatherjumping off a cliffbasketball courthigh school athletepadlockhand on crotchdrug withdrawalboys' schoolbasketball teaminnocence lostarm castcash registerdeliberate crueltyhigh school basketballpill poppingschool expulsionfalling downboyhood frienderotic dancingbasketball coachpastiesclimbing over a fencegodmotherhandwritingmedicine cabinet42nd street manhattan new york cityhigh school sportsirish accentarm in a castcold turkeytoilet sexhot wiring a cartheatre marqueebreaking into a carovercoatcliff divingtalking through a doorlistening at a doorbreaking a glass doorteenage rebellying in stateclimbing a fire escapeheroin detoxreference to wilt chamberlainrunning through fieldsboys' locker roomdiarist (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Cell (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Cell (2016)

When a strange signal pulsates through all cell phone networks worldwide, it starts a murderous epidemic of epic proportions when users become bloodthirsty creatures, and a group of people in New England are among the survivors to deal with the ensuing chaos after.

Subgenre:
independent filmsuspensesupernaturalpost apocalypsesurvival horrorzombie apocalypsedisaster film
Themes:
supernatural powerdrunkennesssuicidemurderdeathrevengefearescapedeceptionbrutalityparanoiainsanitysurveillancehome invasionpanic …apocalypsecannibalismnear death experience (See All)
Mood:
nightmaregorebehind the scenesambiguous ending
Locations:
woodsforestbartraincemeteryairplaneairportkitchenapartmentcampfiretunnelschool teachercar bombnew englandcar fire …train driver (See All)
Characters:
studentteacherteenage girlboyfriend girlfriend relationshipteenagerfather son relationshipmother son relationshipbrother sister relationshipzombiepolice officerartistsecurity guardteacher student relationship
Period:
2010s
Story:
mutationshovelcovered in bloodburialvirusexploding bodybaseball bathit by a cartoiletimpalementflashlightshowdownblood splattercorpsebeating …knifepartydancingcigarette smokingdogfightviolencebloodbased on novelone word titletitle spoken by characterexplosionchasesurprise endingpistolfirebased on bookcell phonedreamshot to deathshot in the chestshot in the headshotgunrescueslow motion scenecatswordbrawlfalling from heightrifleheld at gunpointbombshot in the backsurvivalfoot chaseambushaxemontagestabbed to deathdinerstabbed in the chestsubwayexploding cardisarming someonedrawingchild in perildouble crosssearchtransformationshot in the foreheadbartenderattempted murderbeaten to deathdangerscreamingkeyperson on fireattackfantasy sequencepay phoneon the roadundeaddisasterfireplacebow and arrowburned aliverevelationmachetelistening to musicscene during opening creditssurvivormutantcooksecurity cameracaught having sexeccentricmind controlend of the worldeaten alivebarefootmobile phonedual wielditalian americanboston massachusettscannibalchaosstabbed in the legairplane crashaccidental killingaerial shotatticblood on shirtdisfigurementrefrigeratorgasolineaxe murderburned to deathsmokesurprise after end creditshit with a baseball batenglishman abroadtext messagingdjmysterious manliving deadvietnam veteranfinal showdownbag over headhiding in a closetconstruction workervomitepidemictowerworld dominationabandoned housejukeboxmegalomaniacinsomniaanarchyexploding truckdamman kills a womansuicide bomberwoman kills a manburnt bodymetal detectortitle same as bookmatricidecrowbarpool of bloodmainehoodiemass gravepsychotronic filmimprovised weaponexploding airplanehusband murders wifeman hits a womangrindhouse filmvietnam war veteransausageice cream truckdoomsdayhooded figurec4 explosivesscreenplay adapted by authorset on fireconspiracy theoristtaxidermyabandoned cartire ironairport securitybased on the works of stephen kingelectromagnetic pulsehusband wife estrangementmass deathstrapped to a bombthrown from heighttennis ballfoaming at the mouthdrive in theaterwoman murders a manshared dreamsignalabandoned apartmentaxe in the chesthordehooded sweatshirtinsomniacabandoned cityexplosives expertabandoned schoolprep schoolterminalwhiskysoccer fieldcontrol towerfalse endingcell phone detonatorsuicide vestmysterious figure (See All)

The Neon Demon (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Neon Demon (2016)

The sixteen year-old aspiring model Jesse arrives in Los Angeles expecting to be a successful model. The aspirant photographer Dean takes photos for her portfolio and dates her. Jesse befriends the lesbian makeup artist Ruby and then the envious models Gigi and Sarah in a party. Meanwhile the agency … considers Jesse beautiful with a "thing" that makes her different and she is sent to the professional photographer Jack. Jesse attracts he attention of the industry and has a successful beginning of career. But Ruby, Gigi and Sarah are capable to do anything to get her "thing". (Read More)

Subgenre:
dark comedyblack comedycoming of ageindependent filmexperimental filmsuspenseconspiracyfish out of waterarthousemurder conspiracymodern fairy tale
Themes:
obsessionrapesuicidemurderdeathrevengesurrealismbetrayaljealousylesbianismfeardeceptionseductionpsychopathbrutality …youthrivalryunrequited loveexploitationpaniccannibalismfashiongetting away with murderfear of sex (See All)
Mood:
nightmaregoreneo noiravant gardestylization
Locations:
bathtubbeachrestaurantswimming poolmotorcyclelos angeles californianightclubdesertmotel
Characters:
photographerfemale protagonistteenage girlboyfriend girlfriend relationshipteenagerwaitresslustaustraliancoronersuicide by stabbingmake up artist
Period:
2010s
Story:
fake bloodneon light16 year oldcovered in bloodfull moonburialbaseball batvirginlatex glovestoiletflashlightdead bodycamerablood splattercorpse …knifepartyphotographbloodviolencefemale nuditynuditybare breastsfemale frontal nudityflashbackfemale full frontal nuditylesbian kisschasesurprise endingshowertopless female nuditycell phonedreammirrorblondeface slapslow motion scenepunched in the facewritten by directorundressingsunglassesbedf wordfoot chaseorphanbracaliforniamansiondinerstabbed in the chestmodeldouble crosslesbian interestfemme fatalenecklacedangerfantasy sequencecover upfull frontal female nudityscene during end creditsattempted rapelong takegardenthreatened with a knifecult directorlgbtwarehouseelectronic music scorelooking at oneself in a mirrorsociopathbeardmorguegossiprapistsocial commentarychokingphoto shootbackstagecannibalmercilessnessrejectionimmortalitydeath of protagonistrivalsexploitationliondisembowelmentlipstickmustachedressing roomlens flaresports carsymbolismmain character diestaking a photographnecrophiliaforced to striphuman monstereyemetaphormotel roomvery little dialoguefemale psychopathnaivetyfashion designernarcissismbeach houseoffscreen killingeyeballfemale villaindesignerfuneral homefatal attractiontragic pastnude modelingcamera phoneblack dresskicking in a doormortuarybreaking a mirrortechno musicregenerationstabbed with scissorswomen's bathroomfetishismstrobe lightsurprise during end creditsbody imageplastic surgeonnarcissistred lightcatwalkphoto studiogiallo esquewild animaltriangleneonvomiting bloodfashion industryfemale murdererpasadena californianecrophiliacamoralitypuritysheetempty swimming poolpushed into a swimming poolfemale sociopathfemale virginguilt riddendream likedriving licencemodel agencyvitalityfemale rapistpumapremeditated murderbathorypukingnaked female corpseevil winsfemale rivalryspringboardmotel ownerkissing a mirrormurder cover uppushed to deathrevitalizationaspiring modeleating eyegag reflexremorselessness (See All)

Persepolis (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Persepolis (2007)

In 1970s Iran, Marjane 'Marji' Statrapi watches events through her young eyes and her idealistic family of a long dream being fulfilled of the hated Shah's defeat in the Iranian Revolution of 1979. However as Marji grows up, she witnesses first hand how the new Iran, now ruled by Islamic fundamental …ists, has become a repressive tyranny on its own. With Marji dangerously refusing to remain silent at this injustice, her parents send her abroad to Vienna to study for a better life. However, this change proves an equally difficult trial with the young woman finding herself in a different culture loaded with abrasive characters and profound disappointments that deeply trouble her. Even when she returns home, Marji finds that both she and homeland have changed too much and the young woman and her loving family must decide where she truly belongs. (Read More)

Subgenre:
coming of agemartial artsautobiographicaladult animationbased on autobiography
Themes:
drug usetorturedrinkingdeathmurderlovefriendshipsurrealismmarriageinfidelitychristmasreligionpoliticsprisonfear …weddingfuneralmemorytravelangerdivorcetheftdepressionblackmailguiltunfaithfulnessexecutionchildhoodhomelessnessfreedomjusticephilosophyforgivenessrevolutionfirst loveclaustrophobiareligious intolerancemurder of sister (See All)
Mood:
high schoolnightmarerain
Locations:
bathtubschoolhospitalrestaurantsnowmotorcyclecemeteryparis francenightclubbicycletaxiairportwheelchaircityfrance …rooftopschool teacher (See All)
Characters:
teenage boydancerstudentteacherfemale protagonistteenage girlboyboyfriend girlfriend relationshipmother daughter relationshipfather daughter relationshippolicefamily relationshipshomosexualfather son relationship …mother son relationshipfrienddoctorchildrenprostitutegirlsoldierpolicemanthiefreference to godmuslimcousin cousin relationshipuncle nephew relationshipgrandmother granddaughter relationshipuncle niece relationshipgrandfather granddaughter relationshipbakerart studentcheating on one's girlfriendphilosophy teacher (See All)
Period:
1980s1990s1970syear 1986year 1982year 1992year 1978
Story:
coughing bloodpubertyburialwatching a moviewoundobscene finger gestureclassbasementhangingpaintoiletflashlightclassroommarijuanadead body …runningvomitingdrinkwatching tvcorpsepartydancingcigarette smokingf ratedfightdogbloodkissone word titleflashbackexplosionchaseshowertelephone callvoice over narrationcryingtitle directed by femaledreamfoodcatbattlearrestfalling from heightshootingbooklieriflebeertearsbedcafeneighborjailhallucinationprayersurvivalnewspaperbracookingwinebased on comic bookold manmountaineatingarmysuicide attemptfishmodelfalse accusationnunbirdold womandrowningflash forwardgravekarateprotestkeyliarpay phonestorytellingsuitcasereadingtankuniversitypursuitcrossfilm within a filmpremarital sexelectionflowerwhippingrefugeeciatherapyheart attacktwenty somethingsurgerymissilehuggingtraitorsupermarketgrenadefaintinglawsurvivorjail cellislamdemonstrationcommunistdrug abusehidingtherapistpsychologistvirginityiraqmoralitycannongas maskiranpassportmovie theatrecensorshipheavy metalgrocery storebombingpillssufferingbraveryhypocrisyhippiesexismbroken glassfalling to deathbutcherdespairsculptureoilswampexilebutterflyswedendeath of sistermusical numberyoung lovedemocracypunk rockpolice raidwar veteransirenreckless drivingpajamasturkey the countrypipe smokingplaying cardsmoscow russiaintimidationrevolutionarybriberyearphoneswomen's rightstriple f ratedsneakersbeggarrepressionselfishnesstombstoneblack marketidealismplaywrightconventtape recordingaustriacredit cardvienna austriabased on graphic novelnihilismblizzardrazoranarchistpolitical prisonervolkswagenhonestymartyrtitle same as bookpsychotherapyair raidchoicenationalismfiring squadnewlywedussrreference to michael jacksonprophetsecret policecheckpointshopping cartdiabetesloudspeakerveilfleeingswansolidaritydignitysubcultureexpatriatesurgical operationcowardicebedtime storycustomsbirthmarktehran iranpenis joketrolleyart historycuriositypolitical repressionsnowballpuppet showhashishnailtyrannyart classhomeless womanideologyreference to karl marxazerbaijanhead scarfartillerymarxismmohawk haircutreference to leninprotest marchunfaithful boyfriendloud musicreference to saddam husseiniraq iran warseparation from familyadaptation directed by original authorreference to che guevarapolitical rallyfarewellfalse passportcyanideexecution by hangingprescription drugsmarxisttalking to godair guitarburqadrowning in a bathtubgroceriron maidenyodelingreference to godzillarubblewindow washeriranian revolutionwine makingdog humping someone's legbroochislamic revolutionwar ruinsnunneryproletariatleningrad russiashahpolitical exilereference to abbaliberatorstudy abroadlife drawingreference to the bee geesshah of irangovernment repressionopen heart surgeryataturkbronchitiscoronaryjasmineyodeliranian historymultiple amputeereference to botticellisifting through garbageiranian soldierlong distance telephone callreference to iron maidenreference to romy schneideramputated arm and legbeauty spotnailed to a wallorly airport paristoppling a statue (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Lost Boys (1987) is one of the best movies like Ginger Snaps (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Lost Boys (1987)

A mother and her two sons move to a small coast town in California. The town is plagued by bikers and some mysterious deaths. The younger boy makes friends with two other boys who claim to be vampire hunters while the older boy is drawn into the gang of bikers by a beautiful girl. The older boy star …ts sleeping days and staying out all night while the younger boy starts getting into trouble because of his friends' obsession. (Read More)

Subgenre:
black comedycult filmteen movie
Themes:
obsessiondeathmurderdysfunctional familyhome invasionmissing child
Mood:
goremoving
Locations:
bathtubbeachtrainmotorcyclesmall towncavecatholic churchwater gunnew boy in town
Characters:
boyfather daughter relationshipteenagermother son relationshipbrother brother relationshipvampiresingle mothersecurity guardgrandfather grandson relationship
Period:
1980s
Story:
drinking bloodwormgothcovered in bloodanimal attackgothicfalling down stairsobscene finger gesturefirst partexploding bodythroat slittingimpalementflashlightmarijuanablood splatter …corpsecigarette smokingdogbloodfightbare chested malechasesurprise endingshot in the chestpunched in the facefalling from heightwineconcertcaliforniastabbed in the chestdinnerchild in perilshot in the foreheadstabbed in the backwidowerperson on firekicked in the faceskeletonconvertibledisappearancedateneck breakingpremarital sexsevered armfireplaceteen angstbow and arrowflyingnipples visible through clothingslow motioncomic booklifting someone into the airsevered handshopliftinghippiegash in the faceimmortalityamusement parkexploding headfoghealingcliffraised middle fingerhomoeroticismlooking at self in mirrordivorceebonfireburned to deathtorso cut in halfleather jacketsunsetlevitationruinshiding in a closetvideo storeroller coasterhanging upside downburnt facemaggotmotorcycle gangfatal attractionhiding under a bedcarouselinvitationcounter culturelifting person in airholy waterguard dogvampire slayerinitiationpretending to be deadbitten handstakegarlichomoeroticboardwalkscalpingmissing person posterburnt handchased by a dogchild driving a carmulletmohawkcomic book shoparrow in chestbrat packfalling off a bridgevampire versus vampireabandoned hotelhorror comicblowing smoke in someone's facebitten by a dogchild vampireear piercinggreaserhiding under the covershiding behind a doorspear through chestevil dogscratching facedeer antlerscar through walldevil dogholy water gunwindex (See All)

Carrie (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Carrie (2013)

The outcast teenager Carrie White is bullied by her classmates at high school. Her mother, Margaret White, is a pious and paranoid woman that sees sin everywhere and the need of self-inflicting punishment. When Carrie has her first period, she does not understand what is happening to her and her cla …ssmates humiliate her in the changing room. The spiteful Chris Hargensen videotapes Carrie with her cell phone and posts it on the Internet. Their teacher Ms. Desjardin punishes the students, but when Chris challenges her, she is suspended and consequently is banned from the prom. Meanwhile, Carrie discovers that she has telekinesis and learns how to control her ability. Sue Snell, one of the girls that tormented Carrie, feels bad and asks her boyfriend Tommy Ross to invite Carrie to go with him to the prom to make up for what she did to Carrie. But Chris and her boyfriend Billy Nolan plot an evil prank with her friends to seek vengeance for Carrie. (Read More)

Subgenre:
coming of agesuspenseteen movieteen horror
Themes:
supernatural powerpregnancyrapesuicidedeathmurderfriendshiprevengesurrealismreligionfeardanceangerdeath of motherdepression …redemptionguilthumiliationpoetrybullyingcrueltypanicvengeanceself sacrificenear death experienceregretpsychological trauma (See All)
Mood:
high schoolnightmaregorerainnighthorror movie remake
Locations:
bathtubschoolhospitalswimming poolcarcemeterysmall townbicyclewaterpolice cargas stationschool bussex in a carfire truckschool dance …school fire (See All)
Characters:
studentnurseteacherfemale protagonistteenage girlboyfriend girlfriend relationshipmother daughter relationshipteenagerdoctorbullysingle motherteacher student relationshipbibleterrorself mutilation …religious fanaticpregnant teenagerreligious zealotself injurymother versus daughterreligious mothervomiting girl (See All)
Period:
2010s
Story:
sanitary napkintamponmenstruationcovered in bloodfalling down stairsclasslocker roomsuburblatex glovesimpalementstabbingflashlightclassroomvomitingblood splatter …knifedancingcharacter name in titlef ratedviolencebloodkissbased on novelone word titlebare chested malesex scenetitle spoken by characterexplosionsurprise endingshowerfirecell phonecar accidentface slapremakeslow motion scenesex in bedprayerf wordbedroomstrangulationmassacreambulancemontagestabbed to deathstabbed in the chestchild abuseexploding cargraveyardattempted murderlimousinegravelibrarystabbed in the backprologuescreamingperson on fireelectrocutionlightninggymamerican flagtragic eventhigh school studentcrosschildbirththreatpigsadnessschoolgirlstagecharacter says i love youthreatened with a knifeteenage sexsingle parentpoemnerdsabotageteen angstdestructionburned alivekilling an animallooking at oneself in a mirrorscene during opening creditslifting someone into the aircrucifixyoutubefemale killercrushed to deathhomicideearthquakereverse footagepower outagescissorsstabbed in the leglaughterroseaccidental killinglonerclassmatebody countpublic humiliationjuvenile delinquentalienationcharacters killed one by onesurgeonsports cartelekinesistext messaginginterrupted sexteenage pregnancyshynesslevitationstabbed in the handclosetoutcastmedical masksurgical maskhigh school teachercafeterialong hairabuse of powerfemale teacherfireballbully comeuppancefemale psychopath17 year oldwhistlecrownstabbed in the armcameramandental maskbroken mirrordomineering motherknocked unconsciousteasingteenage daughterteenage sexualitylocked doorpromnewborn babydeath of boyfriendsewing machinepsychic powerfrightmatricidedeath of title charactercamera phonepool of blooddetentionsledgehammerdisturbed individualwoman wearing black lingerietauntingdeeply disturbed personbucketdutch anglestabbed multiple timeswashingfemale in a showerfemale studentcliquemissionary positionsurgical gownhostilityburning houselord's prayerperiodhigh school dancehigh school principalseamstresstwin sistersdead teenagergym classgym teachervillainess played by lead actressthrown through a windshieldcuttingwoman in a bathtubbloody handteenage romancewoman in a towelmenstrual bloodpsionic powerhigh school promlacrosseteen lovefemale bullylesbian slurstretch limousineexploding gasoline stationrepeated scene from a different perspectiveparty dressmultiple stabbingoverprotective parentalternate endingbanging head against wallparanormal phenomenonwhite rosefalling off a bicycleshy girlcruel jokecyberbullyinginferiority complexprom nightteen sexwoman murders a womanprom queenfirst menstruationprom dresscracked mirrorhome birthtroubled teenage girldaughter murders motherhit by a falling objectimax versionstabbing a womanwoman on fireteenage prankstertrampledwomen wearing a one piece swimsuitcollapsing housedeath by falling objectprom kingreference to samsonwomen's locker roommother murders daughterpig bloodteen pregnancybucket of bloodtragic villainessclothes shoppiggeryreference to tim tebow (See All)

The Virgin Suicides (1999)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Virgin Suicides (1999)

A man about forty years of age tells the story from when he was a teenager in upscale suburban Detroit of his and three of his friends' fascination with the mysterious and doomed Lisbon sisters. In 1974, the sisters were seventeen year old Therese, sixteen year old Mary, fifteen year old Bonnie, fou …rteen year old Lux, and thirteen year old Cecilia. Their fascination still remains as they try to piece together the entire story. The sisters were mysteries if only because of having a strict and overprotective upbringing by their father, who taught math at the girls' private co-ed school, and overly devout Catholic mother, who largely dictated the household rules. The story focuses primarily on two incidents and the resulting situations on the girls' lives. The first was an action by Cecilia to deal with her emotions over her life. And the second was the relationship between Lux - the sister who pushed the boundaries of the household rules most overtly in doing what most teenagers want to do - and Trip Fontaine, he who could have any girl he wanted but wanting solely Lux. (Read More)

Subgenre:
black comedycoming of agecult filmindependent filmteen moviecoming of age film
Themes:
obsessiondrinkingsuicidedeathinfidelitybetrayalghostjealousyadulteryescapedeceptionmemoryextramarital affairdepressionunfaithfulness …mental illnessunrequited lovefirst loveregret (See All)
Mood:
high school
Locations:
schoolhospitalswimming poolcemeterytaxischool dance
Characters:
teenage boysister sister relationshipdancerteacherteenage girlboyfriend girlfriend relationshipmother daughter relationshipfather daughter relationshipteenagerfamily relationshipshusband wife relationshipfather son relationshipsingerpriestlust …psychiatristcatholiccatholic priestgay fatherwriter directorself destructivenessdeath wishself inflicted injuryhomosexual father (See All)
Period:
1970ssummer
Story:
girls' bathroomtamponwatching a moviepot smokingloyaltyclasshangingpoisonsuburbvirginimpalementclassroommarijuanavomitingdrink …watching tvpartydancingcigarette smokingf ratedsexkissbased on novelflashbacksingingvoice over narrationcryingsongtitle directed by femaledreamunderweartearssunglassesneighborhallucinationvoyeurprayertelephoneambulancesuicide attemptdinnerchild abusegraveyardtalking to the camerapop musicpassionstorytellingdiarymanipulationtragic eventcrosssplit screenrock 'n' rollisolationdirectorial debutteenage sexrecord playerflirtingteen angstballoonloss of virginityrecordingcrucifixamerican footballmagazinemovie theatergossipgay parentflatulencehome movietennisvirginitypeeping tomgas masktelescopeunderage drinkingfootball playertheatre audiencecigarette lightertime lapse photographyaviationnotemelancholypromiscuityreflectionnews reportersexual awakeningteachingcannabishigh school teacherhomecomingpostcardfenceloss of daughterrepressiontombstonetween girltv reportersexual promiscuityinsomniarumorinfatuationpoisoninggeneration gapwrist slittingpopularityloss of childfootsie under the tablehearseprommichiganschoolteacherdown syndromequarantinebeltfootball teamlabor unionknittingenigmateen suicidefirst sexual experiencecocktailunicornfemale to male footsie playingabusive mothertennis courtasphyxiationsexual explorationmental instabilitylabor strikemirror ballsleeping pillshigh school dancemodel airplanetv crewfootball stadiuminsulinsparklerfootball fieldlawn sprinklerpopsiclehouse arrestinnocence lostdebutantemorse codemass suicidelovesicksouvenirauditoriumhanged girlabused childrat poisonmentally challenged personchild suicidejumping off a rooffootball practiceoverprotective parentsuicide preventiondrugged foodpicket lineyale universitycarbon monoxide poisoninginsomniacmathematics classmath teacherbrownie the foodprom dressschnappsgas stoveimpaled childstrict mothercataloguetalking to a plantemotional depressionhollyhomecoming dancereference to kiss the bandmaximum securityphotosynthesisdead child with eyes openreference to aerosmith the bandscotch tapemysteriousnesstwo on one footsie playingbaseball on tvelmiron fencemedicine overdosestrict parent (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Glass House (2001)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Glass House (2001)

When Ruby Baker's parents are killed in a car accident, she and her brother, Rhett, must travel to Malibu, to live with Terrence and Erin Glass, their former neighbors. At first, all seems well. Ruby is making new friends at school and Rhett is getting more video games and flashy toys than he's ever … had in his life. When Ruby speaks to her family's estate lawyer, he tells her that her parents have left Rhett and her $4 million. Suddenly, Ruby begins to notice odd behavior from Terry and Erin. (Read More)

Subgenre:
suspensepsycho thriller
Themes:
drug usedrunkennessdrinkingsuicidedeathmurderfriendshipdrugsfuneraldeath of fatherdeath of motheradoptionwealthcheatinginheritance …murder of a police officerclaustrophobia (See All)
Mood:
high schoolnightmarerain
Locations:
schoolrestaurantchurchswimming poolcarcemeterypolice cartruckschool teachercar explosiontruck accident
Characters:
teenage boyfemale protagonistteenage girlboyfather daughter relationshipmother daughter relationshippolicefamily relationshipsfather son relationshipmother son relationshipfrienddoctorbrother sister relationshipgirlpolice officer …policemanpriestlawyermaiduncle nephew relationshipuncle niece relationship (See All)
Story:
menstruationwatching a moviehypodermic needleclassinjectionhit by a carstabbingflashlightclassroomdead bodydrinkwatching tvcorpseknifecigarette smoking …bloodgunexplosioncryingdreamcar accidentcomputerbikinitearscar crashcafeswimmingcleavageorphanbracaliforniamansionstabbed to deathinternetchild abusedrivingdrawinggraveyardgraveargumentdrug addictscreamingdebtlightninghigh school studentfilm within a filmloss of fathersuspicionloss of motherreference to william shakespearetrustmachetefaintingcaptiveloss of loved onearchitecthome moviescamdrug overdosemovie theatreswitchbladetensionbroken glassjunkietheatre audiencee mailsocial workerdeath of loved onereckless drivingnintendo 64flat tiretombstonedrunk drivingpopcornloanglassloan sharkguardianreference to shakespeare's hamletbmwcruisingmorphineloss of parentsvideo cassetteplagiarismcar wreckapple computercaregiverdriving lessondiabeticillegal drugseulogydead parentsperilinsulinshooting uplife insurancetrust fundseat beltgourmetsocial servicesunlikely criminalreference to meryl streepcheating on a testelectric drillbrake failurecar hit by a trucksaablegal guardianglass housestepfamilycar over a cliffferrari testarossadeviousnessmulholland driveradio producerdriver's educationsan bernardino californiaaol (See All)

Apt Pupil (1998) is one of the best movies like Ginger Snaps (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Apt Pupil (1998)

Neighborhood boy Todd Bowden (Renfro) discovers that an old man living on his block named Arthur Denker (Mackellan) is Nazi war criminal. Bowden confronts Denker and offers him a deal: Bowden will not go to the authorities if Denker tells him stories of the concentration camps in WWII. Denker agrees … and Bowden starts visiting him regularly. The more stories Bowden hears, the more it affects his personality. (Read More)

Themes:
obsessionsuicidemurderdeathinvestigationangerblackmailcrueltyholocaust
Mood:
nightmare
Locations:
hospitalbusbicyclepolice cartunnel
Characters:
teenage boystudentnurseteacherteenage girlboyteenagerhusband wife relationshipfather son relationshipmother son relationshipjew
Period:
1980syear 1984
Story:
guidance counselorshovelwatching a moviefalling down stairsbasementlocker roomsuburbstabbingclassroommarijuanacamerawatching tvknifephotographblood …nuditymale nudityshowercatsecrettearsold manambulancebasketballdinnerman with glassesnews reportlibrarybeaten to deathcostumefantasy sequencespeechteenage sexheart attackrecord playerkilling an animalreference to adolf hitlerfbi agentbuttocksimpersonationpassportmovie theatreanti semitismresearchtheatre audiencebonfirepigeoncartoon on tvswastikabicyclingbaseball playernewspaper articleblackboardbaseball gamenazismsociologyanguishhomosexual subtextinnocent person killedsmoking potwar criminalhomeworkhigh school graduationprotestornazi uniformphonograph recordexaminationmarchingbased on novellabased on the works of stephen kingcandlelight dinnerforgersociologistsavageryvictrolareference to heinrich himmlerwinoeliteknife in backsociologicalplacardkilling a birdginger catreference to john donne (See All)

City Of God (2002)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

City Of God (2002)

Brazil, 1960s, City of God. The Tender Trio robs motels and gas trucks. Younger kids watch and learn well...too well. 1970s: Li'l Ze has prospered very well and owns the city. He causes violence and fear as he wipes out rival gangs without mercy. His best friend Bene is the only one to keep him on t …he good side of sanity. Rocket has watched these two gain power for years, and he wants no part of it. Yet he keeps getting swept up in the madness. All he wants to do is take pictures. 1980s: Things are out of control between the last two remaining gangs...will it ever end? Welcome to the City of God. (Read More)

Subgenre:
black comedycoming of agecult filmcrime epic
Themes:
photographydrug usetorturerapedeathmurderlovefriendshiprevengekidnappinginfidelityreligionmoneyadulteryescape …dancegangsterrobberyextramarital affairtheftpsychopathdeath of fatherdeath of motherpovertyredemptionunfaithfulnesssexualityhomelessnessdrug addictionwealthenvironmentpolice corruptionmurder of fathermurder of mothermurder of brother (See All)
Mood:
neo noir
Locations:
woodsforestbarbeachchurchmotorcyclebusnightclubbicycleurban settingpolice carcitymoteljunglebrothel …brazilslum (See All)
Characters:
teenage boyphotographerdancernurseteenage girlboyboyfriend girlfriend relationshippolicefamily relationshipsfather son relationshipmother son relationshipfriendbrother brother relationshipprostitutepoliceman …thiefartistinterracial relationshipuncle nephew relationshippolice chasedeath of boy (See All)
Period:
1980s1970s1960s
Story:
drug dealingpromiseburialpot smokingobscene finger gesturevirginpaindrug dealermarijuanarunningshowdowncamerawatching tvblood splatterknife …partyphotographdancingviolencebloodfightgunkissfemale nuditymale nudityflashbackmale frontal nudityinterracial sextitle spoken by characterchasethree word titlepistolbased on true storytelephone callvoice over narrationcryingbased on bookshootoutshot to deathunderwearcar accidentshot in the chestface slapshot in the headarrestshootingrifletearsbirthdaycar crashprostitutionprayercriminalshot in the backreporterswimminggood versus evilgay slurnewspapersoccerjournalistgangcocainefishnonlinear timelineassassinationcontroversyshot in the foreheadracial slurflash forwarddrug addictorganized crimeattackfugitivedeath of childscene during end creditsdomestic violencedeath of brotherpursuitsplit screenpremarital sexbank robberychickenhandgunclass differencespowerchild murderfreeze framerecord playercrime bossafricanmachismotv newsuzisupermarketdiscodesireloss of virginitymass murdersociopathstealinghidingbuttocksswimsuitjournalismvirginitythugshopliftingmercilessnessshot in the faceghettobananahandheld cameramurder of a childpolice raidgrowing upjuvenile delinquentjobmale virgincon manmarijuana jointmultiple storylinemolotov cocktailgang warstreet gangsnorting cocainedead childrenarms dealerarmed robberyinformantgang violencebus stoplatin americanarcissismwetting pantsstonedbakerykitebloody body of childrio de janeiro brazilactual animal killedsouth americagaskiller childsoccer ballshot in the foothold upchapter headingsin medias reslifeguardhoodierise and fallmob violencechild with guncity in titlestreet vendorchild with a gunstrobe lightauto theftillegal drugstalismancareer criminaltv broadcastchild murders a childchild uses gungang warfarename changefavelagun storedeath of uncledrug pushersambabrazilian musicpaperboynon professional castboy killedchild uses a gunmotorscooterchild shotchild shot in the headwoman directoruxoricidechild knocked unconsciousrio de janeirocon gameurban violencehooded sweatshirtyouth gangphotojournalismrunttropical settingankle injuryteenage gangsalesclerkchild shot in the chestlusophonegun dealerbroken rulepushing a carcounter attacktrigger happybus conductorarmed childchild shot through the chestmaconhabrazilian culturestool pigeongang shootingkid gangsmooth talkerstreet war (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The People Under The Stairs (1991)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The People Under The Stairs (1991)

The People Under the Stairs is the story of a young boy (Fool) from the ghetto and takes place on his 13th birthday. In an attempted burglary (along with two others) of the home of his family's evil landlords, he becomes trapped inside their large suburban house and discovers the secret of the "chil …dren" that the insane brother and sister have been "rearing" under the stairs. (Read More)

Subgenre:
dark comedyblack comedycult filmindependent filmpsycho thrillersurvival horroramerican horror
Themes:
deathmurderkidnappingdeceptionincestpsychopathinsanitymental illnesssadismevilhome invasiongreedcannibalismwealthstarvation …claustrophobia (See All)
Mood:
social satiresatiregoreslasherdarkness
Locations:
los angeles californiaslum
Characters:
boyfather daughter relationshipmother daughter relationshippoliceafrican americanbrother sister relationshipvillainterrorkiller dog
Period:
1990s
Story:
dead boygothstabbed in the throatsevered fingerstabbed in the stomachgothicfalling down stairsbasementsuburbvanimpalementflashlightblood splattercorpseknife …cigarette smokingviolencedogbloodtitle spoken by characterpistolshot to deathshot in the chestface slapshotgunbirthdaymansionhousechild abusechild in perilracial slurcharacter repeating someone else's dialogueelectrocutiondollevil mandeath of childskeletoncharacter says i love youcult directorterminal illnessmaniacfireplacekilling an animalbreaking and enteringscene during opening creditsragemutilationspiderpsychosevered handgrindhouseskullsadomasochismmasked manrampagehit in the crotchcannibalchild protagonistdynamiteghettobooby trapatticperversionmurder of a childsoulbody countcellarlasersightlandlordpsycho killerpervertserial murderpsychopathic killerbad guymadmanhiding in a closetold dark houseschemeevictionhuman monsterlighterhomicidal maniacfemale psychopathclimbing through a windowslashinganimal abusebayonetslingshotpondfuneral homemurderessroofexploding housecrowbardeformitytrapdoorwhite dresswoman slaps a mansadistic psychopathmurder spreedisturbed individualgrindhouse filmstarvingdeeply disturbed personmissing girltarot cardchild with a gunfalling off a roofmoney falling through the airgold coinbitten handpsycho terrorfemale serial killershot through a wallsecret passagewayhidden doorrobbery gone awryrottweilersevered tonguesick motherhidden treasureanthropophaguschild murderessnameless characterfurnacedragging a dead bodysickoabused childbad girlpitbullmute childtenementmutilated bodyhung by wristsbreaking through a wallfire pokerbible belttrapped in a housecrawling through an air shafthit with a brickscared to deathstepping on someone's footeyes gougedhouse of horrorscrawl spacebondage equipmenthuman eaten by a dogscalding waterskull ring (See All)

Biutiful (2010)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Biutiful (2010)

Uxbal, single father of two children, finds his life in chaos as he is forced to deal with his life in order to escape the heat of crime in underground Barcelona, to break with the love for the divorced, manic depressive, abusive mother of his children and to regain spiritual insight in his life as  …he is diagnosed with terminal cancer. (Read More)

Themes:
photographycancerdrug usedrunkennessdrinkingdeathmurdermarriagedrugsreligionmoneybetrayalfearmemoryredemption …guiltgriefillnessexploitationdyingpolice corruptionafterlifedying fatherdying from cancer (See All)
Mood:
rain
Locations:
woodsforestschoolhospitalbarbeachrestaurantchurchsnowcemeterynightclubpolice carstrip clubmexicotrain station …slumsex in a closet (See All)
Characters:
dancernurseboyfather daughter relationshipmother daughter relationshippolicefamily relationshipshusband wife relationshiphomosexualfather son relationshipmother son relationshipdoctorchildrenbrother brother relationship …brother sister relationshipprostitutegirlpolicemanbabylittle girlgay kisslittle boychinesegay relationshipsingle fathergay fathercrying babychinese foodgay asianbaby boypolice violencereligious iconsex with brother in lawasking for forgiveness (See All)
Period:
2000s
Story:
dead boyurinating bloodsense of smellhypodermic needleflowerspaintoiletdrug dealercandledead bodyrunningvomitingdrinkwatching tvurination …corpsephotographdancingcigarette smokingkissviolencebloodfightfemale nudityone word titlebare chested maletitle spoken by charactersingingchaseshowertelephone callcryingcell phonedreamunderwearfoodmirrorface slaparrestundressingthongtearsbirthdaycafebathroomjailhallucinationtelephonesubjective cameraorphancookingwinestrangulationmontageeatingcocaineimmigrantsubwayaccidentfishdinnerchild abuseapologycoffinmarriage proposalgravemicrophoneprologuemassageringpursuithairy chesttragic eventcrossdeath of soncharacter says i love yougay coupletrustsingle parentterminal illnessafricanbirthday cakecloseted homosexualtv newshuggingsyringemedicinebreaking and enteringwarehouselooking at oneself in a mirrorcakebabysitterice creamcrucifixmorguespiderdesperationgay parentstreet lifemale underwearpillssufferingboxer shortsconstruction sitemourningbackpackmedical examinationmarital separationmale male kisspolice raidbriefsinjusticedead motherillegal immigrantowldormitorysuffocationg stringcremationconstruction workerbreast feedingrepeated sceneevictionsnorting cocainedead fathertv reporterblack marketconstructionclimbing through a windowdenialdying manbreaking a windowmarriage problemsmediumsewing machinesitting on a toiletintentionally misspelled titledistrustbarcelona spainsleeplessness10 year oldpole dancerhappy birthday to youillegal immigrationspaghettimortuarywrapped in a towelstreet vendorchemotherapyasphyxiationbailbipolar disorderforkcrematoriumchild's drawingpneumoniadead parentsnoseblowing out candleheartbeatsparklerestranged couplemedical clinicwashing clothesatonementblood sampledead sonmass deathbed wettingdiamond ringout of body experiencetouching someone's breastsreference to mother teresaterminal cancerbelief in the afterlifeestranged wifesenegalsweatshopfastingwetting oneselffootbridgeodorreference to disneylandwraithbad newsdeath by suffocationviolence against a childembalmingcarbon monoxide poisoningface woundnude dancingprostate cancerseven year oldupside down viewwaiting in lineincontinencechinese immigrantmale wearing an earringsense of soundtalking with the deadhuman exploitationabandoned childadult diaperbeginning morphed with endingsenegalesemagnetic resonance imagingpounding on a doorreference to the united nationsbarred windowpyreneesreference to the dalai lamacommunicating with the deaddeath from cancerillegal workerkid artstrip club ownerboogerheaterdeath by asphyxiationmale ponytailreference to francisco francopierced eartalkativenessboy smoking a cigarettedead body on beachprostate exammisspelled worddead body floating in waterreference to jack danielsappliance storebody washed up on beachhitting a childsilent sceneblack marketeersurrealism sequencemultiple tv screenssent to one's room (See All)

Slither (2006) is one of the best movies like Ginger Snaps (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Slither (2006)

In this blend of the B movie classic The Blob (1958), and some Romero's zombies film, a meteorite collides in a small town. Grant finds it, and is infected by a parasite worm, which installs in his brain and causes him a creepy transformation into a monster. Starla, his wife, and Bill, a policeman,  …will try to stop him and the plague of worms generated by the creature. (Read More)

Subgenre:
creature featureblack comedycult filmb movie
Themes:
drunkennessmurdermonstercannibalismmurder of a police officer
Mood:
high schoolgore
Locations:
forestbarswimming poolsmall townpolice station
Characters:
teenagerhusband wife relationshipzombiealienmayorcountry singer
Period:
year 2005
Story:
wormdead dogmutationinfectionstabbed in the throatanimal attackexploding bodybasementhit by a carimpalementclassroomblood splattercorpsepartyphotograph …sexbloodviolenceone word titleflashbackmale rear nuditybare chested maleexplosionpistolshot to deathshot in the chestshot in the headshotgunwritten by directorriflecar crashdecapitationfoot chasebandstabbed to deathstabbed in the chestmapsevered headchild in periltransformationshot in the foreheadcharacter repeating someone else's dialoguedomestic violencepolicewomancharacter says i love youdirectorial debuttwincowdismembermentgrenadekilling an animalmutantbarnnosebleedmind controleaten alivealien invasionobesityhungerkaraokestabbed in the headthrown through a windowdisembowelmentdeerdisfigurementranchfemale in showersurprise after end creditssouthern accentblood on camera lensdirector cameohigh school teacherdead animalhead blown offmeatpolice chiefacidold flameanimal abusedeputystakeouttentaclemeteorshot in the foothit with a shovelcountdownparasitehomeless persondeformityreference to charles darwinslime555 phone numberearth viewed from spacecamera focus on female buttnightgownsouth carolinasliced in twonail polishzombie childpossebody torn apartbitten on the armwife murders husbandsteakwoman in a bathtubtentacle rapemass deathvomiting bloodhit on the head with a fire extinguisherjumping off a rooflesbian slurinfestationnude drawingoverweight womanslugcrossing guardsquare dancingradar gun (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Texas Chainsaw Massacre (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Texas Chainsaw Massacre (2003)

Driving through the backwoods of Texas, five youths pick up a traumatized hitchhiker, who shoots herself in their van. Shaken by the suicide, the group seeks help from the locals, but their situation becomes even more surreal when they knock on the door of a remote homestead. It's quickly apparent t …he residents are a family of inbred psychopaths, and the unlucky youths suddenly find themselves running for their lives. In hot pursuit is a disfigured, chainsaw-wielding cannibal known as Leatherface. (Read More)

Subgenre:
independent filmsadistic horror
Themes:
torturesuicidemurderdeathkidnappingpsychopathbrutalityinsanitysadismpolice brutality
Mood:
goreslasherhorror movie remake
Locations:
bathtubbarwheelchairpolice carroad tripgas station
Characters:
boyfriend girlfriend relationshippolicemother son relationshippolice officerserial killercrying babyevil sheriff
Period:
1970s
Story:
severed fingerfull moonfalling down stairspot smokingchainsawobscene finger gesturebasementlocker roomvanhit by a carimpalementrunningblood splatterknifeviolence …bloodsurprise endingvoice over narrationremakeshot in the headinterrogationpianotelephoneaxesevered headno opening creditspolice officer killedevil manpigchickendirectorial debutsevered armcowdismembermentmoonmaniacnipples visible through clothingheavy rainlifting someone into the airgroup of friendscowboy hatmutilationhomicidethrown through a windowdisfigurementbody countalienationtank topmasked killernewspaper clippingbarbed wirecar troublecrucifixionhuman monstersexual perversionterritory name in titletrailer homehillbillymercy killingwhite trashmeat cleaversewing machineshot through the mouthwet t shirtmasked villainslaughterhousesole survivorsaltsevered footstupid victimtruckersevered eargas station attendantclothes linesmall town sheriffbodily dismembermentobese womanpinatasevered faceforensic evidenceanthropophagusone armed manremake of cult filmbody in trunkvolkswagen buslock pickmeat hookchainsaw murderteeth knocked outhole in the wallhung from a hookrotten teethleatherfacebased on ed geinsevered nosechewing tobaccogroup of fiveharbinger of deathabandoned millmeat processing factoryobject made of body partobject made of human skintool in title (See All)

The House Of The Devil (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The House Of The Devil (2009)

Subgenre:
cult filmsuspense
Themes:
pregnancyrapedeathmurderfearescapedeceptionevildevilmurder of family
Mood:
goreslow burn
Locations:
hospitalcemeterykitchen knifeblood in carrunning water
Characters:
self cuttingnursefemale protagonisthusband wife relationshipterrorpregnanttalking to oneself in a mirrorself inflicted gunshot wound
Period:
1980syear 1982
Story:
drinking bloodhaircovered in bloodstabbed in the stomachhypodermic needlebasementvanthroat slittingdead bodywatching tvblood splattercorpsepantiesknifephotograph …dancingcigarette smokingbloodflashbackbare chested malechasesurprise endingpistolblondeshot in the headsecretcollegepianodemoncleavagefoot chasebound and gaggeddeath of friendstabbed to deathsuicide attempthousefishwhite pantiesscantily clad femaleritualroommategraveyardstabbed in the backprologuepay phoneproduct placementknocked outcollege studentshot in the shoulderwigdeath of sonpremarital sexhaunted housepizzagirl in pantiesocculteavesdroppingbabysitterpatientwitchcraftattempted suicidepower outagepool tableshot in the faceanxietyheadphonesbilliardsmurder of a childeye gougingcanetrophywilhelm screamlyingceremonyshot in the neckplaying poollightervery little dialoguecamera shot of bare feetloud sexgoldfishfilm starts with textlandladyshot point blankaudio cassettenewscastpizza deliverysome scenes in black and whitegravestoneritetenantsymbolwoman smokerpentagramzippo lighterthroat cutmuraleclipsebegins with texthooded figurescreaming in fearrunning for your lifehundred dollar billdorm roombarefoot womanhead bandagesatanic cultsatanic ritualstained glass windowstartledstabbed in the bellysingle location911 calllock of hairintravenousbleeding from eyesdreadbroken vasedancing alonetwenty dollar billlunar eclipsestrange noisegermophobeanimal skullrotary phonedeformed facetrip and fallscratching facepoked in the eyegoldfish bowlbulletin boarddevil worshiperbreaking a vaseignoring advicesecluded houseslit wristluncheonettebait and switchcircumscribed pentagrampizza shoppepperoni pizza (See All)

In A Better World (2010)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

In A Better World (2010)

Anton is a doctor who commutes between his home in an idyllic town in Denmark, and his work at an African refugee camp. In these two very different worlds, he and his family are faced with conflicts that lead them to difficult choices between revenge and forgiveness. Anton and his wife Marianne, who … have two young sons, are separated and struggling with the possibility of divorce. Their older, ten-year-old son Elias is being bullied at school, until he is defended by Christian, a new boy who has just moved from London with his father, Claus. Christian's mother recently lost her battle with cancer, and Christian is greatly troubled by her death. Elias and Christian quickly form a strong bond, but when Christian involves Elias in a dangerous act of revenge with potentially tragic consequences, their friendship is tested and lives are put in danger. Ultimately, it is their parents who are left to help them come to terms with the complexity of human emotions, pain and empathy. (Read More)

Themes:
cancerpregnancydeathmurderfriendshiprevengemarriageinfidelityjealousyadulteryfearfuneralnatureextramarital affairanger …divorcelonelinesspsychopathdeath of motherdysfunctional familygriefunfaithfulnessillnessbullyingcrueltydeath of wifevengeanceforgiveness (See All)
Mood:
satire
Locations:
schoolhospitalchurchsmall townboatdesertlondon englandbicycleelevatorpolice stationpolice carafricalaketruckrooftop …war zonerunning after a truck (See All)
Characters:
studentnurseteacherboypolicefamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfrienddoctortattoobrother brother relationshippolicemanbaby …bullygrandmother grandson relationshipsingle fatherbaby killer (See All)
Story:
boys' bathroomswinginfectionplaygroundpromisewoundgaragefireworksclassflowerspainvanstabbingclassroomrunning …beatingknifephotographf ratedbloodviolencekissfightsexone word titlebare chested maleexplosiontelephone callcryingcell phonetitle directed by femaleblondeslow motion scenecomputerlierifletearssunglassesbombf wordswimminggay slurambulancewomaninternetapologychildcoffinbeaten to deathprologuewidowerliartentdisappearancecountrysidecrossthreatthreatened with a knifeloss of motherhatepickup trucksurgeryafricanjoggingpatientvandalismdenmarkloss of wifespiderassaultmoralityremote controllandscapewindsufferingmourningbackpackabsent fatherpunched in the chestprideblood on shirtfriendship between boysmarital separationfemale doctormarital problemmoral dilemmatext messagingsaving a lifehandshakehysteria12 year oldharbornecrophiliahit in the facecremationdockhead woundcrutchesname callingwebcammilitiaidealismpeer pressureschool principalstethoscopekiteplaying a video gameauto mechanicgurneysoccer balljumping into watertormentwarlordguerrillaveilleg woundrefugee campsurgical operationjoggertoy cardental bracesrubik's cubehead bandagebiblical referencegunpowdermissing sonaudikiss on the foreheadsudansuicide contemplationpacifismvideo chatretaliationbomb explosionmalariapain killerreference to coca colasummer housewoman directorswedeparallel storyautomatic riflecobwebsilofacial injuryclimbing a ladderdragging someonewanting to diemultiple languagesparent teacher conferencechoking someonehomemade explosivetelephone hangupct scanhomemade bombmodel carberry pickingereye for an eyereference to hans christian andersenflying a kitevan explosionshoulder woundblind in one eyeknife held to one's throatdying during surgeryhit with a basketballholding someone's hand (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Near Dark (1987) is one of the best movies like Ginger Snaps (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Near Dark (1987)

A mid-western farm boy reluctantly becomes a member of the undead when a girl he meets turns out to be part of a band of southern vampires who roam the highways in stolen cars. Part of his initiation includes a bloody assault on a hick bar.

Subgenre:
black comedycoming of agecult filmindependent filmsuspense
Themes:
supernatural powerdrunkennessdeathmurderfriendshiprevengekidnappingbetrayalfearescapeinvestigationdeceptionpsychopathredemptioninsanity …sadismunrequited lovehomelessnessmurder of a police officernear death experienceregret (See All)
Mood:
goreneo noircar chasenightambiguous ending
Locations:
barsmall townbuspolice stationfarmpolice cartruckmotelgas stationtexasroad moviebus stationshedcar fire
Characters:
boyfather daughter relationshippoliceteenagerfamily relationshipsfather son relationshiptattoobrother sister relationshippolice officerhostagethiefvampirewaitresssheriffpolice shootout …single fathertruck drivershooting a police officer (See All)
Period:
1980s
Story:
curestabbed in the throatfull moongothicexploding bodymissing personlocker roomvanhit by a carthroat slittingflashlightrunningshowdownvomitingwatching tv …blood splattercorpsebeatingknifecigarette smokingf rateddogfightviolencegunkissbloodbare chested maleexplosionchasesurprise endingpistolfireshootouttitle directed by femaleshot to deathfistfightmachine gunhorsecar accidentshot in the chestface slapshot in the headshotgunrescueslow motion scenepunched in the facegunfightbrawlrifleheld at gunpointbeersunglassesrevolvercriminalshot in the backf wordgood versus evilfoot chasegangstrangulationmassacrestabbed to deathdinerstabbed in the chestexploding cardisarming someonechild in perildouble crosspolice officer killedfemme fatalecigar smokingshot in the legtransformationshot in the foreheadbartenderon the runattempted murderscreamingperson on firecowboypay phonefugitiveon the roadproduct placementrace against timedeath of childfarmermanipulationscaramerican flaghorse ridingneck breakingthreatened with a knifedirectorial debutcowarsonfreeze framesingle parentpickup truckmachismoropecard gamebulletburned alivepokerelectronic music scoremass murdershot in the stomachsociopathscene during opening creditscowboy hatbarncountry musicphone boothstrangerhitchhikerhitchhikingbar fightthugredneckgypsyreverse footagestealing a carstarhit in the crotchmercilessnesspool tablepunched in the stomachlove at first sightimmortalitypunched in the chestsunjumping through a windowoutlawblood on shirthealingdisfigurementknife throwingsiegepolice raidduct tapefemale directorburned to deathmoral dilemmaflat tiresouthern accentshot through a windowdriftermolotov cocktailveterinarianspit in the faceteenage lovehuman monsterpolice officer shot in the chestsuper strengthjukeboxquick drawstandofftrailer homedouble barreled shotgunburnt facehit by a truckdeputyexploding trucksawed off shotgunone linerwrist slittingbitten in the neckunderage smokingburnt bodykiller childstar crossed loversbadgemysterious womankansasrecreational vehiclevending machineshot through a doorgang leaderspray paintmass murdereroklahomainnocent person killednomadcamperchild swearingchild with a gunstabbed in the mouthlassoblood drinkingcowboy shirtmosquitobandaged handinvulnerabilityblood transfusionbalisongjumping from a carmobile homesunlightwhite horsefreight trainchild uses gunscarred facestar spangled bannerspit takestate troopercrisis of conscienceskull crushinginitiation riteamerican midwestdoomed lovebloodlustsee you in helloil wellcivil war veterantumbleweedwinnebagoblood suckingchild vampireface burntooth knocked outreflection in car mirrorconfederate soldierbutterfly knifecar showroomsleeping in a bathtubdriving through a wallsearch for sontinfoilbullet catchingslashed tiretrain trackrooster crowingspurhit with a flashlightslit wristjumping from a truckchild burningjesse jamesroaming (See All)

The Witch (2015)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Witch (2015)

New England, 1630: William and Katherine try to lead a devout Christian life, homesteading on the edge of an impassible wilderness, with five children. When their newborn son mysteriously vanishes and their crops fail, the family begins to turn on one another. 'The Witch' is a chilling portrait of a … family unraveling within their own sins, leaving them prey for an inescapable evil. (Read More)

Subgenre:
independent filmsuspenseconspiracyamerican horrorbritish horrorfolk horror
Themes:
supernatural powerdeathmurderkidnappingreligionghostfearmagicdeath of fatherdeath of motherredemptionguiltinsanityillnessevil …dyingdevilmadnesswildernessfather love (See All)
Mood:
goreraindarkness
Locations:
woodsforestchurchvillagerural settingfarmenglandcampfirenew englandbackwoods
Characters:
witchsister sister relationshipteenage girlboyfather daughter relationshipmother daughter relationshipfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipchildrensingerbrother brother relationshipbrother sister relationshipbaby …christianreference to godlittle girllittle boyvillainbibleterrorbaby boythe familydeath of boymother loveasking for forgiveness (See All)
Period:
winter17th century1600s
Story:
dead boybleedingkilling a dogshovelpromiseanimal attackburialgothicwolfpoisonstabbingcandleblood splatterknifedog …bloodviolencekissfemale nuditynuditymale nudityfemale frontal nuditymale rear nuditybare chested malesingingcryingsongfoodhorseundressingsecretlierifledemonhallucinationreference to jesus christprayersubjective camerastrangulationaxewomaneatingfalse accusationsearchgunshotconfessiongravescreamingpossessionrabbitdeath of brotherdisappearancedeath of sondeath of husbandisolationsuspicionchickendirectorial debutsleepingtwinmass murdereggwitchcraftcrying womancrying mangoatappletensionhypocrisysonhungerbutcherpridemurder of a childslaughterlanterndemonic possessionfieldkilling spreebonfireblack magicsinshameprayingbarking doglevitationfarmingrunning awaybaptismbreast feedingname callingsatanismslashingwhisperingwhistlingnewborn babyevil womanravengame playinghymnkiss on the cheekmiserycornbutcherychild abductionminimalismsaying gracechantingno endingflintlock riflechopping woodcowardicepatriarchbanishmenthutsatandead brotherdead babylord's prayerlost in the woodsnew hampshirereference to the ten commandmentswashing clothesanimal trapdead sonreference to luciferreference to abrahambloodstainpuritanred capepuritanismchild sacrificereference to jobdaughter murders motherforebodingmilking a goatcovenantevil winsram1630sreference to englandhomesteaderpossessed boybathing in bloodnewborn sonconjuringpeek a boosilver cup (See All)

The Howling (1981)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Howling (1981)

In a red light district, newswoman Karen White is bugged by the police, investigating serial killer Eddie Quist, who has been molesting her through phone calls. After police officers find them in a peep-show cabin and shoot Eddie, Karen becomes emotionally disturbed and loses her memory. Hoping to c …onquer her inner demons, she heads for the Colony, a secluded retreat where the creepy residents are rather too eager to make her feel at home. There also seems to be a bizarre connection between Eddie Quist and this supposedly safe haven. And when, after nights of being tormented by unearthly cries, Karen ventures into the forest and makes a terrifying discovery. (Read More)

Subgenre:
creature featurecult filmindependent filmstop motionstop motion animationsurvival horror
Themes:
supernatural powerrapemurderdeathlovefriendshipmarriageinfidelityjealousyadulterymonsterdeceptioncorruptionunfaithfulnessfalling in love …amnesiaself sacrificehuntingmurder of brother (See All)
Mood:
gorenight
Locations:
woodsforestbarbeachlos angeles californiarural settingofficegas stationcampfire
Characters:
female protagonistpolicebrother sister relationshipserial killerpolicemanlustpsychiatristsheriffolder man younger woman relationship
Period:
1980s
Story:
silver bulletfemale werewolflycanthropelycanthropyhowlingshapeshiftingclawgothicwerewolffirst of seriescameracorpsekissfemale nuditybased on novel …nuditymale nudityfemale frontal nuditytwo word titlesex scenefemale full frontal nuditynipplessurprise endingfirefondlingshot to deathmirrorblondebare buttriflevoyeurold mancaliforniaaxefemale pubic hairexploding carbrunettedream sequencedrawingtransformationdangerscreamingpay phonesensualitystalkingcabinarsoncorrupt coptv newsburned alivedesiredresstape recordermorguephone boothdesperationsevered handgrindhouseforbidden lovehomiciderampagewoman in jeopardyreverse footagebookstorefogperversionvegetarianbarbecueattractionlens flaresurprise after end creditsbushcartoon on tvbandagesexual perversionacidrestroomsecret societycattlegroup therapyjacketsuicidalmetamorphosisflameorchestral music scoreshape shifterpleasurecolonymurder victimregenerationfangsnews anchorawakeningwearing a sound wirehuman preyporn loopcampfire storygrowlingwildfirecoveadult bookstorewerewolf transformationwerewolf bitebloody scratchwerewolf packwerewolf family (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Butterfly Effect (2004)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Butterfly Effect (2004)

Evan Treborn grows up in a small town with his single, working mother and his friends. He suffers from memory blackouts where he suddenly finds himself somewhere else, confused. Evan's friends and mother hardly believe him, thinking he makes it up just to get out of trouble. As Evan grows up he has  …fewer of these blackouts until he seems to have recovered. Since the age of seven he has written a diary of his blackout moments so he can remember what happens. One day at college he starts to read one of his old diaries, and suddenly a flashback hits him like a brick! (Read More)

Subgenre:
cult filmpunkparanormal phenomena
Themes:
cancerrapesuicidemurderdeathloverevengesurrealismreligionjealousyprisonescapefuneralmemorytravel …psychopathdeath of fatherparanoiatime travelinsanityillnessabuseunrequited lovechildhoodtraumaamnesiainheritanceself sacrificepsychological trauma (See All)
Mood:
nightmarerainmoving
Locations:
woodsforestschoolhospitalbarrestauranthotelcemeterybicyclewheelchairslumsuvprison rape
Characters:
teenage boystudentnurseteacherteenage girlboyboyfriend girlfriend relationshipfather daughter relationshipfather son relationshipmother son relationshipbrother sister relationshipprostitutegirlbabyreference to god …bullywaitresspsychiatristprofessorself mutilationchildhood friendfather in prison (See All)
Period:
future
Story:
goth girlkilling a dogwormdead dogwatching a moviebasementbaseball batcurseimpalementstabbingvomitingbeatingpantiesknifecigarette smoking …dogfightgunkissbloodviolencefemale nudityfemale frontal nudityflashbackbare chested malesex scenefemale full frontal nudityexplosionsurprise endingshowertelephone callfirecryingdreamunderwearsex in bedbeertearsanimal in titlelingeriecafecollegereference to jesus christmale pubic hairtelevisioncleavagegay slurstrangulationvideo cameraambulancebasketballsuicide attemptstabbed in the chestfemale pubic hairnonlinear timelinechild abusescantily clad femalecoffindrawingchild in perilunderwater sceneroommategraveyardmarriage proposalracial slurflash forwardattempted murderdrug addictbeaten to deathstabbed in the backmini skirtpay phonedollknocked outreadinguniversityscarcrosssevered armtherapyhatepornographydestinymedicinekilling an animalsociopathcaptivevandalismmovie theaternosebleedpsychologyhome moviemind controlcompassionfates&mtowelchokingmental institutionhaunted by the pastbraverycynicismhypnosishit on the headbutterflydynamitepedophilebilliardsaccidental killingdungeonmurder of a childconvictalternate realitycastrationfemale in showerbrainmemory lossmale objectificationstabbed in the handnotebookpedophiliajunkyardplaying poolblue pantiesjournallost loveblackoutrepressionmale in underwearasthmaself defensefraternitysororityfilm starts with texthazingmailboxtestexamessaycrotch grabpsychotherapystresschild molesteryoung manfirecrackerburning911kneelingpepper sprayrepressed memoryprosthetic limbmodel airplanechild herograve side ceremonyconvulsiontime travelerchild murders a childlung cancerchild pornographyalternate universealtering historyreference to robin hoodinhalerchildhood memoriescigarette burnsharddisturbed childhoodcat scanfatalismsedationfraternity househuman brainmemory lapsesleeping shirtlesschaos theorytoesdeath of a dogbutterfly effectaryan brotherhoodlighter fluidmk ultraunintended consequenceshypnotic regressionmace the repellentmale time travellerpsychotic childsleeping in underweartalking during a movieu haul truckartificial handbrain hemorrhagenumbnessmail bombchange historymorpho butterflybuilding model airplanechanging past event (See All)

Conviction (2010) is one of the best movies like Ginger Snaps (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Conviction (2010)

Betty Anne Waters (Swank) is a high school dropout who spent nearly two decades working as a single mother while putting herself through law school, tirelessly trying to beat the system and overturn her brother's (Rockwell) unjust murder conviction.

Themes:
obsessiondrinkingrapedeathmurderfriendshipmarriagechristmasmoneyjealousyprisonfearfuneralinvestigationdivorce …death of fatherguiltforgivenessdancing with a baby (See All)
Mood:
high school
Locations:
schoolbarchurchpolice carcourtroomlake
Characters:
photographerdancerfemale protagonistboyboyfriend girlfriend relationshipmother daughter relationshipfather daughter relationshippolicefamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfriendchildrentattoo …brother brother relationshipbrother sister relationshipgirlpolicemanbabylawyerwaitressgrandfather grandson relationship (See All)
Period:
year 1980year 1993year 1983
Story:
promiseclasstoiletstabbingclassroomdead bodyrunningdrinkcamerawatching tvcorpsebeatingknifephotographdancing …cigarette smokingcharacter name in titleviolenceblooddoggunfightnuditymale nudityone word titleflashbackmale rear nuditybare chested maletelephone callcryingcell phonefoodmirrorface slappunched in the facecomputerarrestundressingbare buttletterliebeertearssunglasseshandcuffsprayerbasketballwomaneatingdinerfalse accusationjudgeapologytrialbartenderflash forwardlimousineliarchampagnechristmas treecourtamerican flaghairy chestisolationpolicewomancharacter says i love youcabinsacrificecorrupt copstrong female characterpickup trucksupermarketbreaking and enteringlawbarncookworking classnew year's evestrong female leadbar fightremote controlprison guardshopliftinginnocenceattorneyattempted suicidedespairbribeframe upprideevidenceaerial shotconvictvoice over letternotedead mothermarital problemshamebarbed wirecandytestimonyrunning awayhomecomingarmed robberyclimbing through a windowjuryhot dogdistrict attorneywrist slittingscene of the crimednawrongful convictionmassachusettsreturning homeflashback within a flashbacksolitary confinementtrespassingclimbing out a windowdeath of grandfathermiscarriage of justicecourthousechristmas decorationsshacklesfoster homemedia frenzyperjurybeer bottlemerry christmasransackingforensicsconvicted felonpopsicleman carrying a womanaudio flashbacklaw schooldna testingfalse accusation of murderpiggy back ridelife sentenceestranged daughterhappy new yeari.d.trailer housenotaryprison visitationimmunitychief of policetroubled childhoodshaving legsexonerationmace the repellentgednew york times the newspaperlaw professormale stripteasefriskingnon profit organizationpacing the floorpulling down pantsfacial scratchimitating a blow jobbar examrod and reelmissing evidenceunfit motherblood grouphitting a policemanreference to barbara bushrepairing a roofwitness tamperingdaughter slaps motherretractiontravesty of justice (See All)

Scouts Guide To The Zombie Apocalypse (2015)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Scouts Guide To The Zombie Apocalypse (2015)

A reckless janitor accidentally releases a zombie from a laboratory of research. Meanwhile, the teenagers scouts Ben Goudy and Carter Grant decide to camp for the last time since they are too old to be scouts. The problem is that they do not want to harm the feelings of their friend Augie Foster and … the Scout Leader Rogers. They have a flat tire after hitting a deer on the road and Carter's sister Kendall Grant, her boyfriend and her friend Chloe stop their Jeep to see whether they need a ride. They invite Ben and Carter to go to a party in the night. The two scouts leave the camping during the night to go to the party. When they drive through the town, they do not see a living soul and they decide to visit a night-club since the bouncer is not at the door. They discover that people have turned into zombies and they team-up with Ben's recent acquaintance Denise Russo, who is bartender in the nightclub, and Augie that was left alone at the camp and came to the town. Soon they discover that the non-infected inhabitants have been evacuated and the town will be bombed by the government. They decide to rescue Kendall but they find that the address her boyfriend gave to them is wrong. What can they do to save Kendall? (Read More)

Subgenre:
black comedycoming of ageb movieabsurdismslapstick comedyteen movieteen comedyzombie apocalypseurban fantasy
Themes:
drunkennessdeathmurderfriendshiprevengebetrayalfearescapedeceptionmilitaryrivalryunrequited lovehome invasionexploitationapocalypse …couragemurder of a police officernear death experienceunlikely heroghost town (See All)
Mood:
high schoolgorebreaking the fourth wallone night
Locations:
woodsforestschoolbarhelicoptermotorcyclesmall townbuspolice stationstrip clubcampfirelaboratory
Characters:
teenage boyteacherteenage girlboyfriend girlfriend relationshipteenagerbrother sister relationshipzombiesoldierpolice officerhostagebest friendwaitressalcoholicolder woman younger man relationshipself mutilation …homeless manneighbor neighbor relationship (See All)
Story:
mutationinfectionstabbed in the throatcovered in bloodjanitorvirusfalling down stairsgarageexploding bodybasementmissing personsuburbvirginvanhit by a car …impalementflashlightclassroomcondomblood splattercorpseknifepartyphotographgunfightkissviolencebloodbare breastsmale frontal nuditymale rear nuditybare chested maleexplosionlesbian kisschasesurprise endingpistolfiretopless female nuditycell phoneshot to deathmachine guncar accidentshot in the chestshot in the headshotgunrescueslow motion scenecatwritten by directorbare buttpaintingbeerbombcar crashjailalcoholstripperscientistshot in the backf worddecapitationsurvivalfoot chaseambushcaliforniaaxemassacremontagestabbed to deathstabbed in the chesttied to a chairmapaccidentsevered headradiopolice officer killedshot in the legold womanshot in the foreheadon the rungunshotattempted murdercharacter repeating someone else's dialoguebeaten to deathdangerstabbed in the backportraitprologuekeyperson on fireattackuniformproduct placementrace against timetentscene during end creditsdiarygymamerican flagbodyguardwighigh school studentsplit screenloss of fatherpolicewomanpremarital sexcharacter says i love youthreatened with a knifesevered armdismembermentundeadmonkeytopless womanhand grenadefireplaceburned alivekilling an animalhead buttcagediseasejail cellwalkie talkieexploding buildingbarefoot malegrindhouseteenage protagonistback from the deadeaten alivereverse footagestealing a carbraveryu.s. armycrossbowblood on faceunderage drinkingobesityhit in the crotchhomelessstabbed in the neckresurrectionconvenience storeshot in the facebroken glassevacuationstabbed in the headmentorcigarette lighterstabbed in the legexploding headrivaljumping through a windowaerial shotwisecrack humorblood on shirtfriendship between boysone daydeerdisfigurementgasolinestabbed in the eyeclassmatebody countaxe murdertrophysevered legflat tiremale virginheroismdjblood on camera lensearphonesflagfire extinguisheroutcastshot in the neckdead animalhomagedefecationhead blown offarmored carjournallightermale friendshipabandoned housemallblood stainburnt facehead bashed inreluctant herobitten in the neckshot in the handaltered version of studio logohead cut offevil womantrampolinebadgesitting on a toilettraffic accidentbouncerstabbed in the facecellreference to star warscut into piecesscatological humorvending machineimprovised weaponburn victimshot in the crotchhouse on fireanimal killingpunch in facestupid victimknocked out with a gun buttteenage heromale male hugoutbreakzombie attackscreaming womanscientific researchselfiehardware storeliquor storestabbed in the mouththroat rippingnight clubpaddlesurprise during end creditsbechdel test failednail gunaxe in the headlearning the truthbarricademan wearing a wigfalse teethcorporalscientific experimenthand through chestscouttoupeeblood on handsboy scoutgeneration yreference to britney spearssevered penisbustid cardtoilet stallabsurd violenceclassmate classmate relationshipstabbed in the crotchcleanerhit with a frying pantire ironstabbed in the foreheadvulgar languagehit with a car doorgory violencedead deerfirst aidscreaming girltaking off underwearmarshmallowmopwoman hits manmillennialrecruitmentcampsiteknothole in chestteeth knocked outfertilizeractor talks to audiencehordejaw ripped offmale female fightbiting someonerunning out of ammoface burntooth knocked outescape out a windowgarbage chutescoutingbank notecopped feelreference to dolly partonescape out windowhomemade explosivekilling a deerobscene hand gesturecat ladyescaping out a windowpenis ripped offlock pickingcagedweed whackerescape by the windowrecruitment videoreference to bambibitten in the armreading someone's diaryface blown offwater treatment plantgearing upzombie animalevil old womanheart massagescoutmasterstabbed through the neckzombie cat (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Showing Top 50 Matches Above.
Do you need specific genre & keyword selection to find films similar to Ginger Snaps?
<< FIND THEM HERE! >>