Please wait - finding best movies...
King Henry V of England is insulted by the King of France. As a result, he leads his army into battle against France. Along the way, the young king must struggle with the sinking morale of his troops and his own inner doubts. The war culminates at the bloody Battle of Agincourt.
| Subgenre: | swashbucklerepictragedyindependent film |
| Themes: | courage |
| Locations: | franceengland |
| Characters: | warrior |
| Period: | 15th century |
| Story: | shot with a bow and arrowbow and arrowbattle of agincourtsword and shieldsword and sandalsword fighthundred years waractor shares first and last name with charactershakespeare's henry vhenry vimpaled childdauphin1400sshakespeare playlance …bloody body of a childbritish renaissancewar violenceunsubtitled foreign languagearchercrowndead childrenheroismaristocratarrowkingdommedieval timeshonorroman numeral in titlespearchild murderreference to william shakespearebattlefielddirectorial debutdirected by starwritten and directed by cast memberprincesskingimpalementmassacrecombatswordbattlehorsebased on playcharacter name in titlenumber in titleviolenceflashback (See All) |
William Wallace is a Scottish rebel who leads an uprising against the cruel English ruler Edward the Longshanks, who wishes to inherit the crown of Scotland for himself. When he was a young boy, William Wallace's father and brother, along with many others, lost their lives trying to free Scotland. O …nce he loses another of his loved ones, William Wallace begins his long quest to make Scotland free once and for all, along with the assistance of Robert the Bruce. (Read More)
| Subgenre: | epicchrist allegory |
| Themes: | couragemurderdeathlovefriendshiprevengerapebetrayalpoliticsadulteryprisonpregnancytortureweddingfuneral …executiondeath of wifefreedomdeath of daughter (See All) |
| Mood: | gorenightmarewedding night |
| Locations: | englandforestlondon englandcastle |
| Characters: | warriorfather son relationshiptough guyhomosexualitycatholicfrenchchildhood friend |
| Story: | sword and shieldsword and sandalsword fightlancewar violencecrowndead childrenmedieval timeshonorspearbattlefielddirected by starprincessimpalementmassacre …combatswordbattlehorseviolencefemale nuditybloodmale nudityone word titlefemale frontal nuditymale frontal nuditybare chested malesex scenefightbased on true storyfirevoice over narrationdreamcorpseblood splatterfalling from heighthand to hand combatprayermale pubic hairdecapitationambushdisguisethroat slittingsevered headno opening creditscontroversymarriage proposallegendprologuefarmerhangingspeechtragic eventloss of fatherkissing while having sexdismembermentsubtitled sceneburned aliveassassination attemptbarnloss of wifeblockbusteririshburialdead womanbraveryarranged marriagescotlandenglishthrown through a windowdisembowelmentgay sonrainstormsiegeinsultgay stereotypetragic heroloss of brotherwedding receptionunclemain character dieshorseback ridingunderdogloss of daughterarcheryidealismmooningcrushed headfamous scoremartyrbrotherhoodrevoltmiddle agesnationalismbagpipescavalryscottish accentchildhood sweetheartscotbattle axetortured to deathflaming arrownobilityhandkerchieftyrannykilthanged boybattering ramedinburgh scotlandpublic executiondeer huntingleprosydefenestrationsecret marriage14th centuryscottish highlandsaxe in the chesthanged child1300sknighthoodprince of wales13th centurysword throwingmass hangingjoustdrawn and quarteredbow huntingplantagenethorse killedfamous speechhalberdwar crythistlewoman's throat slitcautery (See All) |
An affair between the second in line to Britain's throne and the princess of the feuding Irish spells doom for the young lovers.
| Subgenre: | tragedy |
| Themes: | murderdeathrevengemarriageinfidelityrapebetrayaladulteryescapedanceweddingfuneralextramarital affairdeath of fatherbrutality …death of motherguiltunfaithfulnessrivalrygreeddeath of wifehuntingmurder of family (See All) |
| Mood: | rainnightmare |
| Locations: | beachchurchforestboatvillagewoodsseacastletunnelboat on fire |
| Characters: | warriorfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipboybrother sister relationshipgirlsoldierdancerpriestlove trianglelust |
| Story: | bow and arrowsword and shieldsword and sandalsword fightwar violencecrownkingdommedieval timeshonorchild murderbattlefieldprincesskingcombatsword …battlehorsecharacter name in titleviolencefemale nuditybloodmale nuditybare chested malekissfightdancingthree word titlefirepunctuation in titlewoman on topdreamblondeliehand to hand combatrunningriverdecapitationorphanambushdisguisemontagemapsevered headflash forwardlegendattackliarpoisonpassionrabbitbracelethangingdeath of husbandirelandlove interestkissing while having sexbare chested male bondagequeenpowertraitorwounddemonstrationhuntersevered handirishknightforbidden loveback from the deadambitionstabbed in the throatkickingmercilessnesskicked in the crotchrowboatcapturetribepassionate kissaxe murderdaggerhorseback ridinghistorical fictionbandagetowerblonde womansailboatdisembodied headstar crossed loverstragic lovemilitary traininganguishman on firetrapdoorhorse and wagonrise and fallthroneblasphemydying wordscryptmedievalchantingstreet vendorantidotefeastaxe fightbattle axelong blonde hairlordflaming arrowbaronfuneral pyrecoronationruinhanged boypageantcornwallhand chopped offspit in facedrawbridgeelixirlong sworddark agesjoustingtreatythrown from a horseyorkpyrerebuildingplus sign in titlefuneral cortegeceltlutesaxonhuman in a cagebetrothaldeath of queenpuffer fish6th centurythought deadunderground passagewaybritanniaviking funeralsword woundburning a corpsenursing someone back to healthburned out houseroman ruin (See All) |
In AD 922, Arab courtier Ahmad Ibn Fadlan accompanies a party of Vikings to the barbaric North. Ibn Fadlan is appalled by the Vikings customs-- their wanton sexuality, their disregard for cleanliness, their cold-blooded human sacrifices. And then he learns the horrifying truth: he has been enlisted …to combat a terror that slaughters the Vikings and devours their flesh. (Read More)
| Subgenre: | swashbucklerepiccult filmsword and sorceryfish out of waterrevisioniststonepunk |
| Themes: | murderdeathlovereligiondrinkingfearfuneraldeceptiontravelsupernatural powercannibalismmurder of brothernorse mythology |
| Mood: | gorerain |
| Locations: | forestboatwoodscavecampfire |
| Characters: | warriorfamily relationshipsfather son relationshipmother son relationshiptattooboyreference to godfacial tattoo |
| Story: | shot with a bow and arrowbow and arrowsword and shieldsword and sandalsword fightkingdomspearbattlefieldkingcombatswordbattlehorsenumber in titleviolence …based on novelblooddogfightthree word titlefirevoice over narrationcorpsedrinkvomitinghand to hand combatdead bodydemonswimminggood versus evilaxesnakesevered headfictional warunderwater scenecreaturelegendpoisonmissiontenthangingdeath of brotherhorse ridingwaterfallsevered armpoetbearsleepingcowdismembermentprincehelmetmutilationsevered handskulltorchshieldinvasioncannibalexilearabeye patchfortune tellerdaggerfast motion scenecameltranslatorprayinggreekcremationalarmvikingdigginglanguage barrierambassadorrespectheirperfumebarbarianfacial scarmiddle agesprophetdiplomatfleeingretreatbanishmentnoblemanflaming arrowhoneybonesadaptation directed by original authorreference to allahangel of deathgonghordemarauderancient times10th centurybeowulfends with funeralirish wolfhoundvisceralcannibal cultflying debrisviking shipodinviking funeralblowing one's nosemohammadvalhallapaupercaliphwashing one's handsarabian horseseastorm (See All) |
Based on a more realistic portrayal of "Arthur" than has ever been presented onscreen. The film will focus on the history and politics of the period during which Arthur ruled -- when the Roman empire collapsed and skirmishes over power broke out in outlying countries -- as opposed to the mystical el …ements of the tale on which past Arthur films have focused. (Read More)
| Subgenre: | swashbuckler |
| Characters: | warriorsoldier |
| Story: | shot with a bow and arrowbow and arrowsword and sandalsword fightmedieval timesspearbattlefieldkingcombatswordbattlehorsecharacter name in titleviolencefight …knifefightingbased on filmhelmetspin offclubknightshieldplaystation 2knife fightarmornintendo gamecubefighting gamedaggerxboxsingle playerarcherybehind enemy linescapebritish soldierancient romemultiplayervictorycavalryspin off from filmaxe fightbattle axebritish historyking arthurtomahawkexcaliburarthurian legendancient timesknights of the round table5th centuryroman army (See All) |
Set in the kingdom of Ehb, the story follows Farmer ('Jason Statham' (qv)), who was adopted by his village. When Farmer's wife, Solana ('Claire Forlani' (qv)), and his son leave to sell vegetables at the town of Stonebridge, Farmer's farm is attacked by creatures called Krugs. With the help of his f …riend and neighbor Norrick ('Ron Perlman (I)' (qv)), he travels to Stonebridge where his wife and son are. Before he arrives, the Krugs, controlled by the wizard Gallian ('Ray Liotta' (qv)), kill his son and capture his wife. Farmer, with the help of Bastian ('Will Sanderson' (qv)), his brother-in-law, and Norrick sets out to find and rescue his wife. The King's nephew Fallow ('Matthew Lillard' (qv)) is conspiring with the wizard Gallian to take over the kingdom led by King Konreid ('Burt Reynolds'). (Read More)
| Subgenre: | epictragedymartial artscult filmsword and sorcerysword and fantasy |
| Themes: | couragemurderdeathlovefriendshiprevengekidnappingpregnancytortureescapeweddingmonsterherodeceptionmagic …memorydeath of fathersupernatural powerdeath of mothergriefgreedadoptiondyingvengeance (See All) |
| Mood: | rain |
| Locations: | forestvillagewoodsfarmlakecastle |
| Characters: | warriorfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipfriendboybrother sister relationshipsoldiertough guyaction herovillainuncle nephew relationshipgrandfather grandson relationship …grandmother grandson relationship (See All) |
| Story: | shot with a bow and arrowbow and arrowsword and sandalsword fightarcherheroismkingdommedieval timeshonorspearchild murderbattlefieldprincesskingmassacre …combatswordbattlehorseflashbackviolencebloodkissfightexplosionknifechasefirecryingblood splatterfoodrescueslow motion scenefalling from heightbookshowdowntearshand to hand combatrunningneighborsubjective cameragood versus evilsurvivalwinecandleaxemountainstabbingthroat slittingbridgeeatingarmymixed martial artsprisonermapdisarming someonefictional warnecklaceduelgravelibraryattackpoisonninjapassionreadinglightningfarmerhangingpursuitdeath of sonhorse ridingpigneck breakingtrapgeneraldestinymachetecaptivestabbed in the stomachwitchcraftgenocideburialslavepresumed deadrampagetelescopethunderbraveryloss of sonbased on video gameshovelwizardpridedungeoncapturearmorraidsiegelieutenantsword duelblack magictelekinesissmokedaggerimprisonmentcrowpeasantlevitationfarmingstandoffshot with an arrowcommanderhanging upside downsorcererfantasy worldheirclimbing a treetitle in titleflamedeath of grandmotherfacial scarsorceryman on firehorse and wagondeath of parentscavalrystaffimmolationvalleydeath of grandfatherthronetear on cheekbrother in lawstrawberryretreatchopping woodmistsuit of armorflaming arrowrunning for your lifedukeboomerangfuneral pyrecatapultransackingconcubinemissing sonpickaxesuicide contemplationaudio flashbackhanged by the neckkidnapped childlong lost fatherforced laborbell towerfalling off horsewarrior womandefiancegrapesmarketplacehayloftlong lost sonbell ringingfalling into a riverallyheir to the throneclimbing a ropegorgeamazon womanturniprope around neckdeath of grandsonshroudblackbirdpet pigpeasant armyreunited with parentupward camera shotburning barndeath of nephewpillageblack blooddeath of a kingswinging on a vinewizards' duelrain of arrows (See All) |
Birth of a legend. Following King Richard's death in France, archer Robin Longstride, along with Will Scarlett, Alan-a-Dale and Little John, returns to England. They encounter the dying Robert of Locksley, whose party was ambushed by treacherous Godfrey, who hopes to facilitate a French invasion of …England. Robin promises the dying knight he will return his sword to his father Walter in Nottingham. Here Walter encourages him to impersonate the dead man to prevent his land being confiscated by the crown, and he finds himself with Marian, a ready-made wife. Hoping to stir baronial opposition to weak King John and allow an easy French take-over, Godfrey worms his way into the king's service as Earl Marshal of England and brutally invades towns under the pretext of collecting Royal taxes. Can Robin navigate the politics of barons, royals, traitors, and the French? (Read More)
| Subgenre: | epic |
| Themes: | murderdeathrevengepoliticsfuneralgamblingblindness |
| Mood: | rain |
| Locations: | franceenglandbeachchurchforestlondon englandvillageshipcastle |
| Characters: | warriormother son relationshipsoldiertough guyaction herosheriffyounger version of characterfrench girl |
| Story: | bow and arrowsword and shieldsword fightwar violencearchercrownarrowmedieval timesbattlefieldkingimpalementcombatswordbattlehorse …character name in titleviolenceflashbackbloodmale rear nuditydogtwo word titlebare chested malekissdancingexplosionsingingsurprise endingfirevoice over narrationshot to deathblood splatterfistfightshot in the chestface slapshot in the headslow motion scenepunched in the facebrawlfalling from heighthand to hand combatshot in the backdecapitationambushaxearmystabbed to deathstabbed in the chestmapno opening creditsdisarming someoneshot in the legstabbed in the backperson on firekicked in the facetough girlringattempted rapedeath of brotherdeath of sondeath of husbandcharacter says i love youkissing while having sexqueensubtitled scenetraitorfireplaceloyaltyburned alivehead buttcaught having sexkicked in the stomachknighttorchcrushed to deathbald manshieldinvasioncrossbowchaosshot in the facerowboatoutlawtitle at the endsiegeblind mansword duelowldaggerstick fightprequelpalacehorseback ridinginterrupted sexswordsmanshot in the neckreading aloudbeeshot with an arrowadventure herodomineering motherfilm starts with textshot in the throatenglishmanfacial scarfrenchmanoverbearing motherwoman slaps a manunwanted kissstaffdying wordsscottish accentfather in law daughter in law relationshipfather in lawpoacherbegins with textaxe fightscotsmanflaming arrowenglishwomanfuneral pyreoystershot in the sidewhite horsestabbed with a swordenglish subtitles in originalfrenchwomanwelshmanbritish royaltyproduced by actortaxcrown princekilled with a swordsign of the crossdaughter in lawking of englandmurdered priestbeekeeperends with narrationgrainsham marriagemother son conflictblind personferal childcrusade12th centuryface woundfacial injuryking of francechain mailbill of rightsdragged by a horsefriarkilled with an arrowmother slaps sonnottingham englandposing as husband and wifebody odorirish wolfhoundaxe in the backburning a documentelbowed in faceshell gamespoiled sonthrowing water on someoneinscriptiondeath of father in lawfemale slaps a malepretending to be marriedenglish nobilityreference to the prodigal sonface scar1190sarrow through neckdeath of a kingassuming identity of a dead personblind person reads a facedonkey cartking richard iprince johnstabbed with a daggertrampled by a horseunpaid taxes (See All) |
It is the time of the Crusades during the Middle Ages - the world shaping 200-year collision between Europe and the East. A blacksmith named Balian has lost his family and nearly his faith. The religious wars raging in the far-off Holy Land seem remote to him, yet he is pulled into that immense dram …a. Amid the pageantry and intrigues of medieval Jerusalem he falls in love, grows into a leader, and ultimately uses all his courage and skill to defend the city against staggering odds. Destiny comes seeking Balian in the form of a great knight, Godfrey of Ibelin, a Crusader briefly home to France from fighting in the East. Revealing himself as Balian's father, Godfrey shows him the true meaning of knighthood and takes him on a journey across continents to the fabled Holy City. In Jerusalem at that moment--between the Second and Third Crusades--a fragile peace prevails, through the efforts of its enlightened Christian king, Baldwin IV, aided by his advisor Tiberias, and the military restraint of the legendary Muslim leader Saladin Ayubi . But Baldwin's days are numbered, and strains of fanaticism, greed, and jealousy among the Crusaders threaten to shatter the truce. King Baldwin's vision of peace--a kingdom of heaven--is shared by a handful of knights, including Godfrey of Ibelin, who swear to uphold it with their lives and honor. As Godfrey passes his sword to his son, he also passes on that sacred oath: to protect the helpless, safeguard the peace, and work toward harmony betwe… (Read More)
| Subgenre: | epic |
| Themes: | couragemurderdeathlovesuicidemarriageinfidelityreligionadulterymilitarycorruptionself sacrificereligious conflict |
| Mood: | gore |
| Locations: | francedesertitalycastleisraelwalled city |
| Characters: | warriorfather son relationshipbrother sister relationshipsoldierpriestchristianchristianitymuslimfrench |
| Story: | bow and arrowsword and shieldsword and sandalsword fightheroismarrowkingdommedieval timeshonorspearkingimpalementmassacreswordbattle …violencebloodsex scenetitle spoken by characterfirecorpseshot to deathblood splattershot in the chestface slapshot in the headfalling from heighthand to hand combatprayershot in the backdecapitationthroat slittingarmystabbed in the chestsevered headno opening creditsritualstabbed in the backperson on firepassioncrossloss of fatherqueenchesstraditionburned aliveislamstabbed in the stomachcrucifixloss of wifeknightsocial commentaryshieldmiddle eastbraveryarranged marriageloss of sonstabbed in the throathatredstabbed in the headstabbed in the legarabarmorsiegestabbed in the eyewilhelm screamloss of brothercamelpalestineunhappy marriageanti warabuse of powershipwrecktreasonjerusalemarcherywellfortressshot in the eyeloss of childshot in the throattolerancedisfigured facecaravanbowmiddle agesriteblacksmithdeformitysailing shipgrave diggingcustommacebattle axeflaming arrowship wreckcatapultpacifistloss of faithsultanpilgrimpublic executionestranged parentleprosycrusadesmegalomaniacorrupt priestcrusaderhead on a stake12th centuryleperpublic hangingcitadelholy landdeformed manholy warvisceralveiled woman1100sboiling oilsaracenmessina italy (See All) |
In 1412, a young girl called Jeanne is born in Domremy, France. The times are hard: The Hunderd Years war with England has been going on since 1337, English knights and soldiers roam the country. Jeanne develops into a very religious young woman, she confesses several times a day. At the age of 13, …she has her first vision and finds a sword. When coming home with it, she finds the English leveling her home town. Years after that, in 1428, she knows her mission is to be ridding France of the English and so sets out to meet Charles, the Dauphin. In his desperate military situation, he welcomes all help and gives the maiden a chance to prove her divine mission. After the successful liberation of Orleans and Reims, the Dauphin can be crowned traditionally in the cathedral of Reims - and does not need her anymore, since his wishes are satisfied. Jeanne d'Arc gets set up in his trap and is imprisoned by the Burgundians. In a trial against her under English law, she can't be forced to tell about her divine visions she has had continuously since childhood. Being condemned of witchcraft and being considered as relapsed heretic, she is sentenced to death. Jeanne d'Arc is burnt alive in the marketplace of Rouen on May 30th, 1431, at only 19 years of age. (Read More)
| Subgenre: | epiccult filmperiod drama |
| Themes: | murderdeathsurrealismrapebetrayalpoliticsfuneralbrutalitydeath of mother |
| Mood: | rainreligious |
| Locations: | francechurchparis francevillagecastlefrench village |
| Characters: | teenage girlfemale protagonistgirlsoldierpriestfrench |
| Period: | 15th century |
| Story: | shot with a bow and arrowbow and arrowsword and shieldsword fighthundred years wardauphin1400swar violencecrownkingdommedieval timesspearkingimpalementcombat …swordbattlecharacter name in titleviolencef ratedbloodbased on true storyblood splatterhand to hand combatinterrogationreference to jesus christfightingdecapitationaxethroat slittingarmysevered headtrialdream sequencedisarming someoneconfessionfantasy sequencemissionsevered armprofanitywolfburned aliveheroinecrucifixknighttorchaction heroineransomfemale warriorhaircutcrossbowmiracletime lapse photographysiegeunclemain character diesauntnecrophiliaconfessionalfortressfemale heromother in lawcarnagebishopconsciencecathedralmartyrtragic endingdeath of title characterinfantrymain character shotvictorycavalryrise and fallsevered footretreattoothdefeatmacebattle axeflaming arrowdukedying youngcoronationstabbed with a swordbannerburned at the stakebad actingheresyfrench historywolf packhereticjoan of arcdrawbridgelong swordcasualty of wararmy captainstabbed with a spearwoman dressed as a manburning villagemoatbad guys wincourt intriguetraveling shotover actingwoman on fireheroine diestrebuchetshot on locationwartime rapeburning cityreligious convictionamerican actor playing foreignerfemale knightfrench courtuntimely death (See All) |
In this case, a group of archaeologists and combat experts led by Paul Walker and Frances O'Connor use a "3-D fax machine" (so much for technobabble!) to time-travel back to France in 1357, in hopes of retrieving Walker's father and returning safely to the present. No such luck! Fending for themselv …es against marauding hordes of medieval French warriors at war with the invading British, these semi-intrepid travelers find their body count rising, and the deadline for their return home is rapidly approaching. (Read More)
| Subgenre: | swashbucklercult filmfish out of watersword and fantasy |
| Themes: | murderdeathlovefriendshiprevengesurrealismdrinkingescapeherodeceptiontime travel |
| Locations: | francehospitalmotorcycleairplanevillagecastlerooftoptunnelcave in |
| Characters: | warriorfather son relationshippolicefrienddoctorteacherstudentpolicemantough guyteacher student relationshipprofessor |
| Story: | shot with a bow and arrowbow and arrowsword fighthundred years wararrowkingdommedieval timesspearbattlefieldcombatswordbattlehorseviolencebased on novel …bloodone word titlekissfightexplosiontelephone callfirecell phonerescuecomputerdrinkfalling from heightshowdownbeerhand to hand combatambushaxestabbingstabbed to deathstabbed in the chestdisarming someonefictional warduelstabbed in the backlocker roomstatueopening action scenehorse ridingsubtitled scenearsoneyeglassesgrenadebeer drinkinghelmetmad scientistknighttorchcannonshieldmobile phonecapturesiegesword duelruinsmonasterytime machineshot with an arrowmarinearcheryarcheologyartifactreluctant herotour guidehistorianairfieldman on fireinfantrycavalryburning buildingscientific researchscottish accentmacearchaeologistwormholeflaming arrowsteel helmetbody armorcatapultswordplayaltering historyarcheological digprototypesecret experimentcarvingmagelucky charmelectro shock1300ssecret lablost fatherancient swordtrebuchetexperiment on oneselffemale archaeologistmedieval francesilver city new mexico (See All) |
The Kingdom of Alagaesia is ruled by the evil King Galbatorix, a former dragon rider that betrayed his mates and his people in his quest for power. When the orphan farm boy Eragon finds a blue stone sent by Princess Arya, he sooner realizes that it is a dragon egg. When the dragon Saphira is born, E …ragon meets his mentor Brom, and becomes the dragon rider foreseen in an ancient prophecy that would set his people free from the tyrant Galbatorix. Eragon meets the rebels Varden and together they fight against the evil sorcerer Durza and the army of Galbatorix in a journey for freedom. (Read More)
| Subgenre: | swashbucklerepicmartial artscult filmsword and sorcerysword and fantasy |
| Themes: | couragemonsterheromagicmythology |
| Locations: | castle |
| Characters: | warriorsoldiertough guy |
| Story: | shot with a bow and arrowbow and arrowsword and sandalheroismkingdomspearbattlefieldkingcombatswordbattlehorsecharacter name in titlebased on novelone word title …fightbased on booksecrethand to hand combatdemonfightingsubjective cameragood versus evilambushdeath of friendmixed martial artsdisarming someonefictional wardueldragonegghunterknightdwarfwizardsiegesword dueltragic herodaggerstick fightelfadventure herofantasy worldsword fightingopen endedchosen onestaffteenage herofictional countrybattle axeteenager fighting adultfire breathing dragonswordplayevil kingevil wizardhaystackflying dragondragon riderdragon featurehuman dragon relationship (See All) |
At the turn of the century, the young lord Vlad and his family live a peaceful life ruling over their small kingdom, but when a Turk warlord demands from Vlad a thousand boys and his son to create an army Vlad seeks a terrible power that will allow him to protect his kingdom and family from the Turk …s at a terrible cost. (Read More)
| Subgenre: | tragedychrist allegory |
| Themes: | murderdeathloverevengesurrealismsuicidekidnappingbetrayalfeardeceptionbrutalitysupernatural powerdeath of motherhopedeath of wife …self sacrificemythologynear death experience (See All) |
| Locations: | churchforestlondon englandwoodscastlecave |
| Characters: | warriorhusband wife relationshipfather son relationshipmother son relationshipsoldierhostagetough guyvampireaction heroself mutilationex soldierself healingblood lust |
| Period: | 15th century |
| Story: | bow and arrowsword fightcrownkingdommedieval timesspearbattlefielddirectorial debutimpalementmassacrecombatswordbattlehorsecharacter name in title …flashbackviolencebloodbare chested maleexplosionknifechasesurprise endingfirevoice over narrationbeatingcorpseblood splatterrescueslow motion scenepunched in the facefalling from heightshowdownhand to hand combatrunningdemonriversubjective cameragood versus evilcandleambushaxemountainthroat slittingarmystabbed to deathstabbed in the chestmapno opening creditsanti heroone man armychild in periltransformationon the runflash forwardattempted murderone against manylegendcursestabbed in the backscreamingperson on firecharacter's point of view camera shottentevil manlightningskeletonshot in the shoulderscarcrossthreatened with a knifesevered armgeneralbare chested male bondagerefugeesubtitled scenefreeze frameprincestylized violencemaniacdestinywolfburned alivehead buttgothicheavy rainhelmetcrucifixloss of wifespiderskulltorchmonkburialanimal attackback from the deadcannonshieldhaunted by the pastreincarnationinvasionstabbed in the throatanimated sequencehatredresurrectionevacuationfalling to deathimmortalitythunderstormstabbed in the legdark herorainstormdeerarmorknife throwingsiegetragic heroblack magicburned to deathpigeonprequelbatyellingdraculamonasteryromaniasuper strengthtowerstreet marketworld dominationhearing voicesfall from heightbitten in the neckeastercaperighteous rageturkishimmortalshapeshiftingwarlordvampirismmountain climbingarmy baseglowing eyesarmorydeal with the devilthronex rayed skeletonregenerationhorse drawn carriagescrolltarantulasuit of armordecomposing bodysuper speedstabbed in the foottransylvaniadrinking bloodchild soldierflaming arrowmessengercoming out of retirementfall to deathfangssunlightoutnumberedsilversultanturkbegins with narrationfangcrucifix pendanttunicwooden stakebuilding firex ray visionheat visionfaustianwater wheelsilver coinsupervillian originswarm of batsarmy on the march (See All) |
Sir Robin of Locksley, defender of downtrodden Saxons, runs afoul of Norman authority and is forced to turn outlaw. With his band of Merry Men, he robs from the rich, gives to the poor and still has time to woo the lovely Maid Marian, and foil the cruel Sir Guy of Gisbourne, and keep the nefarious P …rince John off the throne. (Read More)
| Subgenre: | swashbucklerhistorical event |
| Themes: | murderescaperobberytheftjustice |
| Mood: | poetic justice |
| Locations: | englandforestcastle |
| Characters: | warriorsoldiermusicianthieftough guythief hero |
| Story: | shot with a bow and arrowbow and arrowsword and shieldsword fightlancearrowmedieval timesspearbattlefieldcombatswordbattledancingknifechase …rescueshowdowngood versus evilcandleambushprisonertrialdisarming someonefishingfictional warduellegendhangingvigilanteprinceropefireplacerebelknighttournamentslaveshieldcrossbowfight to the deathdrummeroutlawknife fightcapturedeersword dueldictatordaggerstick fightswordsmanhistorical fictionrobbervigilantismtreasonhideouttavernvigilante justicebishopnoosechainedoutlaw gangrevoltmiddle agestrapdoorhorse and wagonvictorytargetbanquethorse chasemaceoathsteel helmetvineprocessioncoronationgallowscartoutnumberedwinkbritish royaltypiggy back ridejewelsencampmentking of englandpushed down stairsmarksman12th centuryroastsaved from hanginginterrupted hangingfriarriver battleluteusurpernarrow escapesaxongentleman thiefplantagenetbullseyequill penregentswordsmanshipnormanquarterstaffportcullislongbow1190sfire pitsherwood forestthatched roof (See All) |
Set in the mystical lands of Persia, a rogue prince and a mysterious princess race against dark forces to safeguard an ancient dagger capable of releasing the Sands of Time -- a gift from the gods that can reverse time and allow its possessor to rule the world.
| Subgenre: | swashbucklermartial artssword and sorcerysword and fantasy |
| Themes: | murdermarriagebetrayalescapeherodeath of fathertime travel |
| Locations: | snowdesert |
| Characters: | warriorsoldiertough guyaction hero |
| Story: | shot with a bow and arrowbow and arrowsword and sandalsword fightkingdomprincesskingcombatswordbattlehorseviolenceflashbackkisstitle spoken by character …explosionchaseshowdownhand to hand combatkung fugood versus evilfoot chaseorphanassassinambushaxemountainarmycolon in titlemixed martial artssnakefalse accusationno opening creditsanti heroone man armyfictional waron the runone against manyfugitivebrotherprincestylized violencestrong female characterdestinycountry name in titleraceassassination attemptheroinespin offstrong female leadreverse footageshieldsandcrossbowseven word titledual wieldbased on video gamechaosframe updeceitbounty hunteralternate realitytigersword duelblack magicdaggerframed for murderunclepalaceswordsmanparkourfortresssorcereradopted sonmacguffinrobesword fightingtitle in titleempirecorrupt officialsubterraneanarmageddonpersiandukeostrichsandstormbrother versus brotherhourglasssheikpersiahuntedoasismagical objectheir to the thronewantedchanging the futuredeath of kingtime reversalfrozen timebrother against brotherstreet urchinbrother killing brotherregentprince of persiabrother brother hugbrother betrays brother (See All) |
Lt. John Dunbar is dubbed a hero after he accidentally leads Union troops to a victory during the Civil War. He requests a position on the western frontier, but finds it deserted. He soon finds out he is not alone, but meets a wolf he dubs "Two-socks" and a curious Indian tribe. Dunbar quickly makes … friends with the tribe, and discovers a white woman who was raised by the Indians. He gradually earns the respect of these native people, and sheds his white-man's ways. (Read More)
| Subgenre: | epicindependent filmrevisionist western |
| Themes: | couragemurderfriendshipsuicidemarriageweddingherobrutalityhunting |
| Locations: | rural settingcampfire |
| Characters: | warriorsoldiertough guynative americanself discoverymilitary officer |
| Period: | 19th century1860s1840s |
| Story: | shot with a bow and arrowbow and arrowwar violencehonorspearbattlefielddirectorial debutdirected by starmassacrecombatswordbattlehorsecharacter name in titleviolence …flashbackbased on novelbloodmale nuditymale rear nuditytitle spoken by characterknifethree word titlepistolvoice over narrationshootoutbeatingshot to deathblood splatterrescueslow motion scenegunfighthand to hand combatanimal in titlerevolverambushstrangulationarmywidowcontroversycoffeeattackcowboystorytellingtough girlskeletondiaryprankgiftpremarital sexgeneraltrustcivil warwolfwhat happened to epiloguehead buttfaintingcowboy hatassaultblockbusterflatulenceclubculture clashanimal attackinterracial romanceknife fightprisoner of warrainstormraidbonfirehorseback ridingdefecationjournalmigrationarcheryanimal abusecowboy bootslanguage barriertennesseewetting pantsbayonetamerican civil warfamous scoremusketorchestral music scorekansassix shooteradopted daughterfortrepeating rifleflintlock riflestockholm syndromebuffalocowboy shirtscreenplay adapted by authortranslationfrontiernebraskascalpingwestern heroname changestampedetomahawkspear throwingoutpostmedicine manadoptive fatheru.s. civil warsouth dakotawar paintcarcassbisonkilling a horsewarrior racemale soldieradoptive father adopted daughter relationshiptradingcarbinefield hospitalhenry riflegrasslandgreat plainssioux tribesymphonic music scoreriver battlesquawadoptive parentnative american white relationshipsadopted girlnative american chiefnative american languageleitmotiftribal warsiouxnoble savagewestward expansionnorth american indianlakota indianpawnee indian (See All) |
Conquering 90% of the known world by the age of 25, Alexander the Great led his armies through 22,000 miles of sieges and conquests in just eight years. Coming out of tiny Macedonia (today part of Greece), Alexander led his armies against the mighty Persian Empire, drove west to Egypt, and finally m …ade his way east to India. This film will concentrate on those eight years of battles, as well as his relationship with his boyhood friend and battle mate, Hephaestion. Alexander died young, of illness, at 33. Alexander's conquests paved the way for the spread of Greek culture (facilitating the spread of Christianity centuries later), and removed many of the obstacles that might have prevented the expansion of the Roman Empire. In other words, the world we know today might never have been if not for Alexander's bloody, yet unifying, conquest. (Read More)
| Subgenre: | epictragedymartial artscoming of ageconspiracymelodramachrist allegory |
| Themes: | couragemurderdeathfriendshiprevengemarriagebetrayaljealousypoliticspregnancyfeardrunkennessescapedancewedding …herodeceptionseductionangerdeath of fatherbrutalityparanoiadysfunctional familywrestlingfaithexecutionphilosophynear death experiencegreek mythologyhomosexual love (See All) |
| Mood: | gorewedding nightgreek myth |
| Locations: | snowdesertcavejungleindiawalled city |
| Characters: | warriorhusband wife relationshipfather son relationshipmother son relationshipdoctorteachersoldierdancertough guyaction herobest friendinterracial relationshiphomosexualityteacher student relationship …snipergay frienddeath of herohomosexual kissdancing girl (See All) |
| Story: | bow and arrowsword and sandalsword fightwar violencearchercrownarrowkingdomhonorspearbattlefieldprincesskingimpalementcombat …swordbattlehorsecharacter name in titleflashbackviolencefemale nuditybloodmale nudityone word titlebare breastsfemale frontal nuditymale rear nuditydogbare chested malefemale rear nudityfightfemale full frontal nuditydancingtitle spoken by characterpartyknifesurprise endingfiretopless female nudityvoice over narrationcorpseshot to deathblood splatterfistfightshot in the chestface slapshot in the headslow motion scenepunched in the facecatarrestbrawlbare buttletterhand to hand combatbedhallucinationorgyrivershot in the backsubjective cameradecapitationcleavagebisexualstrangulationaxemountainstabbingdeath of friendthroat slittingarmystabbed to deathmixed martial artsstabbed in the chestmapsnakenonlinear timelinesevered headno opening creditsanti heroscantily clad femaleassassinationdouble crossritualspankingfemme fataleshot in the legtrainingflash forwardattempted murdertreelegendargumentstabbed in the backpoisoncharacter's point of view camera shotstatuetentlightningopening action sceneringshot in the shouldercourtmanipulationscargiftloss of fatherthreatened with a knifesevered armshot in the armgeneralbearqueendismembermentmonkeyprincetraitordestinyloyaltyrevelationwhat happened to epilogueassassination attemptnipples visible through clothingelectronic music scoreheavy rainhelmetslaveryroyaltytold in flashbackelephantloss of loved onedysfunctional marriageblockbusterservantparadetorchfateanimal attackcrushed to deathambitionindianslavefull moonshieldvisionbraveryinvasionstabbed in the throathatredstabbed in the neckshot in the facegreecestabbed in the headthunderstormstabbed in the legdeath of protagonistdark heroliondisembowelmentaerial shotrainstormtigertribestabbed in the eyepassionate kisstragic herosevered legparrotmain character diespalacedrugged drinkcamelblood on camera lensbisexualityforename as titlegreekshot in the neckwar herometaphorsex slaveeuthanasiatreasonlost loveshot with an arrowyoung version of characterarcheryidealismstabbed in the armemperorpsychedelichead bashed inwetting pantsmercy killingshamanarenacolonialismleadereaglestabbed in the shoulderfinal battleshot in the throathistorianspastabbed in the facedeath of title characterdistrustharemspitting bloodwarlordheroic bloodshedsorceresscavalryflashback within a flashbacksnake bitephilosopherancient egyptanimal killingbanquetassassination plotrainforestknife held to throatepic battleends with textretreatclothes rippingdutch anglescrollbird cageleadershipancient greecememoirmutinystabbed in the footjugglerone eyed manstruck by lightningbody armoreunuchcouncilbad motherpantherscreaming in painreference to aristotleoutnumberedoedipus complexantiquityhusband wife estrangementspear throwingjungle warfareconquestanimal sacrificeentrailsherculeschariotfilm starts with quotewar woundpersiastabbed through the chestzeusbloody sprayfire eatercave paintingtrippyends with historical notesmeleemacedonia25 year oldalchemistguerrilla warfarecavalry chargehadessurroundedpoisoned drinktemptresstitanthrown from a horsetunicathenaancient worldblack panthercriminal trialapollocave drawingfield hospitalnile riversnake charmerbabylonreference to zeusalexandria egyptjourney shown on mapmonsoonanti arabharnesssuccessordereliction of dutypiketroyafrican lionscribeherbal medicinereference to oedipusshot through the chestalexander the greatbabylon babyloniapersian catreference to achillesmedeaconquerorman boy loveinspirational speechcity stateprometheusreference to aphroditebattle cryreference to prometheusexecuting the woundedone eyed characterriding at a gallopfalse colorpolitical marriageroman salutebattle tactic (See All) |
| Subgenre: | martial artsblack comedysuspensesupernaturalfairy talesword and sorcerydark fantasysword and fantasybased on fairy tale |
| Themes: | couragemurderdeathloverevengesurrealismkidnappingmarriagebetrayalfearescapemonsterherodeceptionmagic …angerobsessionsupernatural powerredemptionguiltinsanitygriefevilunrequited loveexecutionhopegreedpanicnear death experienceregretmurder of family (See All) |
| Locations: | churchforestsnowvillagewoodscastlecampfire |
| Characters: | warriorsoldierbabyhostagesister sister relationshipthieftough guyaction herolittle girllittle boy |
| Story: | bow and arrowsword fightarchercrownheroismkingdomspearbattlefielddirectorial debutkingimpalementmassacrecombatswordbattle …horsecharacter name in titleviolenceflashbackbloodsequelbare chested malekissfightexplosionknifechasesurprise endingvoice over narrationbeatingcorpsefistfightmirrorshot in the chestface slapshot in the headrescueslow motion scenepunched in the facebrawlshowdownhand to hand combatsecond parthallucinationriversubjective cameragood versus evilorphancandleambushaxemountainmontagebridgearmymixed martial artsstabbed in the chestsnakefalse accusationno opening creditsanti herobirddisarming someoneone man armychild in perilfictional wardouble crosscreaturefemme fatalenecklacetransformationon the runtrainingflash forwardskinny dippingone against manycharacter repeating someone else's dialoguebeaten to deathdangerstabbed in the backprologuescreamingattackfantasy sequencefugitivemissionkicked in the facedeath of childtough girlscene during end creditsmanipulationthreatened with a knifewaterfallflowerprofanitylove interestqueenmonkeypowerstylized violencechessiceeavesdroppingtraitorgoldwolffireplaceburned aliverevelationhead buttassassination attemptheavy rainlooking at oneself in a mirrorquestcatfighthelmetspin offkicked in the stomachvillainessjumping from heightfrogirishfaked deathmind controlforbidden lovetorchaction heroineanimal attackback from the deadbar fightpresumed deadfemale warriorguarddwarfreverse footageshielddiamondvisiontarget practicebraverycrossbowfight to the deathfairydual wieldmercilessnessresurrectiondark humorsuper villainimmortalityrowboattime lapse photographypunched in the chestengagementbooby trapaerial shotknife fightdeerpassionate kissblack magicburned to deathowltelekinesisstick fightprequelpalacetelepathyimprisonmenthappy endingfemale soldierfinal showdownworld dominationcomic reliefshot with an arrowmegalomaniacyoung version of characterarcheryfortresshearing voicesnarcissismtavernreluctant herotentacleman kills a womanmacguffinwoman kills a manaltered version of studio logogoblinstabbed in the shoulderbleeding to deathevil womantragic lovedeath of familywoman fights a manwarlordsorceresscoup d'etatwoman slaps a manmind readingone woman armybo staffimprovised weaponchainsanimal killingrock climbinghalf brotheranti heroineglowing eyeschild abductionsecret lovethronepower strugglescottish accenthorse drawn carriagenetbanishmentsuit of armoraxe fightsurprise during end creditsorigin of herochild soldierflaming arrowstudio logo segues into filmdukeman fights a womantrackercoronationnarcissistmohawk haircutcaught in a netfemale thieftailrope bridgethrown from heightcloakevil laughterreference to snow whitefreeze to deathevil queenbackflipsentenced to deathelkmagical mirrormeltingsororicidemagical creatureaxe throwingbrothers grimmtunicprequel and sequelblack bloodsnow queen (See All) |
Set against the coming of Christianity, this is the story of the last hero: in 507, a monstrous troll wreaks havoc in the mead hall of the Danish king, Hrothgar. He offers rewards for the death of Grendel, so Beowulf, a great and boastful Geat warrior, arrives with his thanes. Beowulf sets aside his … armor and awaits the monster; a fierce battle ensues that leads to Beowolf's entering the watery lair of Grendel's mother, where a devil's bargain awaits. Beowulf returns to Herot, the castle, and becomes king. Jump ahead many years, and the sins of the father are visited upon Beowulf and his kingdom. The hero must face his weakness and be heroic once again. Is the age of demons over? (Read More)
| Subgenre: | epictragedycult filmsword and sorcerycomputer animationcgi animationadult animation |
| Themes: | couragemurderdeathfriendshiprevengesuicideinfidelityadulterydrinkingdrunkennessfuneralmonsterheromagicmemory …seductioncorruptionbrutalityobsessionredemptioncannibalismvengeanceinheritancemythology (See All) |
| Mood: | gore |
| Locations: | beachchurchforestseashipcastlecaveoceanstorm |
| Characters: | warriorhusband wife relationshipfather son relationshipmother son relationshipsingersoldierpriestchristianitymermaiddeath of herohuman versus monster |
| Story: | bow and arrowsword fightarchercrownkingdomhonorspearkingimpalementmassacrecombatswordbattlecharacter name in titleviolence …sexfemale nuditymale nudityone word titlefemale frontal nuditybare chested malekissfighttitle spoken by charactersingingchasesurprise endingfirebeatingdreamcorpseblood splatterslow motion scenereenactmentbrawlfalling from heightdemondecapitationgood versus evilstabbingdeath of friendthroat slittingbridgearmystabbed to deathapologysevered headno opening creditsritualcreatureduelgravelegendcursebeaten to deathstabbed in the backperson on fireactor playing multiple rolesdragonsadnessratsevered armqueendismembermenthatepowergoldloyaltyburned alivequestfametold in flashbackmutilationdenmarktreasurebuttocksgiantservantburialanimal attackeaten alivecelebrationpromisedwarfshieldfight to the deathloss of sonstabbed in the throatprophecystabbed in the headswampstabbed in the legdisembowelmentheartslaughterarmordisfigurementstabbed in the eyebroken armloss of husbandtragic herosevered legdaggersinshamereflectionnecrophiliavikingshot with an arrowarcherystabbed in the armfortressburnt facetaverncrushed headtrollseductressstabbed in the shoulderbleeding to deathheirmartyrclawritedeformityheart ripped outburning buildingsailing shiploinclothexpressionismcustomrewardarm ripped offillegitimate sonbased on poemleadershipfeastsagabattle axefalling off a cliffhornaxe in the headsliced in twoorigin of herotreasure cheststabbed in the sidedanishfuneral pyrecoronationburned bodyfire breathing dragonfake bloodtorn in halfconquestnude fightlairchildlessnessmotion capturedeath by firesplit in twodesecrationdark agesfleethospitalityhero worshipcandlestickweaknesswenchavariceretellingspear through chestswimming competitionsword throwingdeath by swordnorsestabbed in chestwinged dragontrampled to deathfuneral riteseacoastancient sworddragon riderraider6th centuryragnarokhuman versus dragontest of characterrafterbare backburning churchburning citymonster childhuman fallibilityold englishbeast's heart (See All) |
As the Greeks fall, they decided to head back home. King Priam decides to have one last battle with the Greeks to leave Troy for good. It was a night battle so the Greeks didn't knew, raining them down with flaming arrows and lighting huge balls of dry branches and rolling them down at the beach. It … was a battle that Achilles wasn't in, but his cousin Patroclus pretended to be him by wearing his armor, his sword, his helmet, and his moves. Hector finally had a battle with Achilles not knowing it wasn't him. Patroclus was fast but Hector was faster, causing him to cut Patroclus's neck and finishing him with a sword to the heart. (Read More)
| Subgenre: | epictragedymartial artssword and sorcery |
| Themes: | revengerapebetrayaladulteryfearescapeheromilitarybrutalitygreedvengeancemythologygreek mythology |
| Mood: | goremythgreek myth |
| Locations: | villagecityshipwalled city |
| Characters: | warriorhusband wife relationshipfather son relationshipbrother brother relationshipsoldierbabypriestbest friendcousin cousin relationshipdeath of hero |
| Story: | shot with a bow and arrowbow and arrowsword and sandalsword fightarcherkingdomhonorspearbattlefieldkingimpalementswordbattlefemale nudityblood …male rear nuditysex scenekissfemale rear nudityfighttitle spoken by characterknifesurprise endingcorpseblood splatterblondeundressingfalling from heighthand to hand combatplace name in titlecleavagethroat slittingarmystabbed in the chestscantily clad femaleritualduelstabbed in the backperson on firemistaken identitytentopening action scenecity name in titlegiftkissing while having sexqueenpowerprincehammerblockbusterslaveshieldbraveryinvasionold agefight to the deathloss of sonstabbed in the throatimpostorstabbed in the headstabbed in the legarmorsiegeloss of husbandtragic herowilhelm screamdaggerchallengemain character diespalaceadulterous wifegategreekcremationfemale removes her dressfireballshot with an arrowarcherystabbed in the armnavyfatherhoodstabbed in the shouldercowardempiretreacheryshot in the footstabbed in the facebrotherhoodritegodlong brown hairthroat cutlootingcustomcorridorretreatcowardicefeastancient greecebrandinglong blonde hairflaming arrowwarshipstabbed in the sidefuneral pyreprotegeantiquitychariotgreek godegotismcourtyardfarewellstabbed through the chestpriestessancient civilizationdeath sceneescape plangreco roman wrestlingdesecrationfighting moviestitchfleetachilles tendon cutgloryancient worldhuman brandinglast wordstakeoverheroicagreementpyreends with funeraltrojan horseoverthrowposeidonbronze agetroyplundervindicationjavelintrojan warsword woundburning cityfavorite sonhelen of troyromance subplotaegean seaheelancient troybroken arrowcall to armstrojan (See All) |
A quest that begins as a personal vendetta for the fierce Cimmerian warrior soon turns into an epic battle against hulking rivals, horrific monsters, and impossible odds, as Conan realizes he is the only hope of saving the great nations of Hyboria from an encroaching reign of supernatural evil.
| Subgenre: | epicmartial artssword and sorceryalternate historysword and fantasy |
| Themes: | murderdeathrevengesuicidekidnappingjealousypregnancytortureescapeheromagicdeath of fatherbrutalitysupernatural powerdeath of mother …crueltydeath of wifevengeancedeath of daughtermurder of fatherdeath in childbirth (See All) |
| Mood: | gore |
| Locations: | snowboatwoodscastlecampfirewalled city |
| Characters: | warriorhusband wife relationshipfather son relationshipfather daughter relationshipboysoldierthieftough guyaction herowitchsingle fatheryounger version of characterdancing girl |
| Story: | shot with a bow and arrowbow and arrowsword and sandalsword fightarcherspearbattlefieldprincesskingimpalementmassacrecombatswordbattlehorse …character name in titleviolenceflashbackfemale nuditybloodmale nuditybare chested malesex scenefightexplosionknifechasethree word titlefireshot to deathblood splatterfistfightshot in the chestremakeshot in the headrescueslow motion scenefalling from heightmaskbased on comicshowdownhand to hand combatinterrogationdemonfightingshot in the backdecapitationgood versus evilfoot chaseassassinbound and gaggedbased on comic bookambushname in titleaxemountaindisguisethroat slittingstabbed to deathmixed martial artsstabbed in the chestsevered headnunno opening creditsanti herodisarming someoneone man armychild in perilfictional warritualunderwater scenecreatureshot in the legdrowningone against manybeaten to deathstabbed in the backkeyperson on fireattackevil mankicked in the facetough girlscarchildbirthexploding bodyneck breakingpremarital sextied upthreatened with a knifemercenarywaterfallsevered armfreeze framesingle parenthenchmanpirateburned alivekilling an animalhead buttassassination attempteggcatfightslaverymutilationkicked in the stomachjumping from heightmonkanimal attackgoatinterracial friendshipcrushed to deathback from the deadslavecelebrationfemale warriordamsel in distressadventurerdual wield3 dimensionalchaosgash in the faceresurrectionfalling to deathprophecystabbed in the headstabbed in the legpunched in the chestdark herodungeoncapturedisfigurementeye patchpassionate kissdemonic possessionsword duelblack magicburned to deathdaggerstick fightpipe smokingpalaceswordsmandriftermonasterymusclemanstrongmanfireballhuman sacrificeworld dominationshot with an arrowmegalomaniacadventure herosorcerertaverntentacletestcrushed headsword fightingslingshothammockchainedbarbarianprehistoric timesfacial scarrighteous rageclawsubterraneanblacksmithwarlordarm wrestlingavalanchesorceresscavalryhouse firebonefetusman hits a womanincestuous desiresailing shipstarts with narrationhorse chasewagonsuit of armoraxe fightbattle axenewbornstabbed in the footbuilding collapseone eyed manboulderserpentcatapultwoman in laborstudent teacher relationshiprite of passagestabbed with a swordoraclepulp fictionstone ageancientfalling through icerope bridgepoisonedevil sorcererremake of cult filmmurder of a pregnant womananvilspyglasschained to a wallwarrior womanmaster apprentice relationshipcaesarean birthrun overbound in chainsstabbed with a speartasting bloodsandmanshackledsevered noseslave girlburning villagetwo on a horsegiant octopushorse drawn wagonrobert e. howardbased on pulp magazinefreed slavecaesarean sectionmolten metalchild warriortrebuchetswallowing a keyjumping off cliffpaleolithic ageseeing father murderedvolley of arrowsfall through floor10000 b.c.100th century b.c.four against onehyborian agenatural bridgetied to a wagon wheelsword forging (See All) |
When a mercenary warrior (Matt Damon) is imprisoned within the Great Wall, he discovers the mystery behind one of the greatest wonders of the world. As wave after wave of marauding beasts besiege the massive structure, his quest for fortune turns into a journey toward heroism as he joins a huge army … of elite warriors to confront the unimaginable and seemingly unstoppable force. (Read More)
| Subgenre: | heistfish out of watercreature featureperiod dramaperiod piecedark fantasyalternate historysword and fantasymonster movielive action and animation |
| Themes: | couragemurderdeathfriendshipsurrealismbetrayalprisonfearescapefuneralmonsterdeceptionrobberyparanoiaredemption …greedpanicself sacrificenear death experience (See All) |
| Mood: | poetic justice |
| Locations: | churchdesertrooftopcavechinacampfiretunnelsewer |
| Characters: | warriorteachersoldierthieftough guyaction herointerracial relationshipchinesealien monster |
| Period: | 15th centuryzip line |
| Story: | bow and arrowarcherheroismkingdommedieval timeshonorspearbattlefieldimpalementmassacrecombatswordbattlehorseviolence …explosionknifechasethree word titlesurprise endingfirecorpseblood splattershot in the chestrescueslow motion scenearrestfalling from heightshowdownbombdecapitationgood versus evilorphanbound and gaggedambushaxemountainarmystabbed to deathprisonermapsevered headno opening creditsanti herodisarming someonefictional wardouble crosscontroversycreatureshot in the legcharacter repeating someone else's dialoguedangerattackstatueknocked outopening action sceneexploding bodysuspicionthreatened with a knifemercenarysevered armgeneralqueensubtitled scenetruststylized violenceshavinggrenadedestructionburned alivecagehelmetjail cellcaptivetemplebeardjumping from heightsevered handirishculture clashtorchcannoneaten aliveguardrampageshieldtarget practiceexplosivebraveryinvasioncrossbowdual wieldanimated sequencepartner3 dimensionalchaosevacuationescape attempt3ddark herodynamiteaerial shotdungeoncapturetribesiegestabbed in the eyedark pasttragic heroburned to deathpalacebullet timeimprisonmentrockettorso cut in halfbanditfemale soldiertranslatorblood on camera lensflaghistorical fictionfinal showdowntowergiant monsterfireballstonetwo man armyshot with an arrowarcherywallemperorcommanderdrumfilm starts with textcrash landingoffscreen killingcrashing through a windowmacguffinpotionmale protagonistacrobatfinal battlegurneybritish soldiermeteorhot air balloontragic pastmiddle agesdistrustpsychotronic filmcavalrybanquetarmoryacrobaticsthronealien creaturenomadhorse chasemedallionscrollhands tiedsuit of armorspaniardstudio logo segues into filmkaijumagnetnunchucksharpoongiant creaturecatapultcouncilgunpowdercaught in a netstampedespear throwinggreen bloodspear gunbowlswarmancient chinabackflipgreat wall of chinacannonballstore roomdining roombungee jumpchinese armyaxe throwinghordeman with a ponytailtunic11th centuryburning bodyengine roomsecret military operationstabbed through the mouthhiveopening creditsenvoygreat wallwhite saviorchinese lanternwall of firesleeping potion (See All) |
The continuing quest of Frodo and the Fellowship to destroy the One Ring. Frodo and Sam discover they are being followed by the mysterious Gollum. Aragorn, the Elf archer Legolas and Gimli the Dwarf encounter the besieged Rohan kingdom, whose once great King Theoden has fallen under Saruman's deadly … spell. (Read More)
| Subgenre: | sword and sorcerydark fantasysword and fantasy |
| Themes: | monsterheromagicself sacrifice |
| Mood: | archive footage |
| Locations: | forestcavesea monster |
| Story: | shot with a bow and arrowbow and arrowsword and sandalsword fightarcherarrowkingdomspearbattlefieldcombatswordbattleflashbackbased on novelexplosion …based on bookshot to deathshot in the headaxethroat slittingfictional warduelbased on filmhelmetspin offwitchcraftclubdwarfcrossbowwizardplaystation 2armorsiegenintendo gamecubefighting gamesword duelelfxboxgiant monstersingle playerstandoffadventure herofortressfantasy worldbehind enemy linessuicide bombertrollgoblinbowmulti playerstaffgame boy advancespin off from filmepic battlelast standaxe fightbattle axesteel helmetcatapultaction adventure gameorchobbitmiddle earthaxe throwingtentacleswizardrylord of the ringshack and slash (See All) |
After being captured by Turks during the Crusades, Robin of Locksley and a Moor, Azeem, escape back to England, where Azeem vows to remain until he repays Robin for saving his life. Meanwhile, Robin's father, a nobleman loyal to King Richard the Lionhearted, has been murdered by the brutal Sheriff o …f Nottingham, who helped install Richard's treacherous brother, Prince John, as king while Richard is overseas fighting the Crusades. When Robin returns home, he vows to avenge his father's death and restore Richard to the throne. Even though Maid Marian, his childhood friend, cannot help him, he escapes to the Forest of Sherwood where he joins a band of exiled villagers and becomes their leader. With their help he attempts to cleanse the land of the evil that the Sheriff has spread. (Read More)
| Subgenre: | swashbucklersword and sorcery |
| Themes: | couragemurderfriendshippregnancytortureweddingmagicrobberytheftprison escapemurder of father |
| Mood: | poetic justice |
| Locations: | englandforestvillagecastle |
| Characters: | warriorsingerbabypriestthiefaction herowitchcousin cousin relationshippregnant wifepoaching |
| Story: | shot with a bow and arrowbow and arrowsword and shieldsword and sandalsword fightarcherarrowmedieval timesbattlefieldkingcombatswordhorsefemale nuditymale nudity …male rear nuditydogexplosionknifeshowerfirefistfightshot in the chestface slapshot in the headrescuebare buttfalling from heightlettershowdownhand to hand combatrivershot in the backgood versus evilcleavageambushstabbingstabbed to deathstabbed in the chestdisarming someonedueldangerperson on fireattackpassionstatuekicked in the faceattempted rapedeath of brotherchildbirthloss of fatherarsonprincegoldstabbed in the stomachrebelknighttorchguardcrossbowhit in the crotchrowboatstabbed in the legoutlawknife throwingraidsiegesword dueldaggerstick fighthorseback ridingswordsmanwedding ceremonypeasantrobberbreadshot with an arrowjerusalemarcheryhideoutadventure herofalling into watercrashing through a windowfriends who live togetherbarbarianmiddle ageenglishmanfacial scaroutlaw gangmiddle agesbutt slapwriting a letterman on fireforced marriagemasshalf brotherhorse chasemedallionbattle axecousinflaming arrowenglishwomanfall to deathkrav magawhite horsestained glass windowdevil worshipinterrupted weddinggunpowderstabbed with a swordmelonstabbed in the heartwind chimereturn homecatholic masskilled with a swordagainst the oddsballadeermistletoecrusadesking of englandsitting in a treefacial cutdeath of cousincorrupt priest12th centuryman murders a womanface woundfacial injurykneed in the crotchstabbed with a spearpublic hangingsaved from hangingspitting in someone's faceblack horseblood oathmoorsthrown out a windowfriarkilled with an arrownottingham englandhorseback chasehot candle waxriver battlemass hangingscars on backhiding in a treeantlerhit with a stickholding one's hand over someone's mouthvow of revengewoman slaps a womancut on faceoutdoor weddingdeer antlersplantagenetheld at sword pointswordsmanship1100senglish nobilityinability to swimquarterstaffreference to the prodigal sonvillage set on firepushed through a windowcan't swimcutting the palm of one's handdrum rollface scarsword held to throatunable to swim1190sband of outlawsexploding barrelfather's gravemurder of cousinstolen horsedagger held to throatlife debtscimitarsherwood forestchildbirth complicationking richard ioutlaw hideoutstabbed with a dagger (See All) |
It is the year 1215 and the rebel barons of England have forced their despised King John to put his royal seal to the Magna Carta, a noble, seminal document that upheld the rights of free-men. Yet within months of pledging himself to the great charter, the King reneged on his word and assembled a me …rcenary army on the south coast of England with the intention of bringing the barons and the country back under his tyrannical rule. Barring his way stood the mighty Rochester castle, a place that would become the symbol of the rebel's momentous struggle for justice and freedom. (Read More)
| Subgenre: | swashbucklerindependent filmmartial arts |
| Themes: | suicidetortureseductiontheftbrutalitysadismexecutioncrueltystarvation |
| Mood: | gore |
| Locations: | englandcastlebrothel |
| Characters: | warriorprostitutebullysuicide by hanging |
| Story: | shot with a bow and arrowbow and arrowsword and shieldsword fightarcherarrowkingdommedieval timesspearkingmassacrebattleviolencefemale nudityblood …one word titlebare chested maleblood splatterfistfighthand to hand combatprayerdecapitationaxestabbed to deathmixed martial artsstabbed in the backprologueevil manhangingpigmercenarysevered armdismembermentwoundmutilationmale bondingdysfunctional marriagesevered handclubknightshieldarranged marriageblood on faceunfaithful wifestabbed in the neckhungerstabbed in the headfogarmorsword dueldead woman with eyes openswordsmanfinal showdowncockroachcorporal punishmentshot with an arrowanimal crueltyadventure heroamputationepilogueilliteracyhead cut offstabbed in the shoulderchapelstabbed in the facemiddle agesarm cut offinfantryscoldingimplied sexcavalrysevered footstarvingloveless marriagemacewoman initiating sexstabbed in the mouthstabbed multiple timesbattle axewine drinkingcut armsliced in twohand cut offsteel helmetnobilityrainy nightbaroncatapultwhite horsedead prostituteswordplaybattering ramspear throwingsingle locationstocksman and woman in bedstealing foodpeachevil kingleg cut offsplit in twoarchbishopcavalry chargecrusaderlong swordarm woundpaying for sexknights templargangrene13th centurychain mailmultiple stabbingsdragged by a horsetwo on a horsetemplar knightabbotvow of silencedeath by swordcauterizationneck slashingeating insectholding someone's head underwaterstabbed through the mouthswordsmenknight templarplantagenettrebuchetcauterizing a woundeating an insectquill penunconsummated marriagedunking head in waterportcullisstabbed with swordvow of chastitycg effectscutting out tonguekilling a pigsword held to throatamputated handarrow in the backlifting up a dresspulling up skirthead sliced in twohead split in twoman cut in halfomnipotent narratorstabbed in neck1210saxe in the shoulderhead cut in twoscaling ladderspear in chestthrowing an axe (See All) |
The young, sickly King Einon was wounded in a battle. In order for him to survive, he is healed by Draco, a dragon. Some years later, Bowen, a dragon slayer, encounters Draco. The two team up to form a traveling duo that perform an act, but the act is only known by themselves. Bowen supposedly "slay …s" Draco and then collects a reward from the town or village that he protects by killing the dragon who had been "terrorizing" them. From there, Bowen and Draco must save the entire kingdom from the rule of the now evil King Einon, who is part of Draco and Draco a part of him. (Read More)
| Subgenre: | martial artscult filmsword and sorcerysword and fantasy |
| Themes: | couragemurderfriendshiprevengebetrayalfearescapeherodeceptionangerdeath of fathersupernatural powerpovertyhopeblindness …self sacrificenear death experienceunlikely friendship (See All) |
| Mood: | rain |
| Locations: | englandforestvillagelakecastlecavecampfire |
| Characters: | warriormother son relationshipsoldierpriestchristianitymythical creatureblood lust |
| Story: | shot with a bow and arrowbow and arrowsword fightarcherarrowkingdommedieval timeshonorspearkingimpalementcombatbattlehorseone word title …dogbare chested maleexplosionsingingknifechasefireshot in the chestrescuefalling from heightshowdownliehand to hand combatswimminggood versus evilassassindeath of friendbridgearmystabbed to deathstabbed in the chestanti herodisarming someonepaintrainingattempted murdertreestabbed in the backperson on fireattackdragonfarmerscarpigloss of fathermercenarywaterfallpoetqueenarsonprincechesscivil warspiritflyingheavy raintalking animalquesthelmetslaveryloss of friendcaptiveexploding buildingfraudsheeprebellionknighttorchmonkmoralityfemale warriorreverse footageshieldtarget practicestarcrossbowpartnerresurrectionimmortalitymentorheartdungeonsoulhealingarmorblind maneye patchaxe murdertragic heroshametombswordsmanschemevikingbreadstandoffcomic reliefselfishnessidealismfortresshired killerfencingnarcissismreluctant heroone linertyrantjudofamous scorepart computer animationwatermelonbowmatricideuprisingoff screen murdersecret passagedeterminationproposallong haired maleextinctionaxe fightbattle axeoathjudo throwheart transplantfalconstudent teacher relationshipfire breathing dragonking arthurblamefear of flyingvowfake deathimplied rapestomach ripped openchained to a wallcynicrotting corpselegendary heroevil kingconstellationpushed from heightaxe throwingtrucewooden swordbroken promisedeath of kingflying dragonvalorheld at knifepointpower lustlife forcecode of honorkilling a friendwinged dragondragonslayeringenueprison laborchest woundpeasant armydragon featureheld at sword pointhuman versus dragonmortal woundtalking dragonhorned helmetfencing lessonavalonhuman dragon relationshipreflection in an eyestalemate900sarrow in the shoulderpeasant revolution (See All) |
Britain, A.D. 117. Quintus Dias, the sole survivor of a Pictish raid on a Roman frontier fort, marches north with General Virilus' legendary Ninth Legion, under orders to wipe the Picts from the face of the Earth and destroy their leader, Gorlacon.
| Themes: | murderrevengekidnappingbetrayaltorturedrunkennessescapefuneraldeceptionself sacrificehunting |
| Mood: | gorenightmare |
| Locations: | forestsnowvillagewoodscavecampfire |
| Characters: | warriorfather son relationshiptattoosoldierhostagewitchself mutilation |
| Story: | bow and arrowsword and shieldsword and sandalsword fightarcherarrowhonorspearchild murderkingimpalementmassacrecombatswordbattle …horseviolencebloodone word titledogbare chested malefighttitle spoken by characterknifechasesurprise endingfirevoice over narrationcorpseshot to deathblood splattershot in the chesturinationshot in the headslow motion scenepunched in the facebrawlfalling from heightshowdownhand to hand combatrunningrivershot in the backf worddecapitationsurvivalwineambushstrangulationaxemountainstabbingdeath of friendthroat slittingarmystabbed to deathstabbed in the chestfishnonlinear timelinefalse accusationsevered headanti herochild in perildouble crossfemme fataleshot in the legon the runattempted murderdangerstabbed in the backprologuescreamingattackfugitivepoisontentkicked in the facedeath of childlightningshot in the shoulderscardeath of sonhorse ridingtrapwaterfallgeneralsubtitled scenetraitorwolffireplacekilling an animalwhat happened to epiloguehead buttassassination attempthelmetrome italylifting someone into the aircookstabbed in the stomachhunterhidingnosebleedcampjumping from heightsevered handcovered in bloodtorchanimal attackbar fightbroken legeaten alivefemale warriorfull moonreverse footageshieldface paintteamfight to the deathresistancestabbed in the throatscotlandmanhuntgash in the facestabbed in the neckmuteshot in the facestabbed in the headstabbed in the legexploding headdisembowelmentbooby trapeye gougingdeerarmorclifftribestabbed in the eyebody countaxe murderrescue missionsevered legcharacters killed one by oneburned to deathsuffocationnarrated by characterstabbed in the handset upgreekcremationshot in the neckfemale fighterfireballtombstoneshot with an arrowgovernorstabbed in the armslashingemperorcommandershot in the eyetavernfilm starts with textbehind enemy linesblizzardman kills a womanoffscreen killingmushroombritainhead cut offslingshotstabbed in the shoulderbleeding to deathshot through the mouthsole black character dies clicheshot in the throattreacherybladecamouflagerepeated lineancient romefacial scarstabbed in the facearm wrestlingsole survivorcoughing bloodarmy basevalleygreat britainfortthroat cutscottish accentstarts with narrationstrong mandutch anglescrollstabbed in the mouthbegins with texthuthands tiedbattle axefalling off a cliffaxe in the headroman empiredrinking bloodflaming arrowmessengerrescue attemptstabbed in the sidemale camaraderiemass killingromanguerilla warfarebodily dismembermentpunched in the crotchdefectorfuneral pyreromatrackerscoutwood carvingsurprise attackscreaming in painshot in the kneestabbed in the crotchman huntoutpostdeath by impalemententrailsriver rapidstrackinglegionwar woundstabbed through the cheststomach ripped openroman soldierwar paintarrow in chestcarvinghead held underwaterleg cut offguerrilla warfarevengencewarrior raceashaxe in the chesthead on a stakepoisoned drinkaxe throwinghead split in halftunicbound in chainsstabbed with a speartooth knocked outyorkface paintingbegins with historical notescenturionmute womanflipping a coinroman legioncliff divingjumping into a riverrunning into a treewoman warriorstabbed through the mouthanimal carcassprimal screamgolden eagle2nd centuryjumping off clifftauntroman armyhiding under floorboardsstabbed through the backtreating a woundcatching fish by handchild with a knifearmy on the marchhadrian's wallimpaled on a spearthrowing an axe (See All) |
In an ancient time, predating the pyramids, the evil king Memnon is using the psychic powers of his sorceress Cassandra to fortell his great victories. In a last ditch effort to stop Memnon from taking over the world, the leaders of the remaining free tribes hire the assassin Mathayus to kill the so …rceress. But Mathayus ends up getting much more than he bargained for. Now with the help of the trickster Arpid, tribal leader Balthazar and an unexpected ally, it's up to Mathayus to fufill his destiny and become the great Scorpion King. (Read More)
| Subgenre: | martial artssword and sorcery |
| Themes: | betrayalheromagicwrestling |
| Locations: | desertcitycave |
| Characters: | warriorboythieftough guyaction herohorse thief |
| Story: | shot with a bow and arrowsword and sandalsword fightarrowspearbattlefieldkingimpalementcombatswordbattlecharacter name in titleviolencefightexplosion …knifethree word titlefirefistfightrescuebrawlfalling from heightshowdownhand to hand combatanimal in titlefightingassassinambushstrangulationaxethroat slittingmixed martial artssnakesevered headno opening creditsdream sequencedisarming someoneone man armyfictional warduelpoisonopening action scenewaterfallcross dressingdestinyspin offskullvisiontelescopeexplosivesandresistancedual wieldinventorhit in the crotchknife throwingraidsiegedead boyrescue missionsword dueldaggerprequelpalacecamelswordsmanspit in the facemusclemanstrongmanparkourarcherystabbed in the armcrystalscorpionpatricideanttyranttitle in titlebowharemarm wrestlingsorceressurnancient egyptvalleyclairvoyantcobraflaming arrowsandstormcatapultfalcongunpowderclairvoyanceswordplayantiquityfire antgrappling hookrubygongsinkholeoasisprecognitionseerflaming swordsoothsayerwrestler as actorarrow in backreference to sodompoisoned arrowarrow catchingarrow in the backgomorrahgomorrahitenear death survivorprequel to sequelacadianarrow in one's backwall of firelima syndrome (See All) |
Set in 79 A.D., POMPEII tells the epic story of Milo (Kit Harington), a slave turned invincible gladiator who finds himself in a race against time to save his true love Cassia (Emily Browning), the beautiful daughter of a wealthy merchant who has been unwillingly betrothed to a corrupt Roman Senator …. As Mount Vesuvius erupts in a torrent of blazing lava, Milo must fight his way out of the arena in order to save his beloved as the once magnificent Pompeii crumbles around him. (Read More)
| Subgenre: | epicmartial artsmelodramadisaster filmdisaster movie |
| Themes: | murderdeathrevengekidnappingpoliticsprisontorturedeceptiondeath of fatherdeath of motherblackmailunrequited lovemurder of family |
| Locations: | forestlondon englandvillagewoodsship |
| Characters: | warriorhusband wife relationshipfather daughter relationshipmother daughter relationshipsoldierhostagesister sister relationshiptough guyaction heromayor |
| Story: | bow and arrowsword and sandalsword fightspearbattlefieldprincessimpalementmassacrecombatswordbattlehorseflashbackviolenceblood …one word titledogbare chested malekissfighttitle spoken by characterexplosionknifechasefirebeatingfistfightrescueslow motion scenepunched in the facebrawlfalling from heightshowdownhand to hand combatdecapitationorphanwinestrangulationaxemountainthroat slittingarmystabbed to deathmixed martial artsprisonerstabbed in the chestsevered headanti heroone man armychild in perilunderwater scenetrainingattempted murderone against manystabbed in the backperson on firerace against timestatuekicked in the facelightningexploding bodyneck breakingloss of fatherthreatened with a knifesevered armloss of motherwhippingbare chested male bondageriotdisasterfalling down stairsdestructionburned aliveheavy rainscene during opening creditshelmetslaveryexploding buildingkicked in the stomachforbidden lovefestivaltorchinterracial friendshipcrushed to deathsocial commentaryearthquakeslaveguardshieldfloodblood on facedual wieldstabbed in the throatwhip3 dimensionaltitle appears in writingescape attemptsenatorstabbed in the legpunched in the chestvolcanodeath of sisterdungeontribeknife throwingpassionate kisschainburned to deathbeheadingburied aliveshipwreckvillastabbed in the armemperorlavafilm starts with textarenastablebritainnatural disasterancient romegladiatorrighteous ragecorrupt officialdeath of familyexploding shiptsunamianimal killingwaveloinclothbitecarriagehorse chasemacehorse drawn carriageno survivorsroman empirebuilding collapseromancell matevolcanic eruptionbare knuckle fightingmusculartidal wavespear throwing1st centurychariotcoastal towncelticcolosseumdoomed romancefinger bitten offsinkholehead held underwaterashgiant wavetunicwooden swordamphitheaterbeheadedtogashivslave auctionvolcano eruptionmale bondageforbidden romancepompeiimount vesuviusgolden eaglepyroclastic flowblood on backmuscular physiquemap on screentown in titlewhirlwind romance (See All) |
A veteran samurai, who has fallen on hard times, answers a village's request for protection from bandits. He gathers 6 other samurai to help him, and they teach the townspeople how to defend themselves, and they supply the samurai with three small meals a day. The film culminates in a giant battle w …hen 40 bandits attack the village. (Read More)
| Subgenre: | epicmartial artscult filmcult classic |
| Themes: | couragedeathlovefriendshiprevengesuicidefeardrunkennessherodeceptionangergriefhopedeath of wifepanic …falling in lovesamuraistarvation (See All) |
| Mood: | rain |
| Locations: | forestvillagejapanfarmcampfiretown |
| Characters: | warriorhusband wife relationshipfather daughter relationshipchildrenhostagethieftough guyaction heroold friendcrying babysamurai swordsamurai warrior |
| Period: | 16th century |
| Story: | shot with a bow and arrowbow and arrowsword fighthonorspearbattlefieldcombatswordbattlehorsenumber in titleviolencemale rear nuditybare chested malegun …kisssingingchasefireshot to deathslow motion scenesecretshowdownriflehand to hand combatriverorphanold manprisonermapdisarming someonefishingchild in perilold womantrainingduelfarmerhorse ridingpremarital sextied upmercenarywaterfallflowerlove interestclass differencesarsonhappinessmale bondingcrying womanforbidden lovefollowing someonecrying manburialmoralitycelebrationsufferingkatana swordmisunderstandinghungerdespairensemble castyoung lovearmorsiegeblind mantragic herostick fightmoral dilemmacrowdmudtombbanditswordsmanpeasantkatanakendostrategyassumed identitystandofffencingoffscreen killingilliteracyhumormusketvictorybo staffhouse on firevillagerhillman with no namehostage situationstraight razorharvestlootingflintlock rifleweepingchopping woodricekneelingmoral ambiguitybarricadebarefoot womansicklejidai gekilong black hairstabbed with a swordmillwashing hairelderly womanpracticemockeryoutburstrecruitingshot with a guncaptive womanhead shavinggenealogyelderly manmaster apprentice relationshiproninsabresakecherry blossomnumber 7 in titlefalling off a horsecult favoritestabbed with a spearweeping womandragged by a horseweeping manfalse alarmrice paddywater millsheathplaying flute1570sadmirationrain fightbarleyhot headedcatching fish by handvillage elderdejectionfather hits daughterhorse drawn plow (See All) |
In the Battle of Thermopylae of 480 BC an alliance of Greek city-states fought the invading Persian army in the mountain pass of Thermopylae. Vastly outnumbered, the Greeks held back the enemy in one of the most famous last stands of history. Persian King Xerxes led a Army of well over 100,000 (Pers …ian king Xerxes before war has about 170,000 army) men to Greece and was confronted by 300 Spartans, 700 Thespians, and 400 Thebans. Xerxes waited for 10 days for King Leonidas to surrender or withdraw but left with no options he pushed forward. After 3 days of battle all the Greeks were killed. The Spartan defeat was not the one expected, as a local shepherd, named Ephialtes, defected to the Persians and informed Xerxes that the separate path through Thermopylae, which the Persians could use to outflank the Greeks, was not as heavily guarded as they thought. (Read More)
| Subgenre: | epiccult filmsword and sorcery |
| Themes: | deathmarriagerapebetrayalpoliticsmonstermadness |
| Mood: | gorenight |
| Locations: | beachstormcanyon |
| Characters: | warriorfather son relationshipsoldier |
| Story: | sword and shieldsword and sandalsword fightarcherarrowhonorspearkingimpalementmassacreswordbattlenumber in titleviolencefemale nudity …bloodmale nudityfemale frontal nuditymale rear nuditybare chested malesex scenetitle spoken by characterlesbian kissvoice over narrationwoman on topcorpsedigit in titleblood splatterface slapslow motion scenesex in bedbare buttfalling from heightmaskhand to hand combatdead bodydecapitationcleavagewomanarmystabbed in the chestsevered headno opening creditschild in perildrowningbeaten to deathstabbed in the backprologuespeechthreatsevered armqueeneuropedismembermentstrong female charactermachismogoldwolfgrenadeloyaltynipples visible through clothinghelmetsurvivorslaverytold in flashbackelephantstabbed in the stomachblockbustergiantanimal attackshieldrear entry sexloss of songash in the facegreecestabbed in the headdisembowelmentcliffraidsiegestabbed in the eyeinsulteye patchloss of husbandsevered legpatriotismbullet timeunderdogbriberyhistorical fictionfightergreekspit in the facetreasonfreakarcherystabbed in the armbased on graphic novelambassadordisappointmentkickstabbed in the shoulderharemarm cut offdeformityviolent deathfamous linebeefcakepithunchbackinfanticideslow motion action scenestabbed in the mouthancient greecebattle axefalling off a cliffrhinocerosogrepersianstudio logo segues into filmgay subtextrite of passageoracleantiquityshorevirtual setunreliable narratordark horse comicseviscerationclosing credits sequencesevered limbhyperrealismpeplumarab stereotypemongolianspartanspear through chestspeared to deathtrampled to deathlove slavepersonality cultvolley of arrows5th century b.c.son killedpersian empireelite soldierlobster mancrypto fascismgod kingrain of arrowsunable to sleep (See All) |
In Ancient Greece 1200 B.C., a queen succumbs to the lust of Zeus to bear a son promised to overthrow the tyrannical rule of the king and restore peace to a land in hardship. But this prince, Hercules, knows nothing of his real identity or his destiny. He desires only one thing: the love of Hebe, Pr …incess of Crete, who has been promised to his own brother. When Hercules learns of his greater purpose, he must choose: to flee with his true love or to fulfill his destiny and become the true hero of his time. The story behind one of the greatest myths is revealed in this action-packed epic - a tale of love, sacrifice and the strength of the human spirit. (Read More)
| Subgenre: | epicmartial artsconspiracychrist allegory |
| Themes: | murderdeathrevengesuicidebetrayaltortureescapedeceptionsupernatural powerdeath of motherunrequited lovehopemythologygreek mythology |
| Locations: | forestdesertvillagewoodsshipcastlecavecampfire |
| Characters: | warriorhusband wife relationshipfather son relationshipmother son relationshipbrother brother relationshipteachersoldierhostagetough guyaction hero |
| Story: | bow and arrowsword and sandalsword fightarcherspearbattlefieldprincesskingimpalementcombatswordbattlehorsecharacter name in titleviolence …bloodbare chested malefightexplosionknifechasesurprise endingfirebeatingshot to deathfistfightshot in the chestshot in the headslow motion scenepunched in the facewritten by directorbrawlfalling from heightshowdownhand to hand combatshot in the backdecapitationgood versus evilambushaxedeath of friendthroat slittingarmystabbed to deathmixed martial artsstabbed in the chestsevered headno opening creditsone man armyshot in the legskinny dippingattempted murderone against manycharacter repeating someone else's dialoguebeaten to deathstabbed in the backelectrocutionstatuekicked in the facelightningopening action sceneshot in the shoulderhorse ridingneck breakingthreatened with a knifemercenarywaterfallshot in the armwhippingbare chested male bondagequeenprincestylized violencecaptainheavy rainhelmetslaverykicked in the stomachjumping from heightrebellionforbidden loveanimal attackslavefull moonshieldcrossbowfight to the deathdual wieldstabbed in the throatwhip3 dimensionalegyptstabbed in the legpunched in the chestliondungeonrainstormknife throwingsword duelpalacesuper strengthstabbed in the armcommandercheering crowdarenagoddessstabbed in the shoulderbettinggladiatorwarlordforced marriageshot in the crotchanimal killingrock climbinghusband murders wifeman hits a womanbeefcakeancient greecestabbed in the footorigin of heroflaming arrowtyrannybare knuckle fightingspear throwingdeus ex machinahanged by the neckconquestherculeschariotvirtual setdemi godtunicamphitheaterbound in chainsreference to zeusflaming swordbranding ironcliff divingafrican lionfemale gladiatorgolden eagleblood sportarmy on the march (See All) |
Robin of Locksley, known as the most skilled archer of the land, has just returned to England after fighting in the Holy Crusades, where King Richard the Lionhearted is also fighting. Robin finds that much of what he knew of England has gone to ruin, including his longtime family home having been ta …ken away, all at the hands of the evil Prince John, Richard's brother who has assumed the throne in Richard's absence. Neurotic John is basically being controlled by the equally evil Sheriff of Rottingham, everything they doing to fatten their own coffers at the expense of the commoners and peasants. As such, Robin recruits a band of merry men to help him battle Prince John and the Sheriff, they who include: Blinkin, his blind longtime servant; Ahchoo, the misguided son of Asneeze, the man who helped him escape from prison while fighting in the Crusades; Little John, who seems to think that being called Little is only coincidental to the fact of he being a hulking man; and Little John's friend, Will Scarlet O'Hara, a master with daggers. In going to the palace, Robin falls in love at first sight with Marian of Bagelle, a maid of the court. Marian is looking for the man who has the figurative and literal key to unlock her heart (and more private parts). The Sheriff has his own eyes on Marian, he who in turn is the object of desire of Latrine, a powerful hag of a sorceress of the court. Robin and the Sheriff in particular have a fight to the death mentality to achieve their end goals… (Read More)
| Subgenre: | swashbucklercult filmslapstick comedy |
| Themes: | weddinggangsterheroblindnessescape from prison |
| Mood: | spoofparodybreaking the fourth wall |
| Locations: | englandforestcastlesinging in a bathtub |
| Characters: | warriorafrican americansingerthieftough guyaction herohitmansniperwitchsheriffself referentialthief hero |
| Story: | shot with a bow and arrowbow and arrowsword fightlancearcherarrowmedieval timesspearbattlefieldwritten and directed by cast memberkingcombatswordbattlehorse …character name in titlefighttitle spoken by characterpartysurprise endingfirefistfightface slappunched in the facebrawlfalling from heightshowdownhand to hand combatfightingcleavageambushwomanbridgestabbed in the chestdisarming someonetalking to the cameratrainingcharacter repeating someone else's dialoguevirginkaratecharacter's point of view camera shotopening action scenescene during end creditscontestcharacter says i love youobscene finger gesturecult directorcross dressingsubtitled sceneredheadarsonprincescene during opening creditsservantknightguardabsurd humorremote controlplayboy magazinecrossbowdual wieldhit in the crotchlove at first sighttitle appears in writingpsychotronicdungeonknife fightsexy womanknife throwingraised middle fingerblind mansword dueldaggerstick fightwoman in bathtubsidekickswordsmandirector cameosneakerstowerblack manlizardshot with an arrowjerusalemarcheryadventure herorabbicameo appearancenoosefriends who live togetherbriton abroaddeath of familymimereference to abraham lincolnmoleanachronismhouse on firefairguillotineman in dragman dressed as womansevered earflaming arrowsong and dancecomic herocomic violencecatapultfake beardblowing a kisstrailer narrated by percy rodriguezspeech impedimenttaxestightsreference to mark twainchastity beltballadeerupside down camera shotlong sword12th centuryhangmanmovie reality crossoverjewish stereotypesaved from hangingsinger offscreenminstrelfriarmusical sequence in non musical workmale slaps a malerunning into a treecardboard cut outreference to larry kingmedium breastsquarterstaffportcullis1190s (See All) |
| Subgenre: | martial artscoming of ageblack comedysupernaturalsword and sorcerydark fantasysword and fantasychrist allegoryrevisionist history |
| Themes: | couragemurderdeathfriendshiprevengesurrealismkidnappingmoneybetrayaljealousyprisonfearescapefuneralmonster …deceptionmagicrobberyangerdeath of fatherbrutalitysupernatural powerdeath of motherparanoiaredemptionexecutionhopedeath of wifepanicself sacrificemythology (See All) |
| Mood: | rainnightmaredarkness |
| Locations: | englandforestboatlondon englandwatervillagewoodslakeshipcastlecavebrothelsewer |
| Characters: | warriorhusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshiptattoobrother brother relationshipbrother sister relationshipprostitutesoldierhostagethieftough guyaction herolittle boy …maidwitchuncle nephew relationshipmermaidself doubt (See All) |
| Story: | bow and arrowarchercrownkingdommedieval timesspearbattlefieldkingimpalementmassacrecombatswordbattlehorsecharacter name in title …violenceflashbackblooddogbare chested malefighttitle spoken by characterexplosionknifechasesurprise endingfirebased on bookbeatingcorpseshot to deathblood splatterfistfightshot in the chestshot in the headrescueslow motion scenepunched in the facewritten by directorbrawlfalling from heightshowdownhand to hand combatinterrogationdemonprostitutionbritishislandriverfightingshot in the backsubjective cameradecapitationgood versus evilspyfoot chaseorphancandlegangambushstrangulationaxedisguisemontagethroat slittingbridgearmystabbed to deathmixed martial artsprisonerstabbed in the chestmapsnakenonlinear timelinesevered headanti herodisarming someoneone man armychild in perilfictional warritualunderwater scenecreaturefemme fataleshot in the legtransformationon the runtrainingone against manylegendcharacter repeating someone else's dialoguebeaten to deathdangerstabbed in the backscreamingattackfugitivepoisoncharacter's point of view camera shotevil manknocked outopening action sceneshot in the shouldermanipulationscarexploding bodyloss of fatherratthreatened with a knifewaterfallsevered armloss of motherprofanityshot in the armgeneralqueenarsonpowerfreeze framestylized violencehenchmanriottraitorfalling down stairscaptainsabotagewolfdestructionburned alivehead buttassassination attemptfaintingscene during opening creditshelmetslaveryroyaltyelephantjail cellmagicianbeardsergeantkicked in the stomachloss of wifenosebleedblockbustergiantpoolrebeljumping from heightrebellionknightmind controlcgifollowing someonetorchanimal attackinterracial friendshipcrushed to deathscammasked manslaveeaten aliveguarddwarfreverse footageshieldcameohaunted by the pastnicknamevisiontarget practiceexplosivebraveryblood on faceresistancedual wieldhatredimpostormercilessnesschaosshot in the facedeath threatprophecyrowboatstabbed in the headmentorstabbed in the legpunched in the chestcon artistdark herooutlawaerial shotdungeonwisecrack humordisfigurementknife throwingraiddark pastdemonic possessiontragic heroblack magicburned to deathcoinpatriotismfast motion scenepalacebullet timebatdoppelgangeroppressionswordsmandirector cameoface maskhistorical fictionfighterfinal showdownfolklorebag over headmusclemanstrongmanscene before opening creditssuper strengthtowerfireballhuman sacrificevikingshot with an arrowyoung version of characterarcheryidealismfemale spycommanderfortresshanging upside downsorcerertavernbellfilm starts with textreluctant heroman kills a womantyrantaltered version of studio logofight the systemheirburnt bodyshot in the throatpart computer animationrighteous ragetragic pastmiddle agessubterraneanjailbreaksorceresscoup d'etatcockney accentbo staffflashback within a flashbackresistance fighteralternate dimensionscytheanimal killingchosen onekicking in a doorassassination plotgiant animalglowing eyeshawkthronefratricideburning buildingtotalitarianismslow motion action scenechild swearingjumping from a rooftophands tiedsevered earsuper speedorigin of heroflaming arrowbaronstabbed in the sidetyrannybrandysnorricamsquidcollapsing buildingwarlockdefectorfuneral pyrecoronationcatapultturned to stonebare knuckle fightinggunpowdergiant snakeking arthurbattering ramslave laborspear throwingmartial arts schoolpublic executionevil sorcerervenompyrokinesisstabbed through the chestcamelotcovered in mudevil kingexcaliburwrecking ballarthurian legendmagehanged bodygiant squidashman with a ponytailtunicround tableflaming swordburning villagegiant ratsnake venomchild slaverylancelotcollapsing bridgeknights of the round tablegiant batgrafittiheir to thronemartial arts instructormagic sword (See All) |
When a magic scepter accidentally transports April back through time to 17th Century Japan, the boys take-off in hot pursuit, cowabungling their way out of the sewers right into Samurai-O-Rama! Now they must battle the evil Lord Norinaga to reclaim the magic scepter that will bring them back below t …he subways of New York City. (Read More)
| Subgenre: | independent filmmartial artscult filmsuperhero |
| Themes: | surrealismheromagictime travelsamurai |
| Mood: | poetic justice |
| Locations: | japansewer |
| Characters: | warriorteenagertough guyaction herosamurai sword |
| Period: | 1900s1600s |
| Story: | shot with a bow and arrowbow and arrowsword fightunsubtitled foreign languageroman numeral in titlespearbattlefieldcombatbattlehorseviolencesequelfightexplosionchase …firefistfightbrawlhand to hand combatfightingkung fubased on comic bookambushdisarming someonefictional warvoice overthird partfive word titleninjatough girlopening action scenemartial artistmercenaryvigilantearsonpizzamartial arts masterelectronic music scoreheroineslow motiontalking animallifting someone into the airpart of trilogyaction heroinechop sockycannonkatana sworddual wieldanthropomorphic animalturtlearmorsword duelsequel to cult favoritestick fightkung fu fightingkung fu classicfemale fighterninjitsuvigilante justicemusketroman numbered sequelwarlordbo staffcavalryliquidanimal that acts humanflintlock riflehorse chaseflintlock pistolnunchuckslifting male in airreference to clint eastwoodfurryhockey stickteenage mutant ninja turtlesfeudal japanmusketeersaininja turtlemirage comicslampshade (See All) |
The myth of King Arthur brought once again to the screen. Uthur Pendragon is given the mystical sword Excalibur by the wizard Merlin. At his death Uthur buries the sword into a stone, and the next man that can pull it out will be King of England. Years later Arthur, Uthur's bastard son draws Excalib …ur and becomes king. Guided by Merlin, Arthur marries Guenivere and gathers the Knights of the Round Table. Arthur's evil half-sister Morgana sires a son with him, who may prove his downfall. (Read More)
| Subgenre: | sword and sorcery |
| Themes: | deathfriendshipsurrealismmarriageinfidelityadulteryfearescapedeceptionmagicincestangerbrutalitysupernatural powerdying …falling in love (See All) |
| Mood: | affection |
| Locations: | forestwaterwoodslakecastlecave |
| Characters: | husband wife relationshipfriendlustwitchevil witchself injury |
| Story: | sword and shieldsword fightbritish renaissancemedieval timesspearkingimpalementmassacrecombatswordbattlehorseviolencefemale nuditynudity …bloodmale nudityone word titlefemale frontal nuditymale rear nuditysex scenekissfemale rear nudityfighttitle spoken by characterfirebased on bookbeatingcorpseblondebrawlhand to hand combatmale pubic hairold manaxedisguisestabbingstabbed to deathstabbed in the chestsnakebrunettefictional wartransformationpublic nuditytreelegendmissiondragonpassionrabbithangingtragic eventdeath of husbandhorse ridingqueenquesthelmetmagiciancovered in bloodknightforbidden lovewizardfogdead maneye gougingarmorsiegeattractionowlcrowspellhistorical fictionassumed identitydying manpatricidebleedinghanged manflamebloodshedmatricidemiddle ageswhite dressrise and fallhalf brotherdying wordsweepinghalf sistermagical swordevil powerking arthurholy graildeath by impalementdeath of main characterkilled with a swordcamelotexcaliburarthurian legendattempted escapebloodstainmace the weaponround tablefighting with selfjoustknights of the round tablerape by deception6th centurysword in stone5th century (See All) |
Set, the merciless god of darkness, has taken over the throne of Egypt and plunged the once peaceful and prosperous empire into chaos and conflict. Few dare to rebel against him. A young thief, whose love was taken captive by the god, seeks to dethrone and defeat Set with the aid of the powerful god … Horus. (Read More)
| Subgenre: | epictragedymartial artsblack comedyaustralian fantasyaustralian science fictionaustralian horrorsword and fantasychrist allegoryscience fantasy |
| Themes: | couragemurderdeathloverevengesurrealismkidnappingbetrayalfearescapemonsterdeceptionseductiondeath of fatherbrutality …supernatural powerredemptionfaithhopeapocalypseblindnessself sacrificemythologynear death experienceafterlifeunlikely heroegyptian mythology (See All) |
| Mood: | darknesspoetic justiceaustralian supernatural |
| Locations: | desertelevatorshipouter spacecavejungleaustralian space travel |
| Characters: | warriorhusband wife relationshipfather son relationshipmother son relationshipboyfriend girlfriend relationshipbrother brother relationshipsoldierhostagethieftough guyaction heroex husband ex wife relationshipdeath of girlfriend |
| Story: | bow and arrowsword and sandalsword fightcrownkingdomspearbattlefieldkingimpalementmassacrecombatswordbattlehorseflashback …violencebloodbare chested malekissfightexplosionknifechasesurprise endingfirevoice over narrationbeatingcorpsefistfightshot in the chestrescueslow motion scenepunched in the facebrawlfalling from heightshowdownhand to hand combatbeddemonorgydecapitationgood versus evilsurvivalbedroomassassinambushold manaxemountainbridgearmystabbed to deathmixed martial artsstabbed in the chestsnakesevered headno opening creditsanti heroone man armyfictional wardouble crossunderwater scenecreaturenecklacetransformationone against manylibrarycharacter repeating someone else's dialoguedangerstabbed in the backprologueattackmissiondragonrace against timestatueevil manlightningopening action sceneskeletonbraceletdeath of husbandtraploss of fatherthreatened with a knifewaterfallsevered armlove interestclass differencesqueenstylized violencehenchmancivil wareavesdroppinggolddestinysabotagedestructionburned aliveflyingassassination attemptbreaking and enteringquesthelmetslaveryelephantloss of loved onetempletreasureexploding buildingkicked in the stomacharchitectgiantservantmind controlwomanizertorchend of the worldfateanimal attackfemale killercrushed to deathback from the deadslaveguardreverse footageshieldhaunted by the pastburglarvisiontelescopebraveryburglarystabbed in the throatmercilessnessegyptchaosstabbed in the neckresurrectionimmortalityswampexilestabbed in the legsibling rivalrypunched in the chestdark herosunbooby trapheartaerial shotknife fightwisecrack humoryoung loveeye gougingdark pasteye patchloss of husbandtragic herosevered legburned to deathdictatorloss of brotherdaggerstick fightbrainteleportationgeniuspalacetelepathytorso cut in halffemale assassintombnarrated by characterprayingdirector cameoface maskfinal showdowneyesuper strengthgiant monstersex slaveparkourportaltwo man armyworld dominationshot with an arrowmegalomaniaccheering crowdcrash landingscorpionpyramidreluctant heropatricideman kills a womanseductresshumorfinal battlecapeheirsole black character dies clichedecadencerighteous ragetragic pastvaultwarlordarm cut offriddlecoup d'etatphilosopherancient egyptanimal killingrock climbinghusband murders wifeimmolationglowing eyesthronefratricidewingsstarts with narrationbeetleslow motion action scenehorse drawn carriagescrollgold coindouble entendrefall to deathone eyed manegyptianloss of girlfriendcollapsing buildingtrackercoronationsandstormgiant creaturefire breathing dragongiant snakehenchwomanoutrunning explosionout of body experiencesphinxchariotstabbed through the chestfighting in the airmegalomaniaaustralian creaturestunicblindedfloating in spaceslave girlflaming swordfalling into a poolsedan chairduplicateobeliskwoman changing clothesegyptian godhieroglypheyes gouged outaustralian monstersheir to throneofferingback hand slapland of the deadwalking across desertpile of goldegyptian goddessriver nile (See All) |
Diana, princess of the Amazons, trained to be an unconquerable warrior. Raised on a sheltered island paradise, when a pilot crashes on their shores and tells of a massive conflict raging in the outside world, Diana leaves her home, convinced she can stop the threat. Fighting alongside man in a war t …o end all wars, Diana will discover her full powers and her true destiny. (Read More)
| Subgenre: | epicmartial artscoming of agesuperherofish out of watersteampunkdark fantasysword and fantasy |
| Themes: | couragemurderdeathloverevengesurrealismbetrayaldrinkingfeartorturedrunkennessescapedeceptionmilitaryanger …corruptionpsychopathbrutalityobsessionsupernatural powerparanoiainsanitysadismhopepanicjusticeself sacrificemythologygreek mythology (See All) |
| Mood: | darknessgreek myth |
| Locations: | beachtrainchurchforestsnowmotorcycleairplaneparis franceboatlondon englandvillagewoodsshipcastlecave …campfirelaboratorytrain stationairplane chase (See All) |
| Characters: | warriorfamily relationshipsmother daughter relationshipsingerfemale protagonistsoldierdancerphotographersister sister relationshiptough guyaction heronative americansingle motheralcoholicsniper …secretarygermanamerican abroadsniper rifleaunt niece relationshipfemale scientistamerican in the uk (See All) |
| Period: | 2010s1910syear 1918 |
| Story: | bow and arrowsword fightarchercrownheroismkingdomhonorspearbattlefieldprincessmassacrecombatswordbattlehorse …character name in titleviolenceflashbackf ratednuditymale nuditysequeltwo word titlebare chested malefightcigarette smokingdancingphotographexplosionsingingpartyknifechasesurprise endingpistolfirevoice over narrationshootouttitle directed by femalebeatingcorpseshot to deathfistfightmachine gunshot in the chestshot in the headshotgunrescueslow motion scenepunched in the facedrinkgunfightbrawlsecretfalling from heightpaintingbased on comicshowdownrifleheld at gunpointbeerhand to hand combatbombinterrogationpianoislandrevolverfightingscientistshot in the backgood versus evilspybased on comic bookaxedisguisemontagearmystabbed to deathmixed martial artspoliticianstabbed in the chestmapnonlinear timelinefalse accusationno opening creditsanti heroscantily clad femaledisarming someonepart of seriesdouble crossunderwater scenevanshot in the legtrainingflash forwardattempted murderone against manypilotbinocularscharacter repeating someone else's dialoguebeaten to deathdangercostumescreamingelectrocutionfantasy sequencefactorypay phonepoisonmissionundercoverrace against timestatueevil manknocked outkicked in the facetough girllightningtankbraceletscardeath of brotherexploding bodylaptopsuspicionworld war onethreatened with a knifewaterfallshot in the armgeneralsecret agentlove interestpubqueennewspaper headlinesubtitled scenestylized violenceeavesdroppingropedestinycaptainhand grenadesabotagefireplacedestructionbulletrevelationassassination attemptwarehousesociopathhelmettold in flashbackmad scientistexploding buildingkicked in the stomachcaucasianvillainessblockbusterwristwatchphone boothpooldesperationjumping from heightculture clashstrong female leadfollowing someonefateaction heroinebar fightcannonfemale warriorgas maskshieldbraveryinvasioncynicismfight to the deathdual wieldanimated sequencehatredimpostormercilessnesschaossuper villainpost traumatic stress disorderimmortalitymentorpunched in the chestdynamitejumping through a windowdeath of sisteraerial shotsuperheroinee mailtitle at the endundercover agentarmordisfigurementgasolinefemale directorsecret identitydc comicsloss of brothertelekinesissmokegatling gunprequelteleportationpipe smokingbullet timeclose up of eyesfemale soldiertranslatormale objectificationface maskhistorical fictionlevitationalleyanti warfinal showdownnotebookfemale fighterassumed identityeiffel tower parissuper strengthfake identitytoweramerican indianworld dominationcomic reliefsailboatshot with an arrowmegalomaniacyoung version of characterarcheryidealismamazonno title at beginningsmugglerdepartment storebelgiumcrash landingexploding truckbehind enemy linesgirl powerfemale herobayonetsaving the worldwoman kills a manhumorsuper powerfinal battlegurneyhijackingloss of sisterevil womanflamebomberopen endedsuperhuman strengthwoman fights a manvaultimmortaldistrustgodhuman experimenttalking about sexanecdoteone woman armyflashback within a flashbackottoman empirearmy basebiplanechosen oneexploding airplanehalf brotherforce fieldfake accentbilingualismmad doctorfratricidetrenchrevolving doorearth viewed from spaceoverhead shotepic battlescottish accentparadisehorse drawn carriagesexual innuendopayphonesuit of armorwoman kills mandouble entendrescotsmanwoman punches a mansuper speedgerman armyinvulnerabilityorigin of heroflaming arrowbig ben londonman fights a womansharpshooterwalking stickevil scientistgalachemistdisobeying ordersgas grenadepoison gasstudent teacher relationshipgunpowdersultanbritish intelligencemass deathspear throwingthrown from heightturkwatchtowerantique dealermatriarchybell towergreek godbackfliptrench warfareevil godwartimealley fightbowler hatdeath of auntflameswarrior womancostumed heroescalationamazon tribeend of waralliteration in titlemoroccanwarrior racechemical weaponsfeztower bridge londonmachine gun nestaxe throwingdc extended universesuperhuman speedcasualty of warchemical weapontough womanprequel and sequelwestern frontwonder womanarmisticereference to zeuslightning boltamazon warriorhydrogenintelligence officeramazon womanfemale superheromilitary jeepdeath of mentorfemale archergas attackarescyanide pillmustard gasfemale talking about sexgerman spyamazon queenloss of auntmagic swordreturning actress with different character (See All) |
While hunting in the forest, Lord Asano of Ako and his samurai find a young half-breed and take him with them to live in the castle. Several years later, Lord Asano holds a tournament to welcome the Shogun to Ako. The night after the tournament, Lord Asano is bewitched into hurting Lord Kira of Naga …to, and is punished into committing seppuku by the Shogun. Realizing that it was a Lord Kira's evil plot, the samurais and the half-breed sets out for revenge against the Shogun's order. (Read More)
| Subgenre: | epictragedyconspiracysword and sorcerydark fantasysword and fantasy |
| Themes: | murderdeathrevengesurrealismsuicidekidnappingghostescapeweddingmonsterdeceptionmagicdeath of fathersupernatural powerredemption …unrequited lovesamurairitual suicide (See All) |
| Locations: | forestsnowcemeteryvillagewoodsjapanlakeshipcastlecampfire |
| Characters: | warriorhusband wife relationshipfather son relationshipfather daughter relationshipsoldierhostagetough guyaction heroteacher student relationshipwitchself mutilationsamurai swordhuman versus monstersamurai warriorhunting party |
| Story: | bow and arrowsword fightarcherhonorspearbattlefielddirectorial debutimpalementmassacrecombatswordbattlehorsenumber in titleflashback …violencebloodbare chested maletitle spoken by characterexplosionknifechasesurprise endingbased on true storyfirebeatingcorpsedigit in titleshot to deathblood splattershot in the chestshot in the headrescueshowdowndemonshot in the backdecapitationfoot chaseorphancandleambushaxemountaindisguisethroat slittingarmystabbed to deathstabbed in the chestmapfalse accusationsevered headno opening creditsritualcreatureshot in the legnecklacelegendstabbed in the backprologueperson on fireattackpoisondragonmanipulationexploding bodyneck breakingtraploss of fathershot in the armbare chested male bondagestylized violenceburned aliveheavy raintempleexploding buildingwitchcraftspidervillainessgiantforbidden lovecgitournamentburialslavepresumed deadguardarranged marriagecrossbowfight to the deathstabbed in the throat3 dimensionalshot in the facestabbed in the headmentorexiledark heromeditationsnowingsword dueltragic heroburned to deathimprisonmenthorseback ridingbeheadingillusionhistorical fictionstabbed in the handoutcastmysticismfoxgiant monstertemptationtombstoneshot with an arrowfarmhouseyoung version of characterstabbed in the armdrumbeastfortressfilm starts with textman kills a womanhead cut offmusketshape shiftercorrupt officialtragic endingshapeshiftingsubterraneanshrinesorceressforced marriageanimal killingarmorypitmagic spelltitle spoken by narratorends with texthorse drawn carriagescrollbanishmenthutsuper speedstabbed in the footchopsticksfire breathingstudio logo segues into filmman wearing a wigjapanese culturetyrannyoil lampopening narrationjidai gekigiant creaturebare knuckle fightingmagical swordgunpowderfire breathing dragontroubled productionwuxia fictionbased on legendbegins with narrationcheeringfeudal japanhalf breedhara kiristabbed through the chinroninshogunslow motion sequencebowingmagical creatureseppukuwooden sworddishonoreyes different colorhyper speedcode of honorcommitting suicidescarsball and chainone year later1 year laterbokkenhuman versus dragonsamurai erainjured manbow the weaponasian dragonsamurai armourwooden bridgebathing in a streamfilm ends with texthonorable deathsold into slavery (See All) |
In the 1870s, Captain Nathan Algren, a cynical veteran of the American Civil war who will work for anyone, is hired by Americans who want lucrative contracts with the Emperor of Japan to train the peasant conscripts for the first standing imperial army in modern warfare using firearms. The imperial …Omura cabinet's first priority is to repress a rebellion of traditionalist Samurai -hereditary warriors- who remain devoted to the sacred dynasty but reject the Westernizing policy and even refuse firearms. Yet when his ill-prepared superior force sets out too soon, their panic allows the sword-wielding samurai to crush them. Badly wounded Algren's courageous stand makes the samurai leader Katsumoto spare his life; once nursed to health he learns to know and respect the old Japanese way, and participates as advisor in Katsumoto's failed attempt to save the Bushido tradition, but Omura gets repressive laws enacted- he must now choose to honor his loyalty to one of the embittered sides when the conflict returns to the battlefield... (Read More)
| Subgenre: | epicmartial arts |
| Themes: | couragemurderdeathlovefriendshiprevengesuicidepoliticsdrinkingfeartorturedrunkennessdeath of fatherredemptionexecution …hopevengeanceself sacrificesamurai (See All) |
| Mood: | gorerainnightmareambiguous endingsavage |
| Locations: | restaurantforestsnowvillagewoodsjapansan francisco california |
| Characters: | warriorhusband wife relationshipfather son relationshipmother son relationshipfriendboybrother sister relationshipprostitutesoldierreference to godnative americanjapanesealcoholicex soldiermilitary officer …samurai swordsamurai warrior (See All) |
| Period: | winter19th century1800s1870s |
| Story: | bow and arrowsword fightlancehonorspearchild murderbattlefieldmassacrecombatswordbattlehorseviolenceflashbackblood …gunkissfightknifepistolfirevoice over narrationcryingshootoutbeatingshot to deathblood splattermachine gunshot in the headshotgunslow motion scenecameradrinkmaskrifleheld at gunpointtearshand to hand combatprayershot in the backdecapitationassassinstabbingwomanthroat slittingstabbed to deathprisonerstabbed in the chestapologysevered headno opening creditsbathshot in the legshot in the foreheadflash forwardlegendbinocularscharacter repeating someone else's dialoguestabbed in the backspiritualityfired from the jobperson on fireattackninjakicked in the faceu.s. presidentshot in the shoulderdeath of brothertragic eventdeath of sonneck breakingloss of fatherthreatened with a knifeshot in the armgeneralsacrificesubtitled scenecivil wartraitordestinycaptaindestructionmass murdercaptivestabbed in the stomachtemplesergeantblockbusterrebelsevered handrebelliongenocidecompassionmonkcolonelsocial commentarycannonbuddhistbarefootreverse footagetokyo japanimaginationbraveryu.s. armykatana swordministerstabbed in the throathatredironystabbed in the neckstabbed in the legdark heromeditationslaughterarmortigertribeknife throwingbetloss of husbandtragic herodeath of loved oneloss of brothergatling gunarrogancepalaceshamedrugged drinktranslatorblood on camera lensbeheadingkatanagreekirish americanshot in the neckwar heroremorsejournalforeigneridealismstabbed in the armemperortheatre productionshot in the eyerailroadpremonitionheritagestreet fightbayonetheld captiveamerican civil warkarmahead cut offstabbed in the shouldershot in the throattragic pastpatriotmilitary trainingspitting bloodwarlordsurrendershot through a doorwinchester riflesecret pastpacific oceanbrother in lawlast standcutting hairretreatdefeatdojofalling off a roofwisdomchopstickshand cut offpersianjapanese culturedead husbandstabbed in the sidedutyjidai gekirickshawsideshowambiguitycounciljapanese armyscalpinginter culturalenglish subtitles in originalfriendly firecalligraphytroubled youthbowljapanese flagsuicidal tendencymedal of honoru.s. civil warunreliable narratorhara kirilieutenant colonelstitchesarrow in chestbowingsabresakecherry blossomwarrior racecavalry chargeknife in backseppukuthrown from a horsedishonorregimentsea voyagelinguistu.s. cavalryspring the seasonsword throwingcode of honorhiding in a treeyokohama japancentennialcoolieantique gunshot through the chestscalpsheathreference to george armstrong custerbokkenmilitary disciplinethrowing a speartribal leaderdelegationhowitzertroubled mindyear 1877 (See All) |
1400 B.C., a tormented soul walked the Earth that was neither man nor god. Hercules was the powerful son of the god king Zeus. For this, he received nothing but suffering his entire life. After twelve arduous labors, and the death of his family, this dark, world-weary soul turned his back on the god …s finding his only solace in bloody battle. Over the years, he warmed to the company of six similar souls, their only bond being their love of fighting, and the presence of death. These men and women never question where they go to fight, or why, or whom, just how much they will be paid. Now, the King of Thrace has hired these mercenaries to train his men to become the greatest army of all time. It is time for this bunch of lost souls to finally have their eyes opened to how far they have fallen, when they must train an army to become as ruthless and bloodthirsty as their reputation has become. (Read More)
| Subgenre: | martial artsblack comedysword and sorcerysword and fantasy |
| Themes: | murderdeathloverevengekidnappingbetrayalghostprisondrunkennessescapemonsterdeceptionredemptionfaithdeath of wife …self sacrificemurder of familygreek mythology (See All) |
| Mood: | gorenightmaremyth |
| Locations: | trainforestsnowvillageearthwalled city |
| Characters: | warriormother son relationshipfather daughter relationshipsoldierhostagetough guyaction herobullyuncle nephew relationshipex soldier |
| Story: | bow and arrowsword and sandalsword fightarcherkingdomspearbattlefieldprincesskingimpalementmassacrecombatswordbattlehorse …character name in titleviolenceflashbackbloodone word titledogbare chested malefemale rear nudityfighttitle spoken by characterpartyknifefirecorpseshot to deathblood splattershot in the chestshot in the headrescueslow motion scenepunched in the facefalling from heightbased on comicshowdownhand to hand combatjailhallucinationfightingshot in the backdecapitationgood versus evilorphanbased on comic bookambushaxemountaindisguisemontagethroat slittingarmystabbed to deathprisonerstabbed in the chestmapsnakenonlinear timelinebrunettesevered headno opening creditsone man armychild in perilfictional wardouble crosscreatureshot in the legtraininglegendstabbed in the backperson on fireattackstorytellingstatuetentknocked outkicked in the facetough girllightningopening action scenefarmershot in the shoulderdeath of sondarkneck breakingthreatened with a knifemercenarysevered armshot in the armgeneralbare chested male bondagekillingprincestylized violencecivil warrockpiratetraitorgolddestinywolfhead butthelmetjail cellvandalismfraudlossclubtorchfateaction heroineanimal attackfalse identitycrushed to deathfemale warriorfull moonadventurershieldhaunted by the pasttarget practicesufferingpastdual wieldstabbed in the throatwhipson3 dimensionalmuteshot in the facegreecestabbed in the headframe uplostswampstabbed in the leghit on the headexploding headdark herolionaerial shotdungeonknife fightsoulcaptureknife throwingstabbed in the eyetragic herodaggerpalacecrowdrugged drinkstrongmangiant monstermegalomaniacstabbed in the armadventure herotavernbased on graphic novelstabbed in the shoulderteamworkchainedshot in the throatrighteous ragestabbed in the facetragic pastdeath of familywarlordpsychotronic filmscytheanimal killinglong brown hairdreadlocksathens greecegiant animalepic battlestrong manhorse drawn carriageancient greeceaxe fightdouble entendreflaming arrowtyrannygiant creatureambiguitywoman hits a manspear throwingherculeschariotevil kingprecognitionclosing eyes of dead personhead on a stakehurttunictooth ripped outamazon warriorbroken jawfemale mercenaryhydrasoothsayercerberusfemale archeropening creditsheir to thronedark worldgod king (See All) |
After its victory over Leonidas' 300, the Persian Army under the command of Xerxes marches towards the major Greek city-states. The Democratic city of Athens, first on the path of Xerxes' army, bases its strength on its fleet, led by admiral Themistocles. Themistocles is forced to an unwilling allia …nce with the traditional rival of Athens, oligarchic Sparta whose might lies with its superior infantry troops. But Xerxes still reigns supreme in numbers over sea and land. (Read More)
| Subgenre: | epic |
| Themes: | murderdeathrevengerapebetrayalpoliticsdeceptiondeath of fatherbrutalityredemptionsadismexecution |
| Mood: | gore |
| Locations: | beachboatdesertseashipcaveoceanstorm at seasea battlewalled cityship fire |
| Characters: | warriorfather son relationshipsoldierpriesttough guyaction hero |
| Story: | bow and arrowsword and sandalsword fightarcherspearbattlefieldkingimpalementmassacrecombatswordbattlehorsenumber in titleflashback …violencebloodbare breastssequelfemale frontal nuditymale rear nuditydogbare chested malesex scenefemale rear nuditynipplesexplosionknifesurprise endingfiretopless female nudityvoice over narrationwoman on topbeatingcorpsedigit in titleshot to deathblood splatterfistfightshot in the chestshot in the headrescueslow motion scenepunched in the facebrawlfalling from heightshowdownhand to hand combatsecond partshot in the backdecapitationgood versus evilspyorphanambushtoplessdeath of friendmontagethroat slittingarmystabbed to deathstabbed in the chestnonlinear timelinechild abusesevered headno opening creditsanti herounderwater scenefemme fataleshot in the legdrowningtransformationtrainingstabbed in the backperson on firemoaningtentkicked in the facetough girllightningskeletonfarmershot in the shoulderlong takemanipulationscarexploding bodyneck breakingthreatened with a knifesevered armgeneralwhippingqueenstylized violencetopless womancivil warmachismotraitordestinyburned aliveheavy rainshot in the stomachhelmetelephantvillainessjumping from heightskullrape victimtorchaction heroinecrushed to deathmasked manslavefemale warriorguardshieldfloodface painttarget practiceinvasiondual wieldstabbed in the throat3 dimensionalstabbed in the neckgreecenipplewizardprophecystabbed in the headmentoroilsenatorstabbed in the legrainstormeye gougingknife throwingstabbed in the eyeaxe murdersevered legdaggerprequelpalacecrowfemale soldierblood on camera lenshistorical fictiongreeksex slavestandoffshot with an arrowyoung version of charactercommandernavycornfieldbased on graphic novelman punching a womanswimming underwatercrushed headcowgirl sex positionaltered version of studio logoopen endedexploding shipbreastwarlorddeformitychild rapearmy baseathens greecethronesex from behindman slaps a womanburning buildinghunchbackstarts with narrationwoman moaning from pleasurewoman moaningancient greecemoaning womanflaming arrowmessengerman fights a womandefectorfuneral pyrekicked in the chesttidal wavestabbed in the crotchantiquityspear throwingsinking shipnaval battlevirtual setdark horse comicsmeleetunicbound in chainsarmadadoggie style sex positionwar roomsex against the wallsea serpentmultiple sex positionssex against a wall5th century b.c.hell hound (See All) |
In ancient China, before the reign of the first emperor, warring factions throughout the Six Kingdoms plot to assassinate the most powerful ruler, Qin. When a minor official defeats Qin's three principal enemies, he is summoned to the palace to tell Qin the story of his surprising victory.
| Subgenre: | epicmartial artschrist allegorywuxia |
| Themes: | couragelovefriendshipsurrealismsuicideinfidelitybetrayaljealousyfuneralherodeceptionredemptionexecutionhopevengeance …self sacrifice (See All) |
| Locations: | schooldesertlakechina |
| Characters: | warriortough guyaction hero |
| Story: | sword fightheroismarrowhonorspearkingcombatswordbattleviolenceflashbackbloodmale rear nuditybare chested malefight …surprise endingvoice over narrationshot in the chestshot in the headslow motion sceneshowdownhand to hand combatfightingorphanassassincandlearmystabbed in the chestone man armyritualshot in the legtrainingduelone against manylibrarylegendstabbed in the backkicked in the facepremarital sexstylized violenceflyingassassination attempttold in flashbackfaked deathcompassionchop sockyfemale killersocial commentarydeath of protagonistrainstormsword dueltragic heromain character diespalacefemale assassinswordsmanlocal blockbusterlost lovetrue lovearcheryidealismfilm starts with textheritagetyrantkindnessresponsibilityrespectredescorttragic lovegreendeath of title characterpatriotundressing someoneflashback within a flashbackman with no namewu shurewardbluemale full back nuditynameless charactercalligraphywuxia fictionancient chinaunreliable narratordouble impalementwarrior womanwalking on waterbody searchunreliable flashbackunreliable narrationthrone roomcolor motif (See All) |
While protecting his village from rampaging boar-god/demon, a confident young warrior, Ashitaka, is stricken by a deadly curse. To save his life, he must journey to the forests of the west. Once there, he's embroiled in a fierce campaign that humans were waging on the forest. The ambitious Lady Ebos …hi and her loyal clan use their guns against the gods of the forest and a brave young woman, Princess Mononoke, who was raised by a wolf-god. Ashitaka sees the good in both sides and tries to stem the flood of blood. This is met be animosity by both sides as they each see him as supporting the enemy. (Read More)
| Subgenre: | epictragedymartial artscult filmdisneyadult animationdark fantasysword and fantasychrist allegory |
| Themes: | lovefriendshipherodeceptionnatureprejudicemythologysamurai |
| Mood: | goreanime |
| Locations: | forestjapan |
| Characters: | warriorhuman animal relationshipsamurai sword |
| Period: | 15th century16th century |
| Story: | shot with a bow and arrowbow and arrowsword fightprincesscombatswordhorsecharacter name in titleviolencef ratedbloodtwo word titlegunfighttitle spoken by character …knifechaseblood splattershowdownriflehand to hand combatdemonfightingshot in the backdecapitationweaponanimaldisarming someonefictional warjourneytransformationduelcurseopening action scenemanipulationsevered armhateprincestrong female characterspiritwolfheroinemutilationhunterblockbusterstrong female leadcompassionfemale warriorkatana sworddual wieldpeaceenvironmentalenvironmental issuedark heroknife fightsword duelenvironmental issuesdaggerfolklorekendosuper strengthconservationgirl powerkindnessfablefamous scoretolerancemusketdeforestationgiant animalfortboarhorse chasemoral ambiguityirondilemmawild boarforest protectionleprosyelknature conservationanimal protectionferal childsevered limbpanterritoryutopia questhuman versus animalwhite wolfthe westcutting off a handanimal allytalking wolf (See All) |
| Subgenre: | epicchrist allegory |
| Themes: | murderdeathloverevengemarriagereligionbetrayaljealousypoliticsescapedeceptionangerbrutalityredemptionfaith …home invasionexecutionhopeblindnessvengeanceamnesiaforgivenessself sacrificenear death experience (See All) |
| Locations: | beachsnowcemeterydesertwatervillageseashiprooftopcaveoceancampfiresea battle |
| Characters: | warriorfamily relationshipshusband wife relationshipmother son relationshipfather daughter relationshipmother daughter relationshipbrother sister relationshipsoldierhostagetough guyreference to godchristianityteacher student relationshipjewchildhood friend |
| Story: | bow and arrowsword and sandalsword fightarcherkingdombattlefieldcombatswordbattlehorsecharacter name in titleviolenceflashbackbased on novelblood …dogbare chested maledancingtitle spoken by characterexplosionpartyknifesurprise endingfirevoice over narrationcorpseshot in the chestremakeshot in the headslow motion scenearrestlettershowdownorphanaxemountainmontagearmyprisonerstabbed in the chestnonlinear timelinefalse accusationno opening creditsdisarming someoneassassinationunderwater sceneracial slurtrainingflash forwardperson on firetentlightninglong takecrossgiftreunionthreatened with a knifesevered armwhippingbare chested male bondageclass differencesqueenprincecircusassassination attemptheavy rainfriendship between menhelmetslaverycrucifixbeardrebelrebellioncrying mantorchcompassionsocial commentarydebateslavepresumed deadcelebrationreverse footageshieldresistancewhiphatredmercilessnessdeath threatgreecemiracleoilsibling rivalryrainstormbalconybetwar veteranstadiumsevered legdaggermoral dilemmapalaceman cryingbriberynarrated by characteroppressioncrucifixionfinal showdownspiral staircasemale friendshiphorse racingshot with an arrowamputeejerusalemarcherygovernorraftemperordrumcheering crowdarenahead injurywagerpalm treestablefight the systemchainedparaplegicbettingancient romecarpenterbowhorse racefreedom fighterresistance fighterbanquetdreadlocksloinclothtotalitarianismnomadloss of memoryrowingroman empiredinner tableflaming arrowstabbed in the sideromansheikcaught in the rainjesus christlobotomydiscipleseparation from familydeus ex machinasinking shipnaval battle1st centurychariotfirst aidleprosycrucifixion of jesusroman soldierjerusalem israelcannonballzealotoarreference to julius caesarjulius caesarenslavementlepertunicshackledadopted brotherslave girlcenturionremake of remakeriding accidentroman legionchariot racepontius pilatefast forwardleper colonyadrifttrampledcapsizeroman armycarrying someone over shouldercoliseumrebel fighterroman salutewhipping scars (See All) |
Set in 1884 Sudan, this fifth film to be adapted from the A.E.W. Mason novel follows a British officer who resigns his post right before his regiment ships out to battle the rebels. Perceiving his resignation as cowardice, his friends and fiancee give him four white feathers, the symbol of cowardice …, but little do they know he's actually going undercover and plans to redeem his honor. (Read More)
| Subgenre: | epichistorical event |
| Themes: | murderdeathfriendshiprevengejealousyprisondrinkingfeartortureescapemilitaryredemptionhumiliationdyingblindness …starvationfear of death (See All) |
| Mood: | rain |
| Locations: | englandchurchdesertcampfirechurch of england |
| Characters: | family relationshipsfather son relationshipfriendprostitutesoldierdancerlove trianglechristianreference to godsniperfiance fiancee relationshiplove letter |
| Period: | 19th century1890s1880s |
| Story: | sword fightwar violenceheroismhonormassacrecombatswordbattlehorsenumber in titleviolencesexbased on novelnudityblood …male nuditygunkissfightdancingchaseshootoutcorpseremakerescuedrinkgunfightshootingriflehand to hand combatdead bodybritishprayerambushdisguisearmybathjourneymarriage proposalgravelocker roompoisontenthangingpursuithorse ridinggeneralwhippingloyaltyfriendship between menslaveryislamrebelparadeburialorchestraslavebraverysandhypocrisyprideblack eyeprisoner of warslaughtersiegehorse and carriagepatriotismarroganceshamecamelvictorian eraheartbreakmake upabandonmentcolonialismbayonetbritish armymarching bandmilitary uniformstablerugbybritish soldiercowardromantic rivalrycaravanmass gravecavalrygogglesfortimperialismcowardicedeserterjail breakbroken engagementmutinycomradedrinking bloodegyptianmale camaraderiecamaraderiesandstormnorth africaequestrianstabbed with a swordbritish empirefriendly firesudanbritish flagdisgracestabbed with a bayonetdedicationoasisbritish militaryislamic fundamentalismreference to queen victoriaconscientious objectorsudanesenaked dead manregimentbritish colonialismmisfiring guntribal warfareheathenmilitary encampmentbritish imperialism (See All) |
A young Viking boy is left behind at a hostile tribe of American Indians, whom eventually accept him into the tribe and raise him. A personal war begins for the young Viking when the Vikings return 15 years later and initiate a barbaric attack on the tribe and the woman he loves.
| Themes: | murderdeathtortureself sacrifice |
| Locations: | snowrural settingcave |
| Characters: | boynative americanlittle boy |
| Period: | winter |
| Story: | bow and arrowsword and shieldsword fightarcherheroismchild murderimpalementmassacreswordhorsecharacter name in titleviolenceone word titledogtitle spoken by character …chasefalling from heightbased on comichand to hand combatrivershot in the backdecapitationmountainstabbingthroat slittingattempted rapescarunderwaterwaterfallbearwhippingmass murderhelmetcaptivesevered handshieldbooby trapvikingvery little dialoguenativeavalanchehornfrozen lakeship wreckwhite horsebloodlustsavagerymarauderman against natureviking shipsledgepathfinder9th centuryremake of norwegian film (See All) |
Jack Crabb is 121 years old as the film begins. A collector of oral histories asks him about his past. He recounts being captured and raised by indians, becoming a gunslinger, marrying an indian, watching her killed by General George Armstrong Custer, and becoming a scout for him at Little Big Horn.
| Subgenre: | cult filmalternate historyrevisionist western |
| Themes: | murderrevengekidnappingmarriageseductionracismabductiondeath of wife |
| Locations: | bathtubbar shootoutsex in a tent |
| Characters: | warriorhusband wife relationshipbrother sister relationshipnative americanalcoholic |
| Story: | shot with a bow and arrowbow and arrowsword fightwar violencebattlefieldmassacrecombatswordbattlehorseviolenceflashbacksexbased on novelinterview …kisstitle spoken by characterpistolvoice over narrationgunfightrevolvershot in the backorphandeath of friendtentchildbirthhorse ridingkissing while having sexsisterrace relationstold in flashbackblockbusterculture clashpreacherinterracial romancedual wieldslaughterbigotryhistorical fictionadolescencesaloonadopted sonhistorianpolygamysix shootermain character shotcavalryhermitfemale gunfightergunfighterinterracial adoptionwinchester riflestockholm syndromefictional biographydesertiontomahawkriding a horsechiefhistoric figureadoptive fatheranti establishmentwar paintadoptive father adopted son relationshipcavalry chargecarbinecowboys and indiansattempted seductionstorekeepercolt 45u.s. cavalrycentenarianexterminationsquawgoing nativenative american white relationshipstar and featherswhite indianabducted by indianscovered in tarsioux indianlittle big hornwhite raised as indiancheyenne triberaised by indianscheyenne indianmedicine show (See All) |
In 140 AD, twenty years after the unexplained disappearance of the entire Ninth Legion in the mountains of Scotland, young centurion Marcus Aquila (Tatum) arrives from Rome to solve the mystery and restore the reputation of his father, the commander of the Ninth. Accompanied only by his British slav …e Esca (Bell), Marcus sets out across Hadrian's Wall into the uncharted highlands of Caledonia - to confront its savage tribes, make peace with his father's memory, and retrieve the lost legion's golden emblem, the Eagle of the Ninth. (Read More)
| Subgenre: | independent film |
| Themes: | revengebetrayalescapefuneraldeath of fatherbrutalityredemption |
| Locations: | forestvillagewoodscavecampfire |
| Characters: | warriorfather son relationshipsoldieruncle nephew relationshipyounger version of character |
| Story: | bow and arrowsword fighthonorspearchild murderbattlefieldimpalementmassacrecombatswordbattlehorsebased on novelblooddog …two word titlebare chested malefighttitle spoken by charactersurprise endingslow motion scenepunched in the facevomitingshowdownhand to hand combatanimal in titleriversubjective cameradecapitationorphanambushaxethroat slittingarmystabbed to deathstabbed in the chestsevered headno opening creditschild in perilritualnecklacedrowningcharacter repeating someone else's dialoguebased on tv seriesbeaten to deathstabbed in the backperson on fireattackcharacter's point of view camera shotrace against timeknocked outkicked in the facedeath of childringscarhorse ridingloss of fatherratthreatened with a knifewaterfallcowdismembermentsubtitled scenesurgeryburned alivekilling an animalhead buttheavy raininjuryhelmetslaverykicked in the stomachculture clashtorchgoatslaveguardshieldhaunted by the pastface paintfight to the deathdual wieldscotlandtribeknife throwingdead boyethnic slursurgeondaggerbeheadinghistorical fictionwallhuntfilm starts with textarenabloody body of childrole reversalancient romegladiatorbird in titlestabbed in the facedeath of familyspitting bloodsole survivorguideanimal killingarmorybilingualismforthatchetleg woundbody paintboarcowardicehorse drawn carriagechild killeddesertercut armroman empirefuneral pyrebody armorspear throwingoutpostchariotboy killedlegionscottish highlandstuniccenturionslitting the throat of a childeating raw meatmaster slave relationshiptribesmanknife in the backskeletal remains2nd centuryeating a rathonorable dischargeroman senatorcut leghadrian's wall (See All) |
Maximus is a powerful Roman general, loved by the people and the aging Emperor, Marcus Aurelius. Before his death, the Emperor chooses Maximus to be his heir over his own son, Commodus, and a power struggle leaves Maximus and his family condemned to death. The powerful general is unable to save his …family, and his loss of will allows him to get captured and put into the Gladiator games until he dies. The only desire that fuels him now is the chance to rise to the top so that he will be able to look into the eyes of the man who will feel his revenge. (Read More)
| Subgenre: | epicmartial artscult filmstop motion |
| Themes: | couragemurderdeathrevengesurrealismrapebetrayaljealousypoliticsescapeincestcorruptionbrutalityredemptiongambling …mental illnesscrueltydeath of wifedyingvengeancefreedomjusticecheatingself sacrificeafterlifemurder of familymurder of son (See All) |
| Mood: | goresurreal scene |
| Locations: | forestdesertitalygermanyspain |
| Characters: | warriorfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshiptattoobrother sister relationshipsoldiersingle motherdaughteruncle nephew relationshipdeath of hero |
| Story: | bow and arrowsword and sandalsword fightlancearchercrownarrowhonorspearchild murderbattlefieldimpalementcombatswordbattle …horseviolencebloodone word titledogbare chested malekissfighttitle spoken by charactersingingfireblood splattershot in the chestface slaparresthallucinationprayerriverdecapitationsurvivalstabbingarmywidowstabbed to deathprisonerstabbed in the chestmapsnakesevered headno opening creditschilddream sequencejourneyshot in the legtrainingstabbed in the backperson on firefantasy sequencepoisonrace against timestatuetentevil manringfarmerhangingcourtspeechwigdeath of sonloss of fathertied upcharacter says i love yougeneraldismembermenttrusthatepowerafricanapplausegoldentertainmentgameloyaltydestructionburned aliveflyingwoundcageinjuryfamehelmetsurvivorrome italyslaverymutilationelephantcaptivehunterenemyloss of wifeblockbustersevered handparadehomecrying mantorchanimal attackambitionslaveshieldvisioncrossbowfight to the deathloss of sonstabbed in the throatwhippet dogsonpeacebutchertime lapse photographysenatorstabbed in the legdeath of protagonistlionsundungeonslaughterarmortigerstadiumtragic herobloodbathholding handscrowdmain character diesimprisonmenttorso cut in halfcamelcontractsuffocationflagwifecrucifixionbandageskirtstreet marketsexual tensionplaguearcherystabbed in the armemperormedalcheering crowdhugwetting pantscampaignarenapatricidepopularitytyrantaltered version of studio logocapedocumentempirefailurefamous scorebarbarianmurder of wifecrotch grabscarfbladefur coatcaravanancient romegladiatorbloodshedbowdeath of title charactercaresshorse and wagoninfantryvictoryretributionphilosopherslapincestuous desiregiraffestrengthveilcarriagechantingdepravityrewardmacefurdeserterscrollleadershipbattle axecobraroman empiresliced in twospaniardstabbed in the footwisdomdevotionflaming arrowsenatemessengernephewdebaucherystabbed in the sideromanprocessionromabody armorcatapulthomesicknessnorth africagodstriumphbustbannerstar died before releasefamous songpracticesaluteantiquityslave tradeconquestchariotwatching someone sleeplegioncolosseumencampmentserviceroman soldiertridentanimal bitegrapessavagerywheat fieldrepubliclast man standingreference to julius caesarfighting moviesobbinggloryplacardregicidewooden swordscene based on paintingrememberingdeath of cast memberspectaclevalorhailheadless horsemanimageryburnt corpseriding accidentfrostnativesrobinroman legionsuccessorfamily betrayalgerman languagepikesalt minecaesarforced perspectivevindicationflying debriscropsidearefusalsanitationtent city2nd centuryapplescruel fatherenvoymortal woundgladiatorial combatjasminereference to hannibalroman senatethumbs upbotched executionfamous speechinsigniaoverkillroman centurionchainmailcommanddream imageryformer slavegladiatorial sportlying in statetiredcall to armscoliseumlaurel wreathroman salutetemperanceancestorsartistic imagerydigitizationskip motionthumbs down (See All) |
Lancelot lives by the sword. In fact, they're next door neighbours, so teaming up to fight for money comes pretty naturally. Lady Guinevere, on her way to marry King Arthur is ambushed by the evil Sir Malagant. Fortunately Lancelot is lurking nearby and he rescues his future queen. They fall in love …, but Guinevere still fancies the idea of wearing a crown, so she honours her promise to Arthur. Can Lady Guinevere remain faithful, or will this Pretty Woman become a lady of the knight? (Read More)
| Subgenre: | martial artssword and sorcery |
| Themes: | murderkidnappingmarriageadulteryweddingfuneralhero |
| Locations: | villagecave |
| Characters: | warriorhusband wife relationshiplove triangledeath of hero |
| Story: | sword and shieldsword fightcrownmedieval timesbattlefieldkingcombatswordbattlenumber in titleflashbacktwo word titletitle spoken by charactershot in the chestshowdown …hand to hand combatmenage a troisambushdisarming someonefictional warlegendopening action scenewaterfallqueenarsonlawknighttorchshieldcrossbowarmorraidpassionate kisssword duelhorse and carriagemain character diesage differenceswordsmancremationstandoffshot with an arrowadventure herobarbarianmiddle agesmain character shotstafflast standhorse chasebattle axeflaming arrowobstacle courseking arthurcamelotexcaliburarthurian legendmace the weaponends with funeralknights of the round tableoubliette (See All) |
© 2023 FilmTagger.com
·
New Movies
·
About
·
RSS
·
Conditions
·
Privacy
FilmTagger.com