Best popular movies like Robin Hood: Prince Of Thieves:

Do you need specific genre & keyword selection to find films similar to Robin Hood: Prince Of Thieves?
<< FIND THEM HERE! >>

Robin Hood: Prince Of Thieves (1991)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Robin Hood: Prince Of Thieves (1991)

After being captured by Turks during the Crusades, Robin of Locksley and a Moor, Azeem, escape back to England, where Azeem vows to remain until he repays Robin for saving his life. Meanwhile, Robin's father, a nobleman loyal to King Richard the Lionhearted, has been murdered by the brutal Sheriff o β€¦f Nottingham, who helped install Richard's treacherous brother, Prince John, as king while Richard is overseas fighting the Crusades. When Robin returns home, he vows to avenge his father's death and restore Richard to the throne. Even though Maid Marian, his childhood friend, cannot help him, he escapes to the Forest of Sherwood where he joins a band of exiled villagers and becomes their leader. With their help he attempts to cleanse the land of the evil that the Sheriff has spread. (Read More)

Subgenre:
sword and sorceryswashbuckler
Themes:
murder of fatherprison escapecouragetheftrobberymagicweddingtorturepregnancyfriendshipmurder
Mood:
poetic justice
Locations:
castleenglandvillageforest
Characters:
cousin cousin relationshippoachingpregnant wifewitchaction herowarriorthiefpriestbabysinger
Story:
outlaw hideoutking of englandsword duelvillage set on firemurder of cousindeath of cousinmass hangingcatholic massstabbed with a daggerdagger held to throatkilled with an arrowflaming arrowshot with a bow and arrowoutlaw gangshot with an arrow β€¦childbirth complicationbow and arrowking richard inottingham englandriver battlewriting a lettersword held to throatheld at sword pointsword and shieldkilled with a swordstabbed with a swordsword and sandalcorrupt prieststolen horseblack horsewhite horsehorse chaseoutdoor weddinginterrupted weddingsherwood forestwedding ceremonyhand to hand combatsword fightman on fireperson on fireknife throwingholding one's hand over someone's mouthcutting the palm of one's handreference to the prodigal sonpushed through a windowexploding barrelband of outlawsfather's graveinability to swimenglish nobilityunable to swimlife debtspitting in someone's facewoman slaps a womancan't swimdrum rollface scardeer antlershit with a stickvow of revengecut on facehiding in a treethrown out a windowhorseback chasescimitar1190sscars on backhot candle waxsaved from hangingstabbed with a spearkneed in the crotch1100squarterstaffpublic hangingswordsmanshipblood oathplantagenetman murders a womanfacial injuryantler12th centuryface woundfriarmoorssitting in a treeagainst the oddsfacial cutreturn homecrusadesstabbed in the heartballadeermistletoewind chimestained glass windowdevil worshipmelongunpowderkrav magafall to deathbattle axeenglishwomancousinmedallionhalf brotherforced marriagemassbutt slapmiddle agesfacial scarfriends who live togethermiddle ageadventure heroenglishmanarchercrashing through a windowbarbarianfalling into waterhideoutarcheryjerusalembreadrobberpeasantswordsmanhorseback ridingstick fightdaggerarrowraidsiegemedieval timesstabbed in the legoutlawrowboathit in the crotchcrossbowguardtorchknightrebelstabbed in the stomachgoldprincebattlefieldarsonloss of fatherchildbirthdeath of brotherattempted rapekicked in the facestatuepassionattackdangerduelkingdisarming someonestabbed in the cheststabbed to deathstabbingambushgood versus evilcleavageshot in the backcombatrivershowdownletterfalling from heightbare buttswordrescueshot in the headface slapshot in the chesthorsefistfightfireshowerknifeexplosionmale rear nudityfemale nuditymale nuditydog (See All)

Robin Hood (2010)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Robin Hood (2010)

Birth of a legend. Following King Richard's death in France, archer Robin Longstride, along with Will Scarlett, Alan-a-Dale and Little John, returns to England. They encounter the dying Robert of Locksley, whose party was ambushed by treacherous Godfrey, who hopes to facilitate a French invasion of  β€¦England. Robin promises the dying knight he will return his sword to his father Walter in Nottingham. Here Walter encourages him to impersonate the dead man to prevent his land being confiscated by the crown, and he finds himself with Marian, a ready-made wife. Hoping to stir baronial opposition to weak King John and allow an easy French take-over, Godfrey worms his way into the king's service as Earl Marshal of England and brutally invades towns under the pretext of collecting Royal taxes. Can Robin navigate the politics of barons, royals, traitors, and the French? (Read More)

Subgenre:
epic
Themes:
murderdeathrevengepoliticsfuneralgamblingblindness
Mood:
rain
Locations:
castleenglandvillageforestbeachchurchlondon englandfranceship
Characters:
action herowarriormother son relationshipsoldiertough guysheriffyounger version of characterfrench girl
Story:
king of englandsword duelstabbed with a daggerkilled with an arrowflaming arrowshot with an arrowbow and arrowking richard inottingham englandsword and shieldkilled with a swordstabbed with a swordwhite horsehand to hand combatsword fight β€¦person on firereference to the prodigal sonenglish nobilityface scar1190sfacial injury12th centuryface woundfriarenglishwomanfacial scaradventure heroenglishmanarcherswordsmanhorseback ridingstick fightdaggerarrowsiegemedieval timesoutlawrowboatcrossbowtorchknightbattlefielddeath of brotherattempted rapekicked in the facekingdisarming someonestabbed in the cheststabbed to deathambushshot in the backcombatfalling from heightswordshot in the headface slapshot in the chesthorsefistfightfireexplosionmale rear nuditydogcharacter name in titlebloodviolenceflashbacktwo word titlebare chested malekissdancingsingingsurprise endingvoice over narrationshot to deathblood splatterslow motion scenepunched in the facebattlebrawldecapitationaxearmyimpalementmapno opening creditsshot in the legstabbed in the backtough girlringdeath of sondeath of husbandcharacter says i love youkissing while having sexqueensubtitled scenetraitorfireplaceloyaltyburned alivehead buttcaught having sexkicked in the stomachcrushed to deathbald manshieldinvasionchaosshot in the facetitle at the endblind manowlprequelpalaceinterrupted sexshot in the neckwar violencereading aloudbeecrowndomineering motherfilm starts with textshot in the throatfrenchmanoverbearing motherwoman slaps a manunwanted kissstaffdying wordsscottish accentfather in law daughter in law relationshipfather in lawpoacherbegins with textaxe fightscotsmanfuneral pyreoystershot in the sideenglish subtitles in originalfrenchwomanwelshmanbritish royaltyproduced by actortaxcrown princesign of the crossdaughter in lawmurdered priestbeekeeperends with narrationgrainsham marriagemother son conflictblind personferal childcrusadeking of francechain mailbill of rightsdragged by a horsemother slaps sonposing as husband and wifebody odorirish wolfhoundaxe in the backburning a documentelbowed in faceshell gamespoiled sonthrowing water on someoneinscriptiondeath of father in lawfemale slaps a malepretending to be marriedarrow through neckdeath of a kingassuming identity of a dead personblind person reads a facedonkey cartprince johntrampled by a horseunpaid taxes (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Adventures Of Robin Hood (1938)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Adventures Of Robin Hood (1938)

Sir Robin of Locksley, defender of downtrodden Saxons, runs afoul of Norman authority and is forced to turn outlaw. With his band of Merry Men, he robs from the rich, gives to the poor and still has time to woo the lovely Maid Marian, and foil the cruel Sir Guy of Gisbourne, and keep the nefarious P β€¦rince John off the throne. (Read More)

Subgenre:
swashbucklerhistorical event
Themes:
theftrobberymurderescapejustice
Mood:
poetic justice
Locations:
castleenglandforest
Characters:
warriorthiefsoldiermusiciantough guythief hero
Story:
king of englandsword duelshot with a bow and arrowoutlaw gangbow and arrowriver battlesword and shieldhorse chasesherwood forestsword fight1190ssaved from hangingquarterstaffswordsmanshipplantagenet β€¦12th centuryfriarmiddle ageshideoutrobberswordsmanstick fightdaggerarrowmedieval timesoutlawcrossbowknightrebelprincebattlefielddueldisarming someoneambushgood versus evilcombatshowdownswordrescueknifedancingchasebattlecandleprisonertrialfishingfictional warlegendhangingvigilanteropefireplacespeartournamentslaveshieldfight to the deathdrummerknife fightcapturedeerdictatorhistorical fictionvigilantismtreasontavernvigilante justicebishopnoosechainedrevolttrapdoorhorse and wagonvictorytargetbanquetmaceoathsteel helmetvineprocessioncoronationgallowscartoutnumberedwinkbritish royaltypiggy back ridejewelslanceencampmentpushed down stairsmarksmanroastinterrupted hangingluteusurpernarrow escapesaxongentleman thiefbullseyequill penregentnormanportcullislongbowfire pitthatched roof (See All)

Conan The Barbarian (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Conan The Barbarian (2011)

A quest that begins as a personal vendetta for the fierce Cimmerian warrior soon turns into an epic battle against hulking rivals, horrific monsters, and impossible odds, as Conan realizes he is the only hope of saving the great nations of Hyboria from an encroaching reign of supernatural evil.

Subgenre:
sword and sorcerymartial artsalternate historysword and fantasy
Themes:
murder of fathermagictorturepregnancymurderdeathrevengesuicidekidnappingjealousyescapeherodeath of fatherbrutalitysupernatural power β€¦death of mothercrueltydeath of wifevengeancedeath of daughterdeath in childbirth (See All)
Mood:
gore
Locations:
castlesnowboatwoodscampfirewalled city
Characters:
witchaction herowarriorthiefhusband wife relationshipfather son relationshipfather daughter relationshipboysoldiertough guysingle fatheryounger version of characterdancing girl
Story:
sword duelshot with a bow and arrowshot with an arrowbow and arrowstabbed with a swordsword and sandalhorse chasehand to hand combatsword fightperson on firestabbed with a spearbattle axefacial scaradventure heroarcher β€¦barbarianswordsmanstick fightdaggerstabbed in the legbattlefieldchildbirthkicked in the faceattackkingdisarming someonestabbed in the cheststabbed to deathambushgood versus evilshot in the backcombatshowdownfalling from heightswordrescueshot in the headshot in the chesthorsefistfightfireknifeexplosionfemale nuditymale nuditycharacter name in titlebloodviolenceflashbackbare chested malesex scenefightchasethree word titleshot to deathblood splatterremakeslow motion scenebattlemaskbased on comicinterrogationdemonfightingdecapitationfoot chaseassassinbound and gaggedbased on comic bookname in titleaxemassacremountaindisguisethroat slittingimpalementmixed martial artssevered headnunno opening creditsanti heroone man armychild in perilfictional warritualunderwater scenecreatureshot in the legprincessdrowningone against manybeaten to deathstabbed in the backkeyevil mantough girlscarexploding bodyneck breakingpremarital sextied upthreatened with a knifemercenarywaterfallsevered armfreeze framesingle parenthenchmanpirateburned alivekilling an animalhead buttspearassassination attempteggcatfightslaverymutilationkicked in the stomachjumping from heightmonkanimal attackgoatinterracial friendshipcrushed to deathback from the deadslavecelebrationfemale warriordamsel in distressadventurerdual wield3 dimensionalchaosgash in the faceresurrectionfalling to deathprophecystabbed in the headpunched in the chestdark herodungeoncapturedisfigurementeye patchpassionate kissdemonic possessionblack magicburned to deathpipe smokingpalacedriftermonasterymusclemanstrongmanfireballhuman sacrificeworld dominationmegalomaniacsorcerertaverntentacletestcrushed headsword fightingslingshothammockchainedprehistoric timesrighteous rageclawsubterraneanblacksmithwarlordarm wrestlingavalanchesorceresscavalryhouse firebonefetusman hits a womanincestuous desiresailing shipstarts with narrationwagonsuit of armoraxe fightnewbornstabbed in the footbuilding collapseone eyed manboulderserpentcatapultwoman in laborstudent teacher relationshiprite of passageoraclepulp fictionstone ageancientfalling through icerope bridgepoisonedevil sorcererremake of cult filmmurder of a pregnant womananvilspyglasschained to a wallwarrior womanmaster apprentice relationshipcaesarean birthrun overbound in chainstasting bloodsandmanshackledsevered noseslave girlburning villagetwo on a horsegiant octopushorse drawn wagonrobert e. howardbased on pulp magazinefreed slavecaesarean sectionmolten metalchild warriortrebuchetswallowing a keyjumping off cliffpaleolithic ageseeing father murderedvolley of arrowsfall through floor10000 b.c.100th century b.c.four against onehyborian agenatural bridgetied to a wagon wheelsword forging (See All)

King Arthur: Legend Of The Sword (2017) is one of the best movies like Robin Hood: Prince Of Thieves (1991)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

King Arthur: Legend Of The Sword (2017)

Subgenre:
sword and sorcerymartial artscoming of ageblack comedysupernaturaldark fantasysword and fantasychrist allegoryrevisionist history
Themes:
couragerobberymagicmurderfriendshipdeathrevengesurrealismkidnappingmoneybetrayaljealousyprisonfearescape β€¦funeralmonsterdeceptionangerdeath of fatherbrutalitysupernatural powerdeath of motherparanoiaredemptionexecutionhopedeath of wifepanicself sacrificemythology (See All)
Mood:
rainnightmaredarkness
Locations:
castleenglandvillageforestboatlondon englandwaterwoodslakeshipcavebrothelsewer
Characters:
witchaction herowarriorthiefhusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshiptattoobrother brother relationshipbrother sister relationshipprostitutesoldierhostagetough guy β€¦little boymaiduncle nephew relationshipmermaidself doubt (See All)
Story:
flaming arrowshot with an arrowbow and arrowhand to hand combatknife throwinggunpowdermiddle agesarcherarcheryswordsmanraidmedieval timesstabbed in the legoutlawrowboat β€¦guardtorchknightrebelbattlefieldarsonloss of fatherattackdangerkingdisarming someonestabbed in the cheststabbed to deathambushgood versus evilshot in the backcombatrivershowdownfalling from heightswordrescueshot in the headshot in the chesthorsefistfightfireknifeexplosiondogcharacter name in titlebloodviolenceflashbackbare chested malefighttitle spoken by characterchasesurprise endingbased on bookbeatingcorpseshot to deathblood splatterslow motion scenepunched in the facewritten by directorbattlebrawlinterrogationdemonprostitutionbritishislandfightingsubjective cameradecapitationspyfoot chaseorphancandlegangstrangulationaxemassacredisguisemontagethroat slittingbridgearmyimpalementmixed martial artsprisonermapsnakenonlinear timelinesevered headanti heroone man armychild in perilfictional warritualunderwater scenecreaturefemme fataleshot in the legtransformationon the runtrainingone against manylegendcharacter repeating someone else's dialoguebeaten to deathstabbed in the backscreamingfugitivepoisoncharacter's point of view camera shotevil manknocked outopening action sceneshot in the shouldermanipulationscarexploding bodyratthreatened with a knifewaterfallsevered armloss of motherprofanityshot in the armgeneralqueenpowerfreeze framestylized violencehenchmanriottraitorfalling down stairscaptainsabotagewolfdestructionburned alivehead buttspearassassination attemptfaintingscene during opening creditshelmetslaveryroyaltyelephantjail cellmagicianbeardsergeantkicked in the stomachloss of wifenosebleedblockbustergiantpooljumping from heightrebellionmind controlcgifollowing someoneanimal attackinterracial friendshipcrushed to deathscammasked manslaveeaten alivedwarfreverse footageshieldcameohaunted by the pastnicknamevisiontarget practiceexplosivebraveryblood on faceresistancedual wieldhatredimpostormercilessnesschaosshot in the facedeath threatprophecystabbed in the headmentorpunched in the chestcon artistdark heroaerial shotdungeonwisecrack humordisfigurementdark pastdemonic possessionkingdomtragic heroblack magicburned to deathcoinpatriotismfast motion scenepalacebullet timebatdoppelgangeroppressiondirector cameoface maskhistorical fictionfighterfinal showdownfolklorebag over headmusclemanstrongmanscene before opening creditssuper strengthtowerfireballhuman sacrificevikingyoung version of charactercrownidealismfemale spycommanderfortresshanging upside downsorcerertavernbellfilm starts with textreluctant heroman kills a womantyrantaltered version of studio logofight the systemheirburnt bodyshot in the throatpart computer animationrighteous ragetragic pastsubterraneanjailbreaksorceresscoup d'etatcockney accentbo staffflashback within a flashbackresistance fighteralternate dimensionscytheanimal killingchosen onekicking in a doorassassination plotgiant animalglowing eyeshawkthronefratricideburning buildingtotalitarianismslow motion action scenechild swearingjumping from a rooftophands tiedsevered earsuper speedorigin of herobaronstabbed in the sidetyrannybrandysnorricamsquidcollapsing buildingwarlockdefectorfuneral pyrecoronationcatapultturned to stonebare knuckle fightinggiant snakeking arthurbattering ramslave laborspear throwingmartial arts schoolpublic executionevil sorcerervenompyrokinesisstabbed through the chestcamelotcovered in mudevil kingexcaliburwrecking ballarthurian legendmagehanged bodygiant squidashman with a ponytailtunicround tableflaming swordburning villagegiant ratsnake venomchild slaverylancelotcollapsing bridgeknights of the round tablegiant batgrafittiheir to thronemartial arts instructormagic sword (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Robin Hood (1973)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Robin Hood (1973)

An imaginative Disney version of the Robin Hood legend. Fun and romance abound as the swashbuckling hero of Sherwood Forest and his valiant sidekick plot one daring adventure after another to outwit the greedy prince and his partner as they put the tax squeeze on the poor.

Subgenre:
swashbuckler2d animationdisney
Themes:
theftrobberyweddingtorturefriendshipmoneyheroexecutiongreed
Mood:
rain
Locations:
castleenglandforestchurch
Characters:
action herowarriorthiefpriestvillainsheriffthief hero
Story:
bow and arrowsherwood forestsword fightswordsmanship12th centuryfriarmiddle agesfriends who live togetheradventure heroarcherarcheryrobberpeasantswordsmanstick fight β€¦arrowmedieval timesoutlawguardrebelprincearsondisarming someonegood versus evilcombatswordfiredogcharacter name in titlekisstitle spoken by characterchaseunderwearcatjailfoot chaseaxedisguisefootballsnakevoice overmissionrabbitpigchickenbearsleepingcross dressingwolfballoontalking animalelephantmouseblockbusterfaked deathtournamentfalse identityanthropomorphismimaginationanthropomorphic animalhypnosisliondungeonturtleowlanimal name in titlevillain played by lead actorsidekickfoxcorporal punishmentcrocodilesquirrelsleeptyrantroosterbowblacksmithanachronismraccoonvillain arrestedgender disguisevultureburning buildingcarriagechildhood sweetheartjail breakaxe fightrhinocerospuppet showcollisionreference to walt disneyhippopotamusexecutionerfurrycastle thunderanimal protagonistbadgerbased on legendtaxorphan boyplay fightanthropomorphic mousebadmintonbased on folk talewolf whistlelong swordstorkwooden swordends with a weddingthumb suckingminstreltax collectoraleanthropomorphic dogends with weddinganthropomorphic catluteanthropomorphic birdnarrow escapeanthropomorphic bearanthropomorphic rabbitstorybook in opening shotregentanimal villainspiraling eyesanthropomorphic turtleanthropomorphic elephantanthropomorphic foxanthropomorphic pigprince john (See All)

Robin Hood: Men In Tights (1993)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Robin Hood: Men In Tights (1993)

Robin of Locksley, known as the most skilled archer of the land, has just returned to England after fighting in the Holy Crusades, where King Richard the Lionhearted is also fighting. Robin finds that much of what he knew of England has gone to ruin, including his longtime family home having been ta β€¦ken away, all at the hands of the evil Prince John, Richard's brother who has assumed the throne in Richard's absence. Neurotic John is basically being controlled by the equally evil Sheriff of Rottingham, everything they doing to fatten their own coffers at the expense of the commoners and peasants. As such, Robin recruits a band of merry men to help him battle Prince John and the Sheriff, they who include: Blinkin, his blind longtime servant; Ahchoo, the misguided son of Asneeze, the man who helped him escape from prison while fighting in the Crusades; Little John, who seems to think that being called Little is only coincidental to the fact of he being a hulking man; and Little John's friend, Will Scarlet O'Hara, a master with daggers. In going to the palace, Robin falls in love at first sight with Marian of Bagelle, a maid of the court. Marian is looking for the man who has the figurative and literal key to unlock her heart (and more private parts). The Sheriff has his own eyes on Marian, he who in turn is the object of desire of Latrine, a powerful hag of a sorceress of the court. Robin and the Sheriff in particular have a fight to the death mentality to achieve their end goals… (Read More)

Subgenre:
swashbucklercult filmslapstick comedy
Themes:
weddinggangsterheroblindnessescape from prison
Mood:
spoofparodybreaking the fourth wall
Locations:
castleenglandforestsinging in a bathtub
Characters:
witchaction herowarriorthiefsingerafrican americantough guyhitmansnipersheriffself referentialthief hero
Story:
sword duelflaming arrowshot with a bow and arrowshot with an arrowbow and arrowhand to hand combatsword fightknife throwing1190ssaved from hangingquarterstaff12th centuryfriarballadeerfriends who live together β€¦adventure heroarcherarcheryjerusalemswordsmanstick fightdaggerarrowmedieval timeshit in the crotchcrossbowguardknightprincebattlefieldarsonkingdisarming someonestabbed in the chestambushcleavagecombatshowdownfalling from heightswordface slaphorsefistfightfirecharacter name in titlefighttitle spoken by characterpartysurprise endingpunched in the facebattlebrawlfightingwomanbridgetalking to the cameratrainingcharacter repeating someone else's dialoguevirginkaratewritten and directed by cast membercharacter's point of view camera shotopening action scenescene during end creditscontestcharacter says i love youobscene finger gesturecult directorcross dressingsubtitled sceneredheadspearscene during opening creditsservantabsurd humorremote controlplayboy magazinedual wieldlove at first sighttitle appears in writingpsychotronicdungeonknife fightsexy womanraised middle fingerblind manwoman in bathtubsidekickdirector cameosneakerstowerblack manlizardrabbicameo appearancenoosebriton abroaddeath of familymimereference to abraham lincolnmoleanachronismhouse on firefairguillotineman in dragman dressed as womansevered earsong and dancecomic herocomic violencecatapultfake beardblowing a kisstrailer narrated by percy rodriguezspeech impedimenttaxeslancetightsreference to mark twainchastity beltupside down camera shotlong swordhangmanmovie reality crossoverjewish stereotypesinger offscreenminstrelmusical sequence in non musical workmale slaps a malerunning into a treecardboard cut outreference to larry kingmedium breastsportcullis (See All)

Timeline (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Timeline (2003)

In this case, a group of archaeologists and combat experts led by Paul Walker and Frances O'Connor use a "3-D fax machine" (so much for technobabble!) to time-travel back to France in 1357, in hopes of retrieving Walker's father and returning safely to the present. No such luck! Fending for themselv β€¦es against marauding hordes of medieval French warriors at war with the invading British, these semi-intrepid travelers find their body count rising, and the deadline for their return home is rapidly approaching. (Read More)

Subgenre:
swashbucklercult filmfish out of watersword and fantasy
Themes:
friendshipmurderdeathloverevengesurrealismdrinkingescapeherodeceptiontime travel
Locations:
castlevillagehospitalmotorcycleairplanefrancerooftoptunnelcave in
Characters:
warriorfather son relationshippolicefrienddoctorteacherstudentpolicemantough guyteacher student relationshipprofessor
Story:
sword duelflaming arrowshot with a bow and arrowshot with an arrowbow and arrowhand to hand combatsword fightman on firereturn homearcheryarrowsiegemedieval timestorchknight β€¦battlefieldarsonstatuedueldisarming someonestabbed in the cheststabbed to deathstabbingambushcombatshowdownfalling from heightswordrescuehorsefireexplosionbased on novelbloodviolenceone word titlekissfighttelephone callcell phonecomputerdrinkbattlebeeraxefictional warstabbed in the backlocker roomopening action scenehorse ridingsubtitled sceneeyeglassesgrenadespearbeer drinkinghelmetmad scientistcannonshieldmobile phonecapturekingdomruinsmonasterytime machinemarinearcheologyartifactreluctant herotour guidehistorianairfieldinfantrycavalryburning buildingscientific researchscottish accentmacearchaeologistwormholesteel helmetbody armorcatapultswordplayaltering historyarcheological digprototypesecret experimentcarvingmagelucky charmelectro shock1300ssecret lablost fatherhundred years warancient swordtrebuchetexperiment on oneselffemale archaeologistmedieval francesilver city new mexico (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

First Knight (1995) is one of the best movies like Robin Hood: Prince Of Thieves (1991)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

First Knight (1995)

Lancelot lives by the sword. In fact, they're next door neighbours, so teaming up to fight for money comes pretty naturally. Lady Guinevere, on her way to marry King Arthur is ambushed by the evil Sir Malagant. Fortunately Lancelot is lurking nearby and he rescues his future queen. They fall in love β€¦, but Guinevere still fancies the idea of wearing a crown, so she honours her promise to Arthur. Can Lady Guinevere remain faithful, or will this Pretty Woman become a lady of the knight? (Read More)

Subgenre:
sword and sorcerymartial arts
Themes:
weddingmurderkidnappingmarriageadulteryfuneralhero
Locations:
villagecave
Characters:
warriorhusband wife relationshiplove triangledeath of hero
Story:
sword duelflaming arrowshot with an arrowsword and shieldhorse chasehand to hand combatsword fightbattle axemiddle agesadventure herobarbarianswordsmanraidmedieval timescrossbow β€¦torchknightbattlefieldarsonkingdisarming someoneambushcombatshowdownswordshot in the chestnumber in titleflashbacktwo word titletitle spoken by characterbattlemenage a troisfictional warlegendopening action scenewaterfallqueenlawshieldarmorpassionate kisshorse and carriagemain character diesage differencecremationstandoffmain character shotstafflast standobstacle courseking arthurcamelotexcaliburarthurian legendmace the weaponends with funeralknights of the round tableoubliette (See All)

In The Name Of The King: A Dungeon Siege Tale (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

In The Name Of The King: A Dungeon Siege Tale (2007)

Set in the kingdom of Ehb, the story follows Farmer ('Jason Statham' (qv)), who was adopted by his village. When Farmer's wife, Solana ('Claire Forlani' (qv)), and his son leave to sell vegetables at the town of Stonebridge, Farmer's farm is attacked by creatures called Krugs. With the help of his f β€¦riend and neighbor Norrick ('Ron Perlman (I)' (qv)), he travels to Stonebridge where his wife and son are. Before he arrives, the Krugs, controlled by the wizard Gallian ('Ray Liotta' (qv)), kill his son and capture his wife. Farmer, with the help of Bastian ('Will Sanderson' (qv)), his brother-in-law, and Norrick sets out to find and rescue his wife. The King's nephew Fallow ('Matthew Lillard' (qv)) is conspiring with the wizard Gallian to take over the kingdom led by King Konreid ('Burt Reynolds'). (Read More)

Subgenre:
sword and sorcerymartial artscult filmtragedyepicsword and fantasy
Themes:
couragemagicweddingtorturepregnancymurderfriendshipdeathloverevengekidnappingescapemonsterherodeception β€¦memorydeath of fathersupernatural powerdeath of mothergriefgreedadoptiondyingvengeance (See All)
Mood:
rain
Locations:
castlevillageforestwoodsfarmlake
Characters:
action herowarriorfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipfriendboybrother sister relationshipsoldiertough guyvillainuncle nephew relationshipgrandfather grandson relationship β€¦grandmother grandson relationship (See All)
Story:
sword duelflaming arrowshot with a bow and arrowshot with an arrowbow and arrowsword and sandalhand to hand combatsword fightman on firefacial scararcherpeasantdaggersiegeraid β€¦medieval timesstabbed in the stomachbattlefieldpassionattackduelkingdisarming someonestabbinggood versus evilcombatshowdownfalling from heightswordrescuehorsefireknifeexplosionbloodviolenceflashbackkissfightchasecryingblood splatterfoodslow motion scenebattlebooktearsrunningneighborsubjective camerasurvivalwinecandleaxemassacremountainthroat slittingbridgeeatingarmymixed martial artsprisonermapfictional warprincessnecklacegravelibrarypoisonninjareadinglightningfarmerhangingpursuitdeath of sonhorse ridingpigneck breakingtrapgeneralchild murderdestinyspearmachetecaptivewitchcraftgenocidehonorburialslavepresumed deadrampagetelescopethunderbraveryloss of sonbased on video gameshovelwizardpridedungeoncapturearmorlieutenantkingdomblack magictelekinesissmokeimprisonmentcrowheroismlevitationfarmingstandoffcommanderhanging upside downsorcererfantasy worldheirclimbing a treetitle in titleflamedeath of grandmothersorceryhorse and wagondeath of parentscavalrystaffimmolationvalleydeath of grandfatherthronetear on cheekbrother in lawstrawberryretreatchopping woodmistsuit of armorrunning for your lifedukeboomerangfuneral pyrecatapultransackingconcubinemissing sonpickaxesuicide contemplationaudio flashbackhanged by the neckkidnapped childlong lost fatherforced laborbell towerfalling off horsewarrior womandefiancegrapesmarketplacehayloftlong lost sonbell ringingfalling into a riverallyheir to the throneclimbing a ropegorgeamazon womanturniprope around neckdeath of grandsonshroudblackbirdpet pigpeasant armyreunited with parentupward camera shotburning barndeath of nephewpillageblack blooddeath of a kingswinging on a vinewizards' duelrain of arrows (See All)

The Huntsman: Winter's War (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Huntsman: Winter's War (2016)

Subgenre:
sword and sorcerymartial artsblack comedysuspensesupernaturalfairy taledark fantasysword and fantasybased on fairy tale
Themes:
couragemagicmurderdeathloverevengesurrealismkidnappingmarriagebetrayalfearescapemonsterherodeception β€¦angerobsessionsupernatural powerredemptionguiltinsanitygriefevilunrequited loveexecutionhopegreedpanicnear death experienceregretmurder of family (See All)
Locations:
castlevillageforestchurchsnowwoodscampfire
Characters:
action herowarriorthiefbabysoldierhostagesister sister relationshiptough guylittle girllittle boy
Story:
flaming arrowshot with an arrowbow and arrowhand to hand combatsword fighthalf brotherarcherarcherystick fightrowboatcrossbowguardtorchgoldbattlefield β€¦kicked in the faceattackdangerkingdisarming someonestabbed in the chestambushgood versus evilcombatrivershowdownswordrescueshot in the headface slapshot in the chesthorsefistfightknifeexplosioncharacter name in titlebloodviolencesequelflashbackbare chested malekissfightchasesurprise endingvoice over narrationbeatingcorpsemirrorslow motion scenepunched in the facebattlebrawlsecond parthallucinationsubjective cameraorphancandleaxemassacremountainmontagebridgearmyimpalementmixed martial artssnakefalse accusationno opening creditsanti herobirdone man armychild in perilfictional wardouble crosscreaturefemme fatalenecklacetransformationon the runtrainingflash forwardskinny dippingone against manycharacter repeating someone else's dialoguebeaten to deathstabbed in the backprologuescreamingfantasy sequencefugitivemissiondeath of childtough girlscene during end creditsmanipulationthreatened with a knifedirectorial debutwaterfallflowerprofanitylove interestqueenmonkeypowerstylized violencechessiceeavesdroppingtraitorwolffireplaceburned aliverevelationhead buttspearassassination attemptheavy rainlooking at oneself in a mirrorquestcatfighthelmetspin offkicked in the stomachvillainessjumping from heightfrogirishfaked deathmind controlforbidden loveaction heroineanimal attackback from the deadbar fightpresumed deadfemale warriordwarfreverse footageshielddiamondvisiontarget practicebraveryfight to the deathfairydual wieldmercilessnessresurrectiondark humorsuper villainimmortalitytime lapse photographypunched in the chestengagementbooby trapaerial shotknife fightdeerpassionate kisskingdomblack magicburned to deathowltelekinesisprequelpalacetelepathyimprisonmentheroismhappy endingfemale soldierfinal showdownworld dominationcomic reliefmegalomaniacyoung version of charactercrownfortresshearing voicesnarcissismtavernreluctant herotentacleman kills a womanmacguffinwoman kills a manaltered version of studio logogoblinstabbed in the shoulderbleeding to deathevil womantragic lovedeath of familywoman fights a manwarlordsorceresscoup d'etatwoman slaps a manmind readingone woman armybo staffimprovised weaponchainsanimal killingrock climbinganti heroineglowing eyeschild abductionsecret lovethronepower strugglescottish accenthorse drawn carriagenetbanishmentsuit of armoraxe fightsurprise during end creditsorigin of herochild soldierstudio logo segues into filmdukeman fights a womantrackercoronationnarcissistmohawk haircutcaught in a netfemale thieftailrope bridgethrown from heightcloakevil laughterreference to snow whitefreeze to deathevil queenbackflipsentenced to deathelkmagical mirrormeltingsororicidemagical creatureaxe throwingbrothers grimmtunicprequel and sequelblack bloodsnow queen (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Three Musketeers (1993)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Three Musketeers (1993)

The three best of the disbanded Musketeers - Athos, Porthos, and Aramis - join a young hotheaded would-be-Musketeer, D'Artagnan, to stop the Cardinal Richelieu's evil plot: to form an alliance with enemy England by way of the mysterious Milady. Rochefort, the Cardinal's right-hand man, announces the β€¦ official disbanding of the King's Musketeers. Three, however, refuse to throw down their swords - Athos the fighter and drinker, Porthos the pirate and lover, and Aramis the priest and poet. Arriving in Paris to join the Musketeers, D'Artagnan uncovers the Cardinal's plans, and the four set out on a mission to protect King and Country. (Read More)

Subgenre:
swashbucklermartial artsdark comedybuddy comedy
Themes:
couragetorturemurderfriendshipdeathlovesuicidekidnappingbetrayalpoliticsprisondrunkennessescapeherodeception β€¦seductionrevolution (See All)
Locations:
castlevillagebarparis francebathtubshipprison fight
Characters:
action herowarriorpriestteenagersoldierhostagehitmanwaitressbibleex husband ex wife relationship
Period:
17th century1600s
Story:
sword duelshot with an arrowheld at sword pointcorrupt priesthorse chasesword fightgunpowderadventure heroswordsmandaggersiegeoutlawcrossbowguardtorch β€¦duelkingstabbed in the chestgood versus evilcleavagecombatshowdownfalling from heightswordrescueshot in the chesthorsefistfightfireknifeexplosionbased on novelviolencebare chested maleguntitle spoken by characterchasepistolshootoutbeatingblondepunched in the facebattlegunfightbrawlrifleheld at gunpointkung fuspyassassinwineaxedisguiseimpalementmapanti herodouble crossfemme fataledrowningtrainingmissionsensualitycountrysidethreatened with a knifemercenarywhippingqueenpiratetraitorfalling down stairsfireplaceloyaltykilling an animalassassination attemptlifting someone into the aircaptivecrucifixhonorcannonstupiditytarget practicebuddydeath threatfirst kissdungeonbounty huntercaptureeye patchpassionate kisspigeonchallengefemale assassinflaghistorical fictiontreasonstabbed in the armfemale spybayonetrobefemale villainwindmillmusketassassination plotteenage herosecret pastflintlock rifleflintlock pistolhorse drawn carriagebaroquescrollfalling off a cliffbrandingcardinal the priestmonarchybrandykicked in the chestroyal courtstabbed with a bayonetcannonballattempted seductionconcealed weaponinvincible henchmanoverhearingthree man armythree musketeerscalais francehollow bookhigh treason (See All)

The Scorpion King (2002) is one of the best movies like Robin Hood: Prince Of Thieves (1991)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Scorpion King (2002)

In an ancient time, predating the pyramids, the evil king Memnon is using the psychic powers of his sorceress Cassandra to fortell his great victories. In a last ditch effort to stop Memnon from taking over the world, the leaders of the remaining free tribes hire the assassin Mathayus to kill the so β€¦rceress. But Mathayus ends up getting much more than he bargained for. Now with the help of the trickster Arpid, tribal leader Balthazar and an unexpected ally, it's up to Mathayus to fufill his destiny and become the great Scorpion King. (Read More)

Subgenre:
sword and sorcerymartial arts
Themes:
magicbetrayalherowrestling
Locations:
desertcitycave
Characters:
action herowarriorthiefboytough guyhorse thief
Story:
sword duelflaming arrowshot with a bow and arrowsword and sandalhand to hand combatsword fightknife throwinggunpowderarcheryswordsmandaggerarrowsiegeraidhit in the crotch β€¦battlefieldduelkingdisarming someoneambushcombatshowdownfalling from heightswordrescuefistfightfireknifeexplosioncharacter name in titleviolencefightthree word titlebattlebrawlanimal in titlefightingassassinstrangulationaxethroat slittingimpalementmixed martial artssnakesevered headno opening creditsdream sequenceone man armyfictional warpoisonopening action scenewaterfallcross dressingdestinyspearspin offskullvisiontelescopeexplosivesandresistancedual wieldinventordead boyrescue missionprequelpalacecamelspit in the facemusclemanstrongmanparkourstabbed in the armcrystalscorpionpatricideanttyranttitle in titlebowharemarm wrestlingsorceressurnancient egyptvalleyclairvoyantcobrasandstormcatapultfalconclairvoyanceswordplayantiquityfire antgrappling hookrubygongsinkholeoasisprecognitionseerflaming swordsoothsayerwrestler as actorarrow in backreference to sodompoisoned arrowarrow catchingarrow in the backgomorrahgomorrahitenear death survivorprequel to sequelacadianarrow in one's backwall of firelima syndrome (See All)

Dragonheart (1996)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Dragonheart (1996)

The young, sickly King Einon was wounded in a battle. In order for him to survive, he is healed by Draco, a dragon. Some years later, Bowen, a dragon slayer, encounters Draco. The two team up to form a traveling duo that perform an act, but the act is only known by themselves. Bowen supposedly "slay β€¦s" Draco and then collects a reward from the town or village that he protects by killing the dragon who had been "terrorizing" them. From there, Bowen and Draco must save the entire kingdom from the rule of the now evil King Einon, who is part of Draco and Draco a part of him. (Read More)

Subgenre:
sword and sorcerymartial artscult filmsword and fantasy
Themes:
couragefriendshipmurderrevengebetrayalfearescapeherodeceptionangerdeath of fathersupernatural powerpovertyhopeblindness β€¦self sacrificenear death experienceunlikely friendship (See All)
Mood:
rain
Locations:
castleenglandvillageforestlakecavecampfire
Characters:
warriorpriestmother son relationshipsoldierchristianitymythical creatureblood lust
Story:
shot with a bow and arrowbow and arrowheld at sword pointhand to hand combatsword fightperson on firebattle axearcherbreadswordsmanarrowmedieval timescrossbowtorchknight β€¦princearsonloss of fatherattackkingdisarming someonestabbed in the cheststabbed to deathgood versus evilcombatshowdownfalling from heightrescueshot in the chesthorsefireknifeexplosiondogone word titlebare chested malesingingchasebattlelieswimmingassassindeath of friendbridgearmyimpalementanti heropaintrainingattempted murdertreestabbed in the backdragonfarmerscarpigmercenarywaterfallpoetqueenchesscivil warspiritflyingspearheavy raintalking animalquesthelmetslaveryloss of friendcaptiveexploding buildingfraudsheeprebellionhonormonkmoralityfemale warriorreverse footageshieldtarget practicestarpartnerresurrectionimmortalitymentorheartdungeonsoulhealingarmorblind maneye patchaxe murdertragic heroshametombschemevikingstandoffcomic reliefselfishnessidealismfortresshired killerfencingnarcissismreluctant heroone linertyrantjudofamous scorepart computer animationwatermelonbowmatricideuprisingoff screen murdersecret passagedeterminationproposallong haired maleextinctionaxe fightoathjudo throwheart transplantfalconstudent teacher relationshipfire breathing dragonking arthurblamefear of flyingvowfake deathimplied rapestomach ripped openchained to a wallcynicrotting corpselegendary heroevil kingconstellationpushed from heightaxe throwingtrucewooden swordbroken promisedeath of kingflying dragonvalorheld at knifepointpower lustlife forcecode of honorkilling a friendwinged dragondragonslayeringenueprison laborchest woundpeasant armydragon featurehuman versus dragonmortal woundtalking dragonhorned helmetfencing lessonavalonhuman dragon relationshipreflection in an eyestalemate900sarrow in the shoulderpeasant revolution (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Season Of The Witch (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Season Of The Witch (2011)

A 14th century Crusader returns to a homeland devastated by the Black Plague. A beleaguered church, deeming sorcery the culprit of the plague, commands the two knights to transport an accused witch to a remote abbey, where monks will perform a ritual in hopes of ending the pestilence. A priest, a gr β€¦ieving knight, a disgraced itinerant and a headstrong youth who can only dream of becoming a knight join a mission troubled by mythically hostile wilderness and fierce contention over the fate of the girl. When the embattled party arrives at the abbey, a horrific discovery jeopardises the knight's pledge to ensure the girl fair treatment, and pits them against an inexplicably powerful and destructive force. (Read More)

Subgenre:
sword and sorcerysuspenseb horrorsword and fantasygothic horror
Themes:
religionherodeception
Locations:
castlechurchcatholic church
Characters:
witchwarriorpriestsoldiertough guycatholic priestself flagellationreligious ritual
Story:
sword duelshot with a bow and arrowbow and arrowstabbed with a swordsword and sandalhand to hand combatsword fightstabbed with a spearbattle axemiddle agesadventure heroswordsmandaggermedieval timesknight β€¦battlefielddisarming someoneambushcombatshowdownswordhorseknifebloodfightblood splatterbattlekissingdemonprayerfightingmassacremapfictional warritualconfessioncursehangingwolfcrucifixwitchcraftmonkanimal attackshieldbelief in godsnowingmonasterywoman cryingplaguedisillusionmentinfantrymass gravecavalrymaceaxe fightshacklescardinal the priestlord's prayertelling a jokebattering ramrope bridgebelief in hellexecution by hangingrotting corpse14th centurypossessed girlcrusadercrusade1300sbegging for mercybelief in witchessuspected witch (See All)

The Legend Of Hercules (2014)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Legend Of Hercules (2014)

In Ancient Greece 1200 B.C., a queen succumbs to the lust of Zeus to bear a son promised to overthrow the tyrannical rule of the king and restore peace to a land in hardship. But this prince, Hercules, knows nothing of his real identity or his destiny. He desires only one thing: the love of Hebe, Pr β€¦incess of Crete, who has been promised to his own brother. When Hercules learns of his greater purpose, he must choose: to flee with his true love or to fulfill his destiny and become the true hero of his time. The story behind one of the greatest myths is revealed in this action-packed epic - a tale of love, sacrifice and the strength of the human spirit. (Read More)

Subgenre:
martial artsconspiracychrist allegory
Themes:
torturemurderdeathrevengesuicidebetrayalescapedeceptionsupernatural powerdeath of motherunrequited lovehopemythologygreek mythology
Locations:
castlevillageforestdesertwoodsshipcavecampfire
Characters:
action herowarriorhusband wife relationshipfather son relationshipmother son relationshipbrother brother relationshipteachersoldierhostagetough guy
Story:
sword duelflaming arrowbow and arrowsword and sandalhand to hand combatsword fightknife throwingforced marriagearcherstabbed in the legcrossbowprincebattlefieldkicked in the facestatue β€¦kingstabbed in the cheststabbed to deathambushgood versus evilshot in the backcombatshowdownfalling from heightswordshot in the headshot in the chesthorsefistfightfireknifeexplosioncharacter name in titlebloodviolencebare chested malefightchasesurprise endingbeatingshot to deathslow motion scenepunched in the facewritten by directorbattlebrawldecapitationaxedeath of friendthroat slittingarmyimpalementmixed martial artssevered headno opening creditsone man armyshot in the legprincessskinny dippingattempted murderone against manycharacter repeating someone else's dialoguebeaten to deathstabbed in the backelectrocutionlightningopening action sceneshot in the shoulderhorse ridingneck breakingthreatened with a knifemercenarywaterfallshot in the armwhippingbare chested male bondagequeenstylized violencecaptainspearheavy rainhelmetslaverykicked in the stomachjumping from heightrebellionforbidden loveanimal attackslavefull moonshieldfight to the deathdual wieldstabbed in the throatwhip3 dimensionalegyptpunched in the chestliondungeonrainstormpalacesuper strengthstabbed in the armcommandercheering crowdarenagoddessstabbed in the shoulderbettinggladiatorwarlordshot in the crotchanimal killingrock climbinghusband murders wifeman hits a womanbeefcakeancient greecestabbed in the footorigin of herotyrannybare knuckle fightingspear throwingdeus ex machinahanged by the neckconquestherculeschariotvirtual setdemi godtunicamphitheaterbound in chainsreference to zeusflaming swordbranding ironcliff divingafrican lionfemale gladiatorgolden eagleblood sportarmy on the march (See All)

Assassin's Creed (2016) is one of the best movies like Robin Hood: Prince Of Thieves (1991)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Assassin's Creed (2016)

Through a revolutionary technology that unlocks his genetic memories, Callum Lynch (Michael Fassbender) experiences the adventures of his ancestor, Aguilar de Nerha, in 15th Century Spain. Callum discovers he is descended from a mysterious secret society, the Assassins, and amasses incredible knowle β€¦dge and skills to take on the oppressive and powerful Templar organization in the present day. (Read More)

Subgenre:
martial artssuspenseconspiracycyberpunkscience fantasy
Themes:
couragemurderdeathrevengesurrealismkidnappingbetrayalprisonfearescapedeceptionmemoryangerdeath of fatherdeath of mother β€¦paranoiatime travelredemptionguiltsurveillanceexecutionexploitationpanicregret (See All)
Locations:
villagechurchhelicopterdesertlondon englandbicycleelevatorshiprooftoptexaslaboratoryspainrooftop chase
Characters:
action herowarriorpriestfather son relationshipmother son relationshipfather daughter relationshipdoctortattoosoldierhostagetough guysecurity guardamerican abroadself mutilationbabe scientist
Period:
1980s2010syear 198615th century
Story:
flaming arrowshot with an arrowbow and arrowhorse chasehand to hand combatsword fightknife throwingarchercrashing through a windowarcherydaggerstabbed in the legcrossbowtorchknight β€¦stabbed in the stomachprincebattlefieldloss of fatherkicked in the faceattackdangerstabbed in the cheststabbed to deathambushgood versus evilshot in the backcombatswordrescueshot in the headshot in the chesthorsefistfightfireknifeexplosionbloodviolenceflashbackbare chested malefightphotographtitle spoken by charactersingingchasesurprise endingpunctuation in titlecorpseshot to deathmachine gunslow motion scenepunched in the facecomputerbattlebrawlpaintingbombapostrophe in titlehallucinationcriminalscientistsubjective camerafoot chaseassassinstrangulationaxemassacrebasketballthroat slittingarmyimpalementmixed martial artsprisonerweaponno opening creditsanti heroassassinationdrawingchild in perilfictional wardouble crossritualshot in the leglatex glovestrainingflash forwardone against manycharacter repeating someone else's dialoguestabbed in the backprologueelectrocutioncharacter's point of view camera shotmissionrace against timecover upknocked outtough girlmanipulationscarinjectionneck breakingtied upthreatened with a knifemercenaryloss of mothershot in the armsubtitled scenepowerstylized violencehenchmanchessrioteavesdroppingropedestinygrenaderevelationspearhypodermic needlehelmetsecurity camerajail cellkicked in the stomachcaucasianjumping from heightvirtual realityfaked deathart galleryfateaction heroinefemale killersocial commentaryapplefemale warriorshieldhaunted by the pastprison guardbraverystabbed in the throatbased on video gamestabbed in the neckescape attemptoilbible quotepunched in the chestdark heroaerial shotknife fightconvictdark pastcorporationrescue missionnewspaper clippingsouthern accentfemale assassinhistorical fictionfemale fighterparkourworld dominationsecret societyyoung version of charactertrailer homestabbed in the armemperordeath rowartifactcolonialismman kills a womantrailer parkmacguffinpalm treeeaglewoman kills a manfight the systemmadrid spaincathedralmetal detectorhigh techbladerepeated linegeneticstragic pastwoman fights a manwarlordceoreference to adam and eveprison wardenhusband murders wiferelicarmoryevil corporationx rayed skeletonsinistercrypttotalitarianismdeoxyribonucleic acidhorse drawn carriagejumping from a rooftopmegacorporationaxe fighthooded figuresecret organizationwoman punches a mannightstickancestorvisionarybatontranquilizer dartreference to the bibledartlethal injectionpseudo sciencesultanenforcerspear throwingpublic executionchariotinitiation ritevirtualityfree willdisobediencefree fallbaja californiafree runningresearch facilitydescendantknights templartunictranquilizer guncutlassspanish inquisitionchristopher columbusknife in shoedeath row inmatehidden weaponfight with selfreference to marie curiestrapped to a chair1490syear 1492father son reunited (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Conan The Destroyer (1984)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Conan The Destroyer (1984)

The wandering barbarian, Conan, alongside his goofy rogue pal, Malak, are tasked with escorting Queen Taramis' virgin niece, Princess Jehnna and her bodyguard, Bombaata, to a mystical island fortress. They must retrieve a magical crystal that will help them procure the horn that legends say can awak β€¦en the god of dreams, Dagoth. Along the way, Conan reunites with the wise wizard, Akiro and befriends the fierce female fighter, Zula. Together the heroes face ancient traps, powerful Wizards, plots of betrayal, and even the dream god, Dagoth, himself! (Read More)

Subgenre:
sword and sorceryindependent filmmartial artscult filmdark fantasyalternate historysword and fantasy
Themes:
murdermonsterherowrestling
Locations:
castledesert
Characters:
action herowarriorthieftough guyaunt niece relationship
Period:
1980s20th centuryyear 1984
Story:
sword duelsword and sandalhorse chasehand to hand combatsword fightknife throwingstabbed with a spearadventure herobarbarianswordsmanstick fightdaggerhit in the crotchguardstabbed in the stomach β€¦battlefieldstatuedisarming someonestabbed in the chestambushcombatshowdownrescuehorsefistfightcharacter name in titlebloodviolencesequelbare chested malebeatingblood splattermirrorblondepunched in the facebrawlname in titlethroat slittingmixed martial artssevered headcultanti heroone man armyprincesstransformationvirginkeyopening action scenewaterfallqueendestinyhead buttspearmagiciankicked in the stomachback from the deadchokingfemale warriorreverse footagedual wieldwizardkingdommutationsequel to cult favoritecamelspittingkendohuman sacrificesword fightingprehistoric timeschosen onestaffbeefcakekicked in the groinsevered earaxe fighthornbreaking glasslast of seriesgodsasian manstone agespear throwingrenegadejapanese manfoolflying kickscratchchoke holdtwentieth centuryaxe throwingstatue comes to lifehall of mirrorsvirgin sacrificerobert e. howardbased on pulp magazinestabbed with knifeenchanted forestplainsfalse promisescratching someone's facepaleolithic agebody slamstabbed with a stickman versus beastwizards' duel10000 b.c.100th century b.c.grabhyborian agebear hugbloody scratches (See All)

Centurion (2010)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Centurion (2010)

Britain, A.D. 117. Quintus Dias, the sole survivor of a Pictish raid on a Roman frontier fort, marches north with General Virilus' legendary Ninth Legion, under orders to wipe the Picts from the face of the Earth and destroy their leader, Gorlacon.

Themes:
torturemurderrevengekidnappingbetrayaldrunkennessescapefuneraldeceptionself sacrificehunting
Mood:
gorenightmare
Locations:
villageforestsnowwoodscavecampfire
Characters:
witchwarriorfather son relationshiptattoosoldierhostageself mutilation
Story:
flaming arrowshot with an arrowbow and arrowsword and shieldsword and sandalhand to hand combatsword fightstabbed with a spearbattle axefacial scararcherarrowraidstabbed in the legtorch β€¦stabbed in the stomachkicked in the faceattackdangerkingstabbed in the cheststabbed to deathstabbingambushshot in the backcombatrivershowdownfalling from heightswordshot in the headshot in the chesthorsefireknifedogbloodviolenceone word titlebare chested malefighttitle spoken by characterchasesurprise endingvoice over narrationcorpseshot to deathblood splatterurinationslow motion scenepunched in the facebattlebrawlrunningf worddecapitationsurvivalwinestrangulationaxemassacremountaindeath of friendthroat slittingarmyimpalementfishnonlinear timelinefalse accusationsevered headanti herochild in perildouble crossfemme fataleshot in the legon the runattempted murderstabbed in the backprologuescreamingfugitivepoisontentdeath of childlightningshot in the shoulderscardeath of sonhorse ridingtrapwaterfallgeneralsubtitled scenechild murdertraitorwolffireplacekilling an animalwhat happened to epiloguehead buttspearassassination attempthelmetrome italylifting someone into the aircookhunterhidingnosebleedcampjumping from heightsevered handcovered in bloodhonoranimal attackbar fightbroken legeaten alivefemale warriorfull moonreverse footageshieldface paintteamfight to the deathresistancestabbed in the throatscotlandmanhuntgash in the facestabbed in the neckmuteshot in the facestabbed in the headexploding headdisembowelmentbooby trapeye gougingdeerarmorclifftribestabbed in the eyebody countaxe murderrescue missionsevered legcharacters killed one by oneburned to deathsuffocationnarrated by characterstabbed in the handset upgreekcremationshot in the neckfemale fighterfireballtombstonegovernorstabbed in the armslashingemperorcommandershot in the eyetavernfilm starts with textbehind enemy linesblizzardman kills a womanoffscreen killingmushroombritainhead cut offslingshotstabbed in the shoulderbleeding to deathshot through the mouthsole black character dies clicheshot in the throattreacherybladecamouflagerepeated lineancient romestabbed in the facearm wrestlingsole survivorcoughing bloodarmy basevalleygreat britainfortthroat cutscottish accentstarts with narrationstrong mandutch anglescrollstabbed in the mouthbegins with texthuthands tiedfalling off a cliffaxe in the headroman empiredrinking bloodmessengerrescue attemptstabbed in the sidemale camaraderiemass killingromanguerilla warfarebodily dismembermentpunched in the crotchdefectorfuneral pyreromatrackerscoutwood carvingsurprise attackscreaming in painshot in the kneestabbed in the crotchman huntoutpostdeath by impalemententrailsriver rapidstrackinglegionwar woundstabbed through the cheststomach ripped openroman soldierwar paintarrow in chestcarvinghead held underwaterleg cut offguerrilla warfarevengencewarrior raceashaxe in the chesthead on a stakepoisoned drinkaxe throwinghead split in halftunicbound in chainstooth knocked outyorkface paintingbegins with historical notescenturionmute womanflipping a coinroman legioncliff divingjumping into a riverrunning into a treewoman warriorstabbed through the mouthanimal carcassprimal screamgolden eagle2nd centuryjumping off clifftauntroman armyhiding under floorboardsstabbed through the backtreating a woundcatching fish by handchild with a knifearmy on the marchhadrian's wallimpaled on a spearthrowing an axe (See All)

The Great Wall (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Great Wall (2016)

When a mercenary warrior (Matt Damon) is imprisoned within the Great Wall, he discovers the mystery behind one of the greatest wonders of the world. As wave after wave of marauding beasts besiege the massive structure, his quest for fortune turns into a journey toward heroism as he joins a huge army β€¦ of elite warriors to confront the unimaginable and seemingly unstoppable force. (Read More)

Subgenre:
heistfish out of watercreature featureperiod dramaperiod piecedark fantasyalternate historysword and fantasymonster movielive action and animation
Themes:
couragerobberyfriendshipmurderdeathsurrealismbetrayalprisonfearescapefuneralmonsterdeceptionparanoiaredemption β€¦greedpanicself sacrificenear death experience (See All)
Mood:
poetic justice
Locations:
churchdesertrooftopcavechinacampfiretunnelsewer
Characters:
action herowarriorthiefteachersoldiertough guyinterracial relationshipchinesealien monster
Period:
15th centuryzip line
Story:
shot with an arrowbow and arrowhorse chasegunpowdermedallionmiddle agesarchercrashing through a windowarcherysiegemedieval timescrossbowguardtorchbattlefield β€¦statueattackdangerdisarming someonestabbed to deathambushgood versus evilcombatshowdownfalling from heightswordrescueshot in the chesthorsefireknifeexplosionviolencechasethree word titlesurprise endingcorpseblood splatterslow motion scenebattlearrestbombdecapitationorphanbound and gaggedaxemassacremountainarmyimpalementprisonermapsevered headno opening creditsanti herofictional wardouble crosscontroversycreatureshot in the legcharacter repeating someone else's dialogueknocked outopening action sceneexploding bodysuspicionthreatened with a knifemercenarysevered armgeneralqueensubtitled scenetruststylized violenceshavinggrenadedestructionburned alivespearcagehelmetjail cellcaptivetemplebeardjumping from heightsevered handirishculture clashhonorcannoneaten aliverampageshieldtarget practiceexplosivebraveryinvasiondual wieldanimated sequencepartner3 dimensionalchaosevacuationescape attempt3ddark herodynamiteaerial shotdungeoncapturetribestabbed in the eyedark pastkingdomtragic heroburned to deathpalacebullet timeimprisonmentrockettorso cut in halfheroismbanditfemale soldiertranslatorblood on camera lensflaghistorical fictionfinal showdowntowergiant monsterfireballstonetwo man armywallemperorcommanderdrumfilm starts with textcrash landingoffscreen killingmacguffinpotionmale protagonistacrobatfinal battlegurneybritish soldiermeteorhot air balloontragic pastdistrustpsychotronic filmcavalrybanquetarmoryacrobaticsthronealien creaturenomadscrollhands tiedsuit of armorspaniardstudio logo segues into filmkaijumagnetnunchucksharpoongiant creaturecatapultcouncilcaught in a netstampedespear throwinggreen bloodspear gunbowlswarmancient chinabackflipgreat wall of chinacannonballstore roomdining roombungee jumpchinese armyaxe throwinghordeman with a ponytailtunic11th centuryburning bodyengine roomsecret military operationstabbed through the mouthhiveopening creditsenvoygreat wallwhite saviorchinese lanternwall of firesleeping potion (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Kingdom Of Heaven (2005) is one of the best movies like Robin Hood: Prince Of Thieves (1991)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Kingdom Of Heaven (2005)

It is the time of the Crusades during the Middle Ages - the world shaping 200-year collision between Europe and the East. A blacksmith named Balian has lost his family and nearly his faith. The religious wars raging in the far-off Holy Land seem remote to him, yet he is pulled into that immense dram β€¦a. Amid the pageantry and intrigues of medieval Jerusalem he falls in love, grows into a leader, and ultimately uses all his courage and skill to defend the city against staggering odds. Destiny comes seeking Balian in the form of a great knight, Godfrey of Ibelin, a Crusader briefly home to France from fighting in the East. Revealing himself as Balian's father, Godfrey shows him the true meaning of knighthood and takes him on a journey across continents to the fabled Holy City. In Jerusalem at that moment--between the Second and Third Crusades--a fragile peace prevails, through the efforts of its enlightened Christian king, Baldwin IV, aided by his advisor Tiberias, and the military restraint of the legendary Muslim leader Saladin Ayubi . But Baldwin's days are numbered, and strains of fanaticism, greed, and jealousy among the Crusaders threaten to shatter the truce. King Baldwin's vision of peace--a kingdom of heaven--is shared by a handful of knights, including Godfrey of Ibelin, who swear to uphold it with their lives and honor. As Godfrey passes his sword to his son, he also passes on that sacred oath: to protect the helpless, safeguard the peace, and work toward harmony betwe… (Read More)

Subgenre:
epic
Themes:
couragemurderdeathlovesuicidemarriageinfidelityreligionadulterymilitarycorruptionself sacrificereligious conflict
Mood:
gore
Locations:
castledesertitalyfranceisraelwalled city
Characters:
warriorpriestfather son relationshipbrother sister relationshipsoldierchristianchristianitymuslimfrench
Story:
flaming arrowbow and arrowsword and shieldsword and sandalcorrupt priesthand to hand combatsword fightperson on fire1100spublic hanging12th centurycrusadesbattle axemiddle agesarchery β€¦jerusalemarrowsiegemedieval timesstabbed in the legknightstabbed in the stomachloss of fatherpassionkingstabbed in the chestshot in the backfalling from heightswordshot in the headface slapshot in the chestfirebloodviolencesex scenetitle spoken by charactercorpseshot to deathblood splatterbattleprayerdecapitationmassacrethroat slittingarmyimpalementsevered headno opening creditsritualstabbed in the backcrossqueenchesstraditionburned alivespearislamcrucifixloss of wifehonorsocial commentaryshieldmiddle eastbraveryarranged marriageloss of sonstabbed in the throathatredstabbed in the headarabarmorstabbed in the eyewilhelm screamloss of brothercamelheroismpalestineunhappy marriageanti warabuse of powershipwrecktreasonwellfortressshot in the eyeloss of childshot in the throattolerancedisfigured facecaravanbowriteblacksmithdeformitysailing shipgrave diggingcustommaceship wreckcatapultpacifistloss of faithsultanpilgrimpublic executionestranged parentleprosymegalomaniacrusaderhead on a stakelepercitadelholy landdeformed manholy warvisceralveiled womanboiling oilsaracenmessina italy (See All)

47 Ronin (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

47 Ronin (2013)

While hunting in the forest, Lord Asano of Ako and his samurai find a young half-breed and take him with them to live in the castle. Several years later, Lord Asano holds a tournament to welcome the Shogun to Ako. The night after the tournament, Lord Asano is bewitched into hurting Lord Kira of Naga β€¦to, and is punished into committing seppuku by the Shogun. Realizing that it was a Lord Kira's evil plot, the samurais and the half-breed sets out for revenge against the Shogun's order. (Read More)

Subgenre:
sword and sorceryconspiracytragedyepicdark fantasysword and fantasy
Themes:
magicweddingmurderdeathrevengesurrealismsuicidekidnappingghostescapemonsterdeceptiondeath of fathersupernatural powerredemption β€¦unrequited lovesamurairitual suicide (See All)
Locations:
castlevillageforestsnowcemeterywoodsjapanlakeshipcampfire
Characters:
witchaction herowarriorhusband wife relationshipfather son relationshipfather daughter relationshipsoldierhostagetough guyteacher student relationshipself mutilationsamurai swordhuman versus monstersamurai warriorhunting party
Story:
sword duelshot with an arrowbow and arrowsword fightperson on firegunpowderforced marriagearcherhorseback ridingcrossbowguardbattlefieldloss of fatherattackstabbed in the chest β€¦stabbed to deathambushshot in the backcombatshowdownswordrescueshot in the headshot in the chesthorsefireknifeexplosionnumber in titlebloodviolenceflashbackbare chested maletitle spoken by characterchasesurprise endingbased on true storybeatingcorpsedigit in titleshot to deathblood splatterbattledemondecapitationfoot chaseorphancandleaxemassacremountaindisguisethroat slittingarmyimpalementmapfalse accusationsevered headno opening creditsritualcreatureshot in the legnecklacelegendstabbed in the backprologuepoisondragonmanipulationexploding bodyneck breakingtrapdirectorial debutshot in the armbare chested male bondagestylized violenceburned alivespearheavy raintempleexploding buildingwitchcraftspidervillainessgiantforbidden lovecgihonortournamentburialslavepresumed deadarranged marriagefight to the deathstabbed in the throat3 dimensionalshot in the facestabbed in the headmentorexiledark heromeditationsnowingtragic heroburned to deathimprisonmentbeheadingillusionhistorical fictionstabbed in the handoutcastmysticismfoxgiant monstertemptationtombstonefarmhouseyoung version of characterstabbed in the armdrumbeastfortressfilm starts with textman kills a womanhead cut offmusketshape shiftercorrupt officialtragic endingshapeshiftingsubterraneanshrinesorceressanimal killingarmorypitmagic spelltitle spoken by narratorends with texthorse drawn carriagescrollbanishmenthutsuper speedstabbed in the footchopsticksfire breathingstudio logo segues into filmman wearing a wigjapanese culturetyrannyoil lampopening narrationjidai gekigiant creaturebare knuckle fightingmagical swordfire breathing dragontroubled productionwuxia fictionbased on legendbegins with narrationcheeringfeudal japanhalf breedhara kiristabbed through the chinroninshogunslow motion sequencebowingmagical creatureseppukuwooden sworddishonoreyes different colorhyper speedcode of honorcommitting suicidescarsball and chainone year later1 year laterbokkenhuman versus dragonsamurai erainjured manbow the weaponasian dragonsamurai armourwooden bridgebathing in a streamfilm ends with texthonorable deathsold into slavery (See All)

Tristan + Isolde (2006)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Tristan + Isolde (2006)

An affair between the second in line to Britain's throne and the princess of the feuding Irish spells doom for the young lovers.

Subgenre:
tragedy
Themes:
weddingmurderdeathrevengemarriageinfidelityrapebetrayaladulteryescapedancefuneralextramarital affairdeath of fatherbrutality β€¦death of motherguiltunfaithfulnessrivalrygreeddeath of wifehuntingmurder of family (See All)
Mood:
rainnightmare
Locations:
castlevillageforestbeachchurchboatwoodsseatunnelboat on fire
Characters:
warriorpriestfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipboybrother sister relationshipgirlsoldierdancerlove trianglelust
Story:
flaming arrowbow and arrowsword and shieldsword and sandalhand to hand combatsword fightman on firebattle axehorseback ridingdaggermedieval timesrowboatknightbattlefieldpassion β€¦attackkingambushcombatriverswordhorsefirefemale nuditymale nuditycharacter name in titlebloodviolencebare chested malekissfightdancingthree word titlepunctuation in titlewoman on topdreamblondebattlelierunningdecapitationorphandisguisemontagemapsevered headprincessflash forwardlegendliarpoisonrabbitbracelethangingdeath of husbandirelandlove interestkissing while having sexbare chested male bondagequeenpowerchild murdertraitorwounddemonstrationhuntersevered handirishforbidden lovehonorback from the deadambitionstabbed in the throatkickingmercilessnesskicked in the crotchcapturetribepassionate kissaxe murderkingdomhistorical fictionbandagewar violencetowerblonde womansailboatcrowndisembodied headstar crossed loverstragic lovemilitary traininganguishtrapdoorhorse and wagonrise and fallthroneblasphemydying wordscryptmedievalchantingstreet vendorantidotefeastaxe fightlong blonde hairlordbaronfuneral pyrecoronationruinhanged boypageantcornwallhand chopped offspit in facedrawbridgeelixirlong sworddark agesjoustingtreatythrown from a horseyorkpyrerebuildingplus sign in titlefuneral cortegeceltlutesaxonhuman in a cagebetrothaldeath of queenpuffer fish6th centurythought deadunderground passagewaybritanniaviking funeralsword woundburning a corpsenursing someone back to healthburned out houseroman ruin (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Hobbit: The Battle Of The Five Armies (2014)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Hobbit: The Battle Of The Five Armies (2014)

After the Dragon leaves the Lonely Mountain, the people of Lake-town see a threat coming. Orcs, dwarves, elves and people prepare for war. Bilbo sees Thorin going mad and tries to help. Meanwhile, Gandalf is rescued from the Necromancer's prison and his rescuers realize who the Necromancer is.

Subgenre:
sword and sorcerymartial artsepicsword and fantasyhigh fantasy
Themes:
murderdeathloverevengebetrayalghostescapedeceptionobsessioninsanitygreedself sacrifice
Mood:
poetic justice
Locations:
castleforestsnowboatdesertcavewalled city
Characters:
action herowarriorfather son relationshipfather daughter relationshipbrother brother relationshipbrother sister relationshipsoldiertough guymayor
Story:
bow and arrowhand to hand combatsword fightperson on fireballadeercousinfriends who live togetherarcherarcherystabbed in the legknightgoldbattlefielddeath of brotherstatue β€¦kingstabbed in the cheststabbed to deathambushgood versus evilshot in the backcombatshowdownfalling from heightswordrescueshot in the headshot in the chesthorsefireknifeexplosiondogbased on novelviolencesequelflashbackfightsurprise endingcorpseshot to deathslow motion scenepunched in the facebattledead bodydemonhallucinationdecapitationsurvivalaxemountaindeath of friendthroat slittingbridgearmymapsevered headno opening creditschild in perilfictional warcreaturethird partnecklacedrowningstabbed in the backfantasy sequencedragontentknocked outrabbittough girlopening action sceneringpigmercenarysevered armbearrefugeesubtitled scenestylized violencecivil wariceropedestinydestructionhead buttspearcagehelmetloss of friendloss of loved onetreasurehammercrying womanblockbustergiantjumping from heightpart of trilogyfaked deathforbidden lovehonorburialaction heroineanimal attackgoatcrushed to deathpresumed deadfemale warriorbarefootdwarfshielddual wieldstabbed in the throat3 dimensionalchaosevacuationfalling to deathwizardstabbed in the headsexy womandeath of loved oneloss of brothermoral dilemmaprequelpipe smokingauctionbatelfinvisibilityanti warreturning character killed offruinsapparitionwoman cryingfemale fightertoweramputeecrownstabbed in the armeaglewoman kills a mangoblinstabbed in the shoulderfinal battlecowardraveneight word titleshape shifterstabbed in the facecorrupt officialexploding housewoman fights a manshapeshiftinghit with a hammersorceressinfantryjewelcockney accentanimal killingarmorytear on cheekcity hallepic battlescottish accentadaptationbanishmentgold coinjail breaksuit of armorfranchisestabbed in the footarsenalliterary adaptationsecret passagewayhidden doorgiant creaturecatapultanti villainman dressed as a womanmultiple cameosoutnumberedfalling through icebridge collapsebell towerelkorchobbitmiddle earthacorngiant wormtunicgemstonescepterprequel and sequelgiant birdhogsinger offscreenminstrelrock throwinglive action remakebare foot womansmoking a pipecollapsing bridgefemale archergiant batpeace negotiationgold ringstone bridgewhite magicblack bloodpile of goldarmy on the march (See All)

The Magnificent Seven (2016) is one of the best movies like Robin Hood: Prince Of Thieves (1991)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Magnificent Seven (2016)

Director Antoine Fuqua brings his modern vision to a classic story in The Magnificent Seven. With the town of Rose Creek under the deadly control of industrialist Bartholomew Bogue, the desperate townspeople employ protection from seven outlaws, bounty hunters, gamblers and hired guns. As they prepa β€¦re the town for the violent showdown that they know is coming, these seven mercenaries find themselves fighting for more than money. (Read More)

Subgenre:
black comedychrist allegory
Themes:
couragemurderfriendshipdeathrevengebetrayaldrunkennessescapedeceptioncorruptionbrutalitygamblingself sacrificemurder of a police officernear death experience
Mood:
poetic justice
Locations:
forestbarchurchcemeterysmall towndesertwoodsfarmcampfirecanyon
Characters:
action herowarriorhusband wife relationshipafrican americantattooprostitutetough guynative americanalcoholicsnipersheriffasian americanex soldier
Period:
19th century
Story:
flaming arrowshot with an arrowbow and arrowhorse chaseperson on fireknife throwingarcherarcherystabbed in the legoutlawtorchgoldbattlefieldarsonduel β€¦disarming someonestabbed in the cheststabbed to deathambushgood versus evilshot in the backcombatshowdownfalling from heightrescueshot in the headshot in the chesthorsefireknifeexplosionnumber in titlebloodviolencecigarette smokingpistolvoice over narrationshootoutcorpseshot to deathblood splatterremakeshotgunslow motion scenebattlerifleheld at gunpointinterrogationrevolvercriminalassassincaliforniastrangulationaxemassacremansiondeath of friendmontagearmyimpalementanti herocoffinchild in perilpolice officer killedcigar smokingshot in the legshot in the foreheadbartenderracial sluron the runtrainingone against manygravecharacter repeating someone else's dialoguestabbed in the backprologuecowboyfugitivetentevil manfarmershot in the shoulderscarexploding bodydeath of husbandhorse ridingdie hard scenariothreatened with a knifemercenaryshot in the armsubtitled scenecorrupt cophenchmanfalling down stairscard gamekilling an animalrevelationsociopathscene during opening creditscowboy hatjumping from heightirishhonorgoatinterracial friendshippreachermexicanthughaunted by the pastface painttarget practicebraveryfight to the deathdual wieldmercilessnesschaosevacuationpost traumatic stress disorderpolice officer shotensemble castdark herodynamitethrown through a windowbooby trapaerial shotknife fightwisecrack humortitle at the endbounty hunterminedark pasteye patchlens flareethnic slurcellardeath of loved onegatling gunshot multiple timessouthern accentclose up of eyesheroismshot through a windowmagic trickgamblerfinal showdownpistol whipquick drawstandoffgunslingerhired killershot in the eyesaloonsawed off shotguncabin in the woodsshot in the handfinal battleteamworkminershot in the throatbadgeshot in the footscarfrighteous ragereference to abraham lincolnsix shooterwanted posterbarbershopgunfighterkicking in a doortycoonknocked out with a gun buttbilingualisminnocent person killedhostile takeovertrenchlast standchurch bellcowardiceindustrialistknife in the chestcard trickhidden gunhorse drawn carriageaxe fightwestern townsharpshooterbaronone eyed manshot through a wallcamaraderieguerilla warfaretrackerabandoned mineenforcertomahawkblack herobell towermining townshot in the earspyglassabandoned churchapacheburial groundsacramento californiaevil businessmantrip wirecivil war veteranaxe throwingremake of remakelong range rifleyear 1879comanchecomanche indianreference to john d. rockefeller (See All)

Red Sonja (1985)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Red Sonja (1985)

The tyrant Gedren seeks the total power in a world of barbarism. She attacks and kills the keepers of a powerful talisman just before it is destroyed. Gedren then uses the power of the talisman in her raid of the city Hablac. Red Sonja, sister of the keeper, sets out with her magic sword to overthro β€¦w Gedren. The talisman's master Kalidor follows to protect her. Of course they fall in love - however Red Sonja's power bases on the oath to never give herself to any man... (Read More)

Subgenre:
sword and sorceryswashbucklermartial artscult filmalternate historysword and fantasy
Themes:
magicrapewrestling
Locations:
castlesea monster
Characters:
action herowarriorfemale protagonisttough guy
Story:
sword duelbow and arrowhand to hand combatsword fightbattle axeadventure herobarbarianswordsmansiegeraidcrossbowguardbattlefielddueldisarming someone β€¦stabbed in the chestcleavagecombatshowdownswordhorsefemale nuditycharacter name in titlebloodviolencebare chested malekissfightblood splatterblondebattlemaskfightingdecapitationwomanmixed martial artsfictional wartough girlscarunderwatersevered armdismembermentspearlifting someone into the airvillainessaction heroinecrushed to deathfemale warriorpsychotronicteleportationbeheadingkendomusclemanstrongmanstandoffredheaded womanfencinggirl powerprehistoric timeslesbian subtextgiant spiderkiller robottalismanstone agenipple sliphyborian agelava stream (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

300: Rise Of An Empire (2014)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

300: Rise Of An Empire (2014)

After its victory over Leonidas' 300, the Persian Army under the command of Xerxes marches towards the major Greek city-states. The Democratic city of Athens, first on the path of Xerxes' army, bases its strength on its fleet, led by admiral Themistocles. Themistocles is forced to an unwilling allia β€¦nce with the traditional rival of Athens, oligarchic Sparta whose might lies with its superior infantry troops. But Xerxes still reigns supreme in numbers over sea and land. (Read More)

Subgenre:
epic
Themes:
murderdeathrevengerapebetrayalpoliticsdeceptiondeath of fatherbrutalityredemptionsadismexecution
Mood:
gore
Locations:
beachboatdesertseashipcaveoceanstorm at seasea battlewalled cityship fire
Characters:
action herowarriorpriestfather son relationshipsoldiertough guy
Story:
flaming arrowshot with an arrowbow and arrowsword and sandalhand to hand combatsword fightperson on fireknife throwingarcherdaggerstabbed in the legguardtorchbattlefieldkicked in the face β€¦kingstabbed in the cheststabbed to deathambushgood versus evilshot in the backcombatshowdownfalling from heightswordrescueshot in the headshot in the chesthorsefistfightfireknifeexplosionmale rear nuditydognumber in titlebloodviolencebare breastssequelfemale frontal nudityflashbackbare chested malesex scenefemale rear nuditynipplessurprise endingtopless female nudityvoice over narrationwoman on topbeatingcorpsedigit in titleshot to deathblood splatterslow motion scenepunched in the facebattlebrawlsecond partdecapitationspyorphantoplessmassacredeath of friendmontagethroat slittingarmyimpalementnonlinear timelinechild abusesevered headno opening creditsanti herounderwater scenefemme fataleshot in the legdrowningtransformationtrainingstabbed in the backmoaningtenttough girllightningskeletonfarmershot in the shoulderlong takemanipulationscarexploding bodyneck breakingthreatened with a knifesevered armgeneralwhippingqueenstylized violencetopless womancivil warmachismotraitordestinyburned alivespearheavy rainshot in the stomachhelmetelephantvillainessjumping from heightskullrape victimaction heroinecrushed to deathmasked manslavefemale warriorshieldfloodface painttarget practiceinvasiondual wieldstabbed in the throat3 dimensionalstabbed in the neckgreecenipplewizardprophecystabbed in the headmentoroilsenatorrainstormeye gougingstabbed in the eyeaxe murdersevered legprequelpalacecrowfemale soldierblood on camera lenshistorical fictiongreeksex slavestandoffyoung version of charactercommandernavycornfieldbased on graphic novelman punching a womanswimming underwatercrushed headcowgirl sex positionaltered version of studio logoopen endedexploding shipbreastwarlorddeformitychild rapearmy baseathens greecethronesex from behindman slaps a womanburning buildinghunchbackstarts with narrationwoman moaning from pleasurewoman moaningancient greecemoaning womanmessengerman fights a womandefectorfuneral pyrekicked in the chesttidal wavestabbed in the crotchantiquityspear throwingsinking shipnaval battlevirtual setdark horse comicsmeleetunicbound in chainsarmadadoggie style sex positionwar roomsex against the wallsea serpentmultiple sex positionssex against a wall5th century b.c.hell hound (See All)

Pride And Prejudice And Zombies (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Pride And Prejudice And Zombies (2016)

The five highly trained Bennett sisters in Georgian England must try to protect themselves from the growing zombie threat, find suitable husbands for themselves, battle marriage proposals and unlikely suitors, and save the country before it's too late.

Subgenre:
independent filmmartial artsblack comedymelodramadystopiaalternate historyzombie apocalypse
Themes:
courageweddingfriendshipmurderdeathrevengekidnappingmarriagebetrayalfeardrunkennessescapedancedeceptionincest β€¦militarytravelbrutalityparanoiaredemptionillnessunrequited lovehopeapocalypsecannibalismprejudicewealthnear death experience (See All)
Mood:
gorerainominous ending
Locations:
englandvillageforestcemeterylondon englandwoodsrooftopwalled city
Characters:
cousin cousin relationshipaction herowarriorpriestfamily relationshipsfather daughter relationshipmother daughter relationshipfriendbrother sister relationshipfemale protagonistzombiesoldierhostagesister sister relationshiptough guy β€¦love triangleaunt niece relationshipaunt nephew relationship (See All)
Period:
19th century
Story:
sword duelhand to hand combatsword fightknife throwingman murders a womanswordsmanhit in the crotchguardrebelbattlefieldattackdangerdisarming someonestabbed in the cheststabbed to death β€¦ambushgood versus evilcombatshowdownletterfalling from heightswordrescuehorsefistfightfireknifeexplosiondogbased on novelbloodviolenceflashbackgunkissfightdancingpartychasesurprise endingpistolvoice over narrationbeatingcorpseblood splatterslow motion scenepunched in the facewritten by directorbattlebrawlpaintingrifleheld at gunpointhallucinationbritishkung fusubjective cameradecapitationsurvivalaxemassacremansionthroat slittingbridgeimpalementmixed martial artssevered headanti heroone man armyfictional wardouble crossmarriage proposaltransformationtraininglibrarystabbed in the backprologuecharacter's point of view camera shotrace against timetentknocked outtough girllightningscene during end creditslong takescarbodyguardexploding bodypigthreatened with a knifesevered armclass differencesdismembermentsubtitled scenestylized violencestrong female charactereavesdroppingtraitorcaptaincard gamemartial arts mastergrenadeburned aliverevelationspearheavy rainlooking at oneself in a mirrordiseaseroyaltyjail cellservantsevered handstrong female leadforbidden loveviolinaction heroinecolonelcrushed to deathcannonfemale warriordamsel in distressexplosivecorsetbraverydual wieldstabbed in the throathatredcannibalmercilessnessstabbed in the necklove at first sightballexploding headpunched in the chestdark herosuperstitioninfectionprideaerial shotrainstormdisfigurementdark pasteye patchlieutenantmutationtragic herocellarmoral dilemmaroundhouse kickblood on camera lensface maskfemale fighterhead blown offepidemicphysicianquick drawmilitiaplagueflypocket watchbritish armywoman kills a manbritainstabbed in the shoulderfight the systemheirbritish soldieropen endedtragic pastwoman fights a manarm cut offaristocracycourtshiparmy basefade to blackanti heroinegrindhouse filmbilingualismthroneoutbreakhigh societygold diggersuitorelopementrich manslow motion action scenehorse drawn carriagesurprise during end creditswoman punches a manlordaxe in the headman fights a womansecret passagewaycountry estatemanor houseshaolinladywoman hits a manstory continued during end creditscliffhanger endingrich womansisterhoodswordswomanblood on mouthabandoned churchenglish countrysidegolddiggercavalry chargehordefire pokergeorgian eraexploding bridgepeace treatyjourney shown on maprogue soldierends with weddingburning bodymashupregency periodparsoncollapsing bridgehouse flyrace warreference to the four horsemen of the apocalypsetotal warwoman wearing an eye patch (See All)

The 13th Warrior (1999) is one of the best movies like Robin Hood: Prince Of Thieves (1991)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The 13th Warrior (1999)

In AD 922, Arab courtier Ahmad Ibn Fadlan accompanies a party of Vikings to the barbaric North. Ibn Fadlan is appalled by the Vikings customs-- their wanton sexuality, their disregard for cleanliness, their cold-blooded human sacrifices. And then he learns the horrifying truth: he has been enlisted  β€¦to combat a terror that slaughters the Vikings and devours their flesh. (Read More)

Subgenre:
sword and sorceryswashbucklercult filmepicfish out of waterrevisioniststonepunk
Themes:
murderdeathlovereligiondrinkingfearfuneraldeceptiontravelsupernatural powercannibalismmurder of brothernorse mythology
Mood:
gorerain
Locations:
forestboatwoodscavecampfire
Characters:
warriorfamily relationshipsfather son relationshipmother son relationshiptattooboyreference to godfacial tattoo
Story:
flaming arrowshot with a bow and arrowbow and arrowsword and shieldsword and sandalhand to hand combatsword fightmiddle agesfacial scarbarbariandaggertorchprincebattlefielddeath of brother β€¦kinggood versus evilcombatswordhorsefiredogbased on novelnumber in titlebloodviolencefightthree word titlevoice over narrationcorpsedrinkbattlevomitingdead bodydemonswimmingaxesnakesevered headfictional warunderwater scenecreaturelegendpoisonmissiontenthanginghorse ridingwaterfallsevered armpoetbearsleepingcowdismembermentspearhelmetmutilationsevered handskullshieldinvasioncannibalexilearabeye patchkingdomfortune tellerfast motion scenecameltranslatorprayinggreekcremationalarmvikingdigginglanguage barrierambassadorrespectheirperfumeprophetdiplomatfleeingretreatbanishmentnoblemanhoneybonesadaptation directed by original authorreference to allahangel of deathgonghordemarauderancient times10th centurybeowulfends with funeralirish wolfhoundvisceralcannibal cultflying debrisviking shipodinviking funeralblowing one's nosemohammadvalhallapaupercaliphwashing one's handsarabian horseseastorm (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Eragon (2006)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Eragon (2006)

The Kingdom of Alagaesia is ruled by the evil King Galbatorix, a former dragon rider that betrayed his mates and his people in his quest for power. When the orphan farm boy Eragon finds a blue stone sent by Princess Arya, he sooner realizes that it is a dragon egg. When the dragon Saphira is born, E β€¦ragon meets his mentor Brom, and becomes the dragon rider foreseen in an ancient prophecy that would set his people free from the tyrant Galbatorix. Eragon meets the rebels Varden and together they fight against the evil sorcerer Durza and the army of Galbatorix in a journey for freedom. (Read More)

Subgenre:
sword and sorceryswashbucklermartial artscult filmepicsword and fantasy
Themes:
couragemagicmonsterheromythology
Locations:
castle
Characters:
warriorsoldiertough guy
Story:
sword duelshot with a bow and arrowbow and arrowsword and sandalhand to hand combatbattle axeadventure herostick fightdaggersiegeknightbattlefieldduelkingdisarming someone β€¦ambushgood versus evilcombatswordhorsecharacter name in titlebased on novelone word titlefightbased on bookbattlesecretdemonfightingsubjective cameradeath of friendmixed martial artsfictional wardragonspearegghunterdwarfwizardkingdomtragic heroelfheroismfantasy worldsword fightingopen endedchosen onestaffteenage herofictional countryteenager fighting adultfire breathing dragonswordplayevil kingevil wizardhaystackflying dragondragon riderdragon featurehuman dragon relationship (See All)

Prince Of Persia: The Sands Of Time (2010)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Prince Of Persia: The Sands Of Time (2010)

Set in the mystical lands of Persia, a rogue prince and a mysterious princess race against dark forces to safeguard an ancient dagger capable of releasing the Sands of Time -- a gift from the gods that can reverse time and allow its possessor to rule the world.

Subgenre:
sword and sorceryswashbucklermartial artssword and fantasy
Themes:
murdermarriagebetrayalescapeherodeath of fathertime travel
Locations:
snowdesert
Characters:
action herowarriorsoldiertough guy
Story:
sword duelshot with a bow and arrowbow and arrowsword and sandalhand to hand combatsword fightswordsmandaggercrossbowprincekingambushgood versus evilcombatshowdown β€¦swordhorseexplosionviolenceflashbackkisstitle spoken by characterchasebattlekung fufoot chaseorphanassassinaxemountainarmycolon in titlemixed martial artssnakefalse accusationno opening creditsanti heroone man armyfictional warprincesson the runone against manyfugitivebrotherstylized violencestrong female characterdestinycountry name in titleraceassassination attemptheroinespin offstrong female leadreverse footageshieldsandseven word titledual wieldbased on video gamechaosframe updeceitbounty hunteralternate realitytigerkingdomblack magicframed for murderunclepalaceparkourfortresssorcereradopted sonmacguffinrobesword fightingtitle in titleempirecorrupt officialsubterraneanarmageddonpersiandukeostrichsandstormbrother versus brotherhourglasssheikpersiahuntedoasismagical objectheir to the thronewantedchanging the futuredeath of kingtime reversalfrozen timebrother against brotherstreet urchinbrother killing brotherregentprince of persiabrother brother hugbrother betrays brother (See All)

Braveheart (1995)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Braveheart (1995)

William Wallace is a Scottish rebel who leads an uprising against the cruel English ruler Edward the Longshanks, who wishes to inherit the crown of Scotland for himself. When he was a young boy, William Wallace's father and brother, along with many others, lost their lives trying to free Scotland. O β€¦nce he loses another of his loved ones, William Wallace begins his long quest to make Scotland free once and for all, along with the assistance of Robert the Bruce. (Read More)

Subgenre:
epicchrist allegory
Themes:
courageweddingtorturepregnancyfriendshipmurderdeathloverevengerapebetrayalpoliticsadulteryprisonfuneral β€¦executiondeath of wifefreedomdeath of daughter (See All)
Mood:
gorenightmarewedding night
Locations:
castleenglandforestlondon england
Characters:
warriorfather son relationshiptough guyhomosexualitycatholicfrenchchildhood friend
Story:
mass hangingflaming arrowsword and shieldsword and sandalhand to hand combatsword fightplantagenetbattle axemiddle agesarcheryhorseback ridingsiegemedieval timesrebelbattlefield β€¦loss of fatherambushcombatfalling from heightswordhorsefirefemale nuditymale nuditybloodviolenceone word titlefemale frontal nuditymale frontal nuditybare chested malesex scenefightbased on true storyvoice over narrationdreamcorpseblood splatterbattleprayermale pubic hairdecapitationmassacredisguisethroat slittingimpalementsevered headno opening creditscontroversyprincessmarriage proposallegendprologuefarmerhangingspeechdirected by startragic eventkissing while having sexdismembermentsubtitled sceneburned alivespearassassination attemptbarnloss of wifeblockbusteririshhonorburialdead womanbraveryarranged marriagescotlandenglishthrown through a windowdisembowelmentgay sonrainstorminsultgay stereotypetragic heroloss of brotherwedding receptionunclemain character diesunderdogwar violencedead childrenloss of daughteridealismmooningcrushed headfamous scoremartyrbrotherhoodrevoltnationalismbagpipescavalryscottish accentchildhood sweetheartscottortured to deathnobilityhandkerchieftyrannykilthanged boybattering ramedinburgh scotlandpublic executiondeer huntinglanceleprosydefenestrationsecret marriage14th centuryscottish highlandsaxe in the chesthanged child1300sknighthoodprince of wales13th centurysword throwingjoustdrawn and quarteredbow huntinghorse killedfamous speechhalberdwar crythistlewoman's throat slitcautery (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Hercules (2014) is one of the best movies like Robin Hood: Prince Of Thieves (1991)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Hercules (2014)

1400 B.C., a tormented soul walked the Earth that was neither man nor god. Hercules was the powerful son of the god king Zeus. For this, he received nothing but suffering his entire life. After twelve arduous labors, and the death of his family, this dark, world-weary soul turned his back on the god β€¦s finding his only solace in bloody battle. Over the years, he warmed to the company of six similar souls, their only bond being their love of fighting, and the presence of death. These men and women never question where they go to fight, or why, or whom, just how much they will be paid. Now, the King of Thrace has hired these mercenaries to train his men to become the greatest army of all time. It is time for this bunch of lost souls to finally have their eyes opened to how far they have fallen, when they must train an army to become as ruthless and bloodthirsty as their reputation has become. (Read More)

Subgenre:
sword and sorcerymartial artsblack comedysword and fantasy
Themes:
murderdeathloverevengekidnappingbetrayalghostprisondrunkennessescapemonsterdeceptionredemptionfaithdeath of wife β€¦self sacrificemurder of familygreek mythology (See All)
Mood:
gorenightmaremyth
Locations:
villageforesttrainsnowearthwalled city
Characters:
action herowarriormother son relationshipfather daughter relationshipsoldierhostagetough guybullyuncle nephew relationshipex soldier
Story:
flaming arrowbow and arrowsword and sandalhand to hand combatsword fightperson on fireknife throwingadventure heroarcherdaggerstabbed in the legtorchgoldprincebattlefield β€¦kicked in the facestatueattackkingstabbed in the cheststabbed to deathambushgood versus evilshot in the backcombatshowdownfalling from heightswordrescueshot in the headshot in the chesthorsefireknifedogcharacter name in titlebloodviolenceone word titleflashbackbare chested malefemale rear nudityfighttitle spoken by characterpartycorpseshot to deathblood splatterslow motion scenepunched in the facebattlebased on comicjailhallucinationfightingdecapitationorphanbased on comic bookaxemassacremountaindisguisemontagethroat slittingarmyimpalementprisonermapsnakenonlinear timelinebrunettesevered headno opening creditsone man armychild in perilfictional wardouble crosscreatureshot in the legprincesstraininglegendstabbed in the backstorytellingtentknocked outtough girllightningopening action scenefarmershot in the shoulderdeath of sondarkneck breakingthreatened with a knifemercenarysevered armshot in the armgeneralbare chested male bondagekillingstylized violencecivil warrockpiratetraitordestinywolfhead buttspearhelmetjail cellvandalismfraudlossclubfateaction heroineanimal attackfalse identitycrushed to deathfemale warriorfull moonadventurershieldhaunted by the pasttarget practicesufferingpastdual wieldstabbed in the throatwhipson3 dimensionalmuteshot in the facegreecestabbed in the headframe uplostswamphit on the headexploding headdark herolionaerial shotdungeonknife fightsoulcapturestabbed in the eyekingdomtragic heropalacecrowdrugged drinkstrongmangiant monstermegalomaniacstabbed in the armtavernbased on graphic novelstabbed in the shoulderteamworkchainedshot in the throatrighteous ragestabbed in the facetragic pastdeath of familywarlordpsychotronic filmscytheanimal killinglong brown hairdreadlocksathens greecegiant animalepic battlestrong manhorse drawn carriageancient greeceaxe fightdouble entendretyrannygiant creatureambiguitywoman hits a manspear throwingherculeschariotevil kingprecognitionclosing eyes of dead personhead on a stakehurttunictooth ripped outamazon warriorbroken jawfemale mercenaryhydrasoothsayercerberusfemale archeropening creditsheir to thronedark worldgod king (See All)

Solomon Kane (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Solomon Kane (2009)

Once a mercenary of Queen Elizabeth I fighting Spaniards in Africa, Solomon met the Devil's Reaper and discovered he was bound for hell. Barely escaping, he soon renounced violence to atone for his past sins, seeking out redemption in a life of peace. That is until the followers of sorcerer Malachi  β€¦kidnap a Puritan girl, Meredith Crowthorn, and brutally slaughter her family before his very eyes, forcing Solomon to take up arms and return to his violent ways once more to rescue her. (Read More)

Subgenre:
sword and sorceryindependent filmb moviesword and fantasychrist allegorygothic horror
Themes:
magictorturemurderdeathrevengekidnappingreligionbetrayaldrunkennessfuneralmonsterdeceptionredemptionfaithabduction β€¦cannibalismdevilmurder of familycooking over a campfire (See All)
Locations:
castleenglandvillageforestchurchsnowcemeterywoodsshipcavecampfire
Characters:
witchwarriorpriesthusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipbrother brother relationshipbrother sister relationshipzombiesoldierhostagebibleself mutilation β€¦ex soldiership captain (See All)
Period:
winter16th century1600s
Story:
horse chasesword fightperson on firescars on backrobberdaggerstabbed in the legcrossbowtorchprincedeath of brotherstatuekingstabbed in the cheststabbed to death β€¦ambushgood versus evilshot in the backrivershowdownfalling from heightswordrescueshot in the headshot in the chesthorsefireknifeexplosioncharacter name in titlebloodviolenceflashbacktwo word titlebare chested maleguntitle spoken by characterchasesurprise endingcorpseblood splattermirrorslow motion scenebattlemaskbased on comicinterrogationdemonbritishprayerdecapitationaxemassacredisguisethroat slittingarmyimpalementsevered headno opening creditsanti herochild in perildouble crossjourneytransformationshot in the foreheadcursestabbed in the backprologuetentknocked outdeath of childscardeath of sonhorse ridingneck breakingtrapthreatened with a knifemercenarysevered armundeadrevelationheavy rainhatslaverycaptivecrucifixtreasurewitchcraftaccidental deathjumping from heightmind controlmonkslaveeaten alivepresumed deadpromisereverse footagestabbed in the throatgash in the facesibling rivalrydark herodead childjumping through a windowdungeonmurder of a childsoulhealingrainstormcliffdisfigurementdark pastaxe murderdemonic possessionsevered legblack magicburned to deathwilhelm screamteleportationcrowmudblood on camera lensillusioncrucifixiondrifterbag over headmonasterygiant monsterevil spiritportalfortresssorcerershot in the eyetavernmercy killingpatricideepiloguedeath of familyinnmasked villainfather son reunionsorceryanimated creditsgrim reaperdreadlocksimmolationlocketpitdeal with the devilfratricidescottish accentlong haired maleknife in the chestflintlock pistolhorse drawn carriagejumping out a windowscrolllordspaniardorigin of heropaganfrozen lakehealerfuneral pyrebrother versus brotherpacifistnorth africahuman skullkidnapped girloutnumberedbritish flagcloakrainy dayabbeystabbed through the chesttravellerclosing credits sequencehanged bodypuritanpushed from heightaxe in the chestcovered wagonhead chopped offunion jacklast wordstrap doorflaming swordburning villageleather maskelizabethan erabrother against brotherstabbed through backbased on pulp magazinehuman in a cagewitch burningevil versus evildisownedhole in hand1550scloak and daggerpile of goldprison wagonburned villageyear 1600 (See All)

Gods Of Egypt (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Gods Of Egypt (2016)

Set, the merciless god of darkness, has taken over the throne of Egypt and plunged the once peaceful and prosperous empire into chaos and conflict. Few dare to rebel against him. A young thief, whose love was taken captive by the god, seeks to dethrone and defeat Set with the aid of the powerful god β€¦ Horus. (Read More)

Subgenre:
martial artsblack comedytragedyepicaustralian fantasyaustralian science fictionaustralian horrorsword and fantasychrist allegoryscience fantasy
Themes:
couragemurderdeathloverevengesurrealismkidnappingbetrayalfearescapemonsterdeceptionseductiondeath of fatherbrutality β€¦supernatural powerredemptionfaithhopeapocalypseblindnessself sacrificemythologynear death experienceafterlifeunlikely heroegyptian mythology (See All)
Mood:
poetic justicedarknessaustralian supernatural
Locations:
desertelevatorshipouter spacecavejungleaustralian space travel
Characters:
action herowarriorthiefhusband wife relationshipfather son relationshipmother son relationshipboyfriend girlfriend relationshipbrother brother relationshipsoldierhostagetough guyex husband ex wife relationshipdeath of girlfriend
Story:
shot with an arrowbow and arrowsword and sandalhand to hand combatsword fightfall to deathstick fightdaggerstabbed in the legguardtorchrebelgoldbattlefieldloss of father β€¦statueattackdangerkingstabbed in the cheststabbed to deathambushgood versus evilcombatshowdownfalling from heightswordrescueshot in the chesthorsefistfightfireknifeexplosionbloodviolenceflashbackbare chested malekissfightchasesurprise endingvoice over narrationbeatingcorpseslow motion scenepunched in the facebattlebrawlbeddemonorgydecapitationsurvivalbedroomassassinold manaxemassacremountainbridgearmyimpalementmixed martial artssnakesevered headno opening creditsanti heroone man armyfictional wardouble crossunderwater scenecreaturenecklacetransformationone against manylibrarycharacter repeating someone else's dialoguestabbed in the backprologuemissiondragonrace against timeevil manlightningopening action sceneskeletonbraceletdeath of husbandtrapthreatened with a knifewaterfallsevered armlove interestclass differencesqueenstylized violencehenchmancivil wareavesdroppingdestinysabotagedestructionburned aliveflyingspearassassination attemptbreaking and enteringquesthelmetslaveryelephantloss of loved onetempletreasureexploding buildingkicked in the stomacharchitectgiantservantmind controlwomanizerend of the worldfateanimal attackfemale killercrushed to deathback from the deadslavereverse footageshieldhaunted by the pastburglarvisiontelescopebraveryburglarystabbed in the throatmercilessnessegyptchaosstabbed in the neckresurrectionimmortalityswampexilesibling rivalrypunched in the chestdark herosunbooby trapheartaerial shotknife fightwisecrack humoryoung loveeye gougingdark pasteye patchkingdomloss of husbandtragic herosevered legburned to deathdictatorloss of brotherbrainteleportationgeniuspalacetelepathytorso cut in halffemale assassintombnarrated by characterprayingdirector cameoface maskfinal showdowneyesuper strengthgiant monstersex slaveparkourportaltwo man armyworld dominationmegalomaniaccrowncheering crowdcrash landingscorpionpyramidreluctant heropatricideman kills a womanseductresshumorfinal battlecapeheirsole black character dies clichedecadencerighteous ragetragic pastvaultwarlordarm cut offriddlecoup d'etatphilosopherancient egyptanimal killingrock climbinghusband murders wifeimmolationglowing eyesthronefratricidewingsstarts with narrationbeetleslow motion action scenehorse drawn carriagescrollgold coindouble entendreone eyed manegyptianloss of girlfriendcollapsing buildingtrackercoronationsandstormgiant creaturefire breathing dragongiant snakehenchwomanoutrunning explosionout of body experiencesphinxchariotstabbed through the chestfighting in the airmegalomaniaaustralian creaturestunicblindedfloating in spaceslave girlflaming swordfalling into a poolsedan chairduplicateobeliskwoman changing clothesegyptian godhieroglypheyes gouged outaustralian monstersheir to throneofferingback hand slapland of the deadwalking across desertpile of goldegyptian goddessriver nile (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Brave (2012)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Brave (2012)

Set in Scotland in a rugged and mythical time, "Brave" features Merida, an aspiring archer and impetuous daughter of royalty. Merida makes a reckless choice that unleashes unintended peril and forces her to spring into action to set things right.

Subgenre:
coming of agecomputer animationslapstick comedycgi animation
Themes:
magicrevengemarriageghostescapedeceptionredemption
Locations:
castlevillageforestsnowboatwoodsship
Characters:
witchwarriorfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipbrother brother relationshipbrother sister relationshipteenage girlfemale protagonistgirltough guy β€¦maidhunting party (See All)
Story:
shot with an arrowbow and arrowsword fightknife throwingarcherarcheryhorseback ridingarrowmedieval timesrowboattorchrebelprincekingambush β€¦good versus evilrivershowdownbare buttswordrescueshot in the chesthorseknifemale rear nudityfemale nuditydogf ratedone word titleflashbackdancingtitle spoken by characterchasesurprise endingvoice over narrationtitle directed by femaleshot to deathslow motion scenepunched in the facebirthdayswimmingfoot chaseaxemontagefishno opening creditsprincessnecklacetransformationon the runtrainingflash forwardlegendcursecharacter repeating someone else's dialogueprologuescreamingkeyrace against timetough girllightningprankcontestfeminismchickenwaterfallshot in the armbearqueenstrong female characterchessdestinyfalling down stairsspiritfireplaceteen angstspearheavy rainlooking at oneself in a mirrorcakebuttockssheepstrong female leadfateanimal attackapplefemale warriorshieldtarget practicebraveryscotland3 dimensionalscene after end creditspunched in the chestprideaerial shotshadowrainstormkingdomwishblack magicsign languagecrowtriple f ratedhit in the facebirthday presentstuffed animalstrongmanyoung version of charactercrowndomineering motherfemale heromooningmacguffinstablefight the systemheirbechdel test passedbowbagpipesanimal killingbanquetrock climbingmagic spellteenage herothronehide and seekmedievalsuitorscottish accentbroomscotclothes rippinghuman becoming an animallordharptrackerrebellious daughterruinwood carvinginvisiblespit takeclanspear throwingteenage rebellionmatriarchytrackingone legged manrider horse relationshipwooden legmusic lessontug of warscottish highlandstripletscauldrongirl horse relationshipaxe throwingthrown from a horsebareback ridingredheaded girlcubriding bareback10th centuryirish wolfhoundtapestrypeg legceltdisney princessevil spelllutefemale horse riderfemale archerbetrothalplaying bagpipesbullseyehaggisanimal becomes humangirl riding a horsewill o' the wispfiery redheadwork horsedrumstickrefusing to believehighland gamesmenhir (See All)

The Forbidden Kingdom (2008) is one of the best movies like Robin Hood: Prince Of Thieves (1991)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Forbidden Kingdom (2008)

An American teenager who is obsessed with Hong Kong cinema and kung-fu classics makes an extraordinary discovery in a Chinatown pawnshop: the legendary stick weapon of the Chinese sage and warrior, the Monkey King. With the lost relic in hand, the teenager unexpectedly finds himself traveling back t β€¦o ancient China to join a crew of warriors from martial arts lore on a dangerous quest to free the imprisoned Monkey King. (Read More)

Subgenre:
martial artscoming of agewuxia
Themes:
robberymurderrevengedrunkennessherotime travelvengeancephilosophy
Locations:
villageforestdesertrooftopcavechinacampfire
Characters:
witchaction herowarriorteenagertough guybullyvillainamerican
Story:
shot with a bow and arrowshot with an arrowbow and arrowhand to hand combatsword fightmiddle agesarcheryswordsmanstatuedueldisarming someonestabbingshot in the backcombatshowdown β€¦falling from heightswordshot in the chesthorsefistfightbased on novelbloodviolenceflashbackfighttitle spoken by characterchasebeatingdreamurinationbattlebrawlshootingfightingkung fuorphanflashlightwinestrangulationmountainambulancemixed martial artsbirdlegendkaratemartial artistwaterfallwhippingstylized violencemartial arts masterspearquesttemplevillainessmonkchop sockykickboxinginterracial romancewhipboston massachusettsprophecyimmortalitymentorbounty hunterkarate chopkatanaalleyhairparkourwelldrumparamedicartifactpotionresponsibilitypawnshopinnwarlordbo staffcavalrystaffrelicwu shusecret loveslow motion action sceneshaolinsandstormteenager fighting adultturned to stoneoutnumberedprotectorwuxia fictionfighting in the airelixirsparrowunspoken lovemagical weaponburning villagemonkey kingrice paddysagecrescent mooncherry treereferring to oneself in the third person (See All)

Troy (2004)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Troy (2004)

As the Greeks fall, they decided to head back home. King Priam decides to have one last battle with the Greeks to leave Troy for good. It was a night battle so the Greeks didn't knew, raining them down with flaming arrows and lighting huge balls of dry branches and rolling them down at the beach. It β€¦ was a battle that Achilles wasn't in, but his cousin Patroclus pretended to be him by wearing his armor, his sword, his helmet, and his moves. Hector finally had a battle with Achilles not knowing it wasn't him. Patroclus was fast but Hector was faster, causing him to cut Patroclus's neck and finishing him with a sword to the heart. (Read More)

Subgenre:
sword and sorcerymartial artstragedyepic
Themes:
revengerapebetrayaladulteryfearescapeheromilitarybrutalitygreedvengeancemythologygreek mythology
Mood:
goremythgreek myth
Locations:
villagecityshipwalled city
Characters:
cousin cousin relationshipwarriorpriestbabyhusband wife relationshipfather son relationshipbrother brother relationshipsoldierbest frienddeath of hero
Story:
flaming arrowshot with a bow and arrowshot with an arrowbow and arrowsword and sandalhand to hand combatsword fightperson on firecousinarcherarcherydaggersiegestabbed in the legprince β€¦battlefieldduelkingstabbed in the chestcleavagefalling from heightswordknifemale rear nudityfemale nuditybloodsex scenekissfemale rear nudityfighttitle spoken by charactersurprise endingcorpseblood splatterblondebattleundressingplace name in titlethroat slittingarmyimpalementscantily clad femaleritualstabbed in the backmistaken identitytentopening action scenecity name in titlegiftkissing while having sexqueenpowerspearhammerblockbusterhonorslaveshieldbraveryinvasionold agefight to the deathloss of sonstabbed in the throatimpostorstabbed in the headarmorkingdomloss of husbandtragic herowilhelm screamchallengemain character diespalaceadulterous wifegategreekcremationfemale removes her dressfireballstabbed in the armnavyfatherhoodstabbed in the shouldercowardempiretreacheryshot in the footstabbed in the facebrotherhoodritegodlong brown hairthroat cutlootingcustomcorridorretreatcowardicefeastancient greecebrandinglong blonde hairwarshipstabbed in the sidefuneral pyreprotegeantiquitychariotgreek godegotismcourtyardfarewellstabbed through the chestpriestessancient civilizationdeath sceneescape plangreco roman wrestlingdesecrationfighting moviestitchfleetachilles tendon cutgloryancient worldhuman brandinglast wordstakeoverheroicagreementpyreends with funeraltrojan horseoverthrowposeidonbronze agetroyplundervindicationjavelintrojan warsword woundburning cityfavorite sonhelen of troyromance subplotaegean seaheelancient troybroken arrowcall to armstrojan (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Ironclad (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Ironclad (2011)

It is the year 1215 and the rebel barons of England have forced their despised King John to put his royal seal to the Magna Carta, a noble, seminal document that upheld the rights of free-men. Yet within months of pledging himself to the great charter, the King reneged on his word and assembled a me β€¦rcenary army on the south coast of England with the intention of bringing the barons and the country back under his tyrannical rule. Barring his way stood the mighty Rochester castle, a place that would become the symbol of the rebel's momentous struggle for justice and freedom. (Read More)

Subgenre:
swashbucklerindependent filmmartial arts
Themes:
thefttorturesuicideseductionbrutalitysadismexecutioncrueltystarvation
Mood:
gore
Locations:
castleenglandbrothel
Characters:
warriorprostitutebullysuicide by hanging
Story:
sword duelshot with a bow and arrowshot with an arrowbow and arrowsword held to throatsword and shieldwhite horsehand to hand combatsword fightplantagenetbattle axemiddle agesadventure heroarcherswordsman β€¦arrowmedieval timesknightrebelkingstabbed to deathfistfightfemale nuditybloodviolenceone word titlebare chested maleblood splatterbattleprayerdecapitationaxemassacremixed martial artsstabbed in the backprologueevil manhangingpigmercenarysevered armdismembermentspearwoundmutilationmale bondingdysfunctional marriagesevered handclubshieldarranged marriageblood on faceunfaithful wifestabbed in the neckhungerstabbed in the headfogarmorkingdomdead woman with eyes openfinal showdowncockroachcorporal punishmentanimal crueltyamputationepilogueilliteracyhead cut offstabbed in the shoulderchapelstabbed in the facearm cut offinfantryscoldingimplied sexcavalrysevered footstarvingloveless marriagemacewoman initiating sexstabbed in the mouthstabbed multiple timeswine drinkingcut armsliced in twohand cut offsteel helmetnobilityrainy nightbaroncatapultdead prostituteswordplaybattering ramspear throwingsingle locationstocksman and woman in bedstealing foodpeachevil kingleg cut offsplit in twoarchbishopcavalry chargecrusaderlong swordarm woundpaying for sexknights templargangrene13th centurychain mailmultiple stabbingsdragged by a horsetwo on a horsetemplar knightabbotvow of silencedeath by swordcauterizationneck slashingeating insectholding someone's head underwaterstabbed through the mouthswordsmenknight templartrebuchetcauterizing a woundeating an insectquill penunconsummated marriagedunking head in waterportcullisstabbed with swordvow of chastitycg effectscutting out tonguekilling a pigamputated handarrow in the backlifting up a dresspulling up skirthead sliced in twohead split in twoman cut in halfomnipotent narratorstabbed in neck1210saxe in the shoulderhead cut in twoscaling ladderspear in chestthrowing an axe (See All)

Seventh Son (2014)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Seventh Son (2014)

John Gregory, who is a seventh son of a seventh son and also the local spook, has protected his country from witches, boggarts, ghouls and all manner of things that go bump in the night. However John is not young anymore, and has been seeking an apprentice to carry on his trade. Most have failed to  β€¦survive. The last hope is a young farmer's son named Thomas Ward. Will he survive the training to become the spook that so many others couldn't? Should he trust the girl with pointy shoes? How can Thomas stand a chance against Mother Malkin, the most dangerous witch in the county? (Read More)

Subgenre:
sword and sorcerymartial artscoming of ageblack comedydark fantasysword and fantasy
Themes:
couragerobberymagicmurderdeathloverevengesurrealismkidnappingbetrayalghostfearescapemonsterdeception β€¦supernatural powerdeath of motherredemptionunrequited lovehopeself sacrifice (See All)
Mood:
nightdarkness
Locations:
castlevillageforestchurchsnowwoodsfarmcampfirewalled city
Characters:
witchaction herowarriormother son relationshipmother daughter relationshipsoldiersister sister relationshiptough guyalcoholicteacher student relationshipevil witchdeath of student
Story:
bow and arrowhand to hand combatsword fightknife throwingman murders a womanswordsmanstabbed in the legcrossbowtorchknightbattlefieldattackstabbed in the cheststabbed to deathambush β€¦good versus evilcombatshowdownfalling from heightswordrescuehorsefistfightfireknifeexplosiondogbased on novelviolencefighttitle spoken by characterchasesurprise endingurinationslow motion scenebattlebrawldemonhallucinationassassinstrangulationaxemountainmontagethroat slittingbridgearmyimpalementmixed martial artsno opening creditsanti herochild in perilfictional warunderwater scenecreaturefemme fataletransformationtrainingskinny dippingstabbed in the backprologuepossessiondragonrace against timelightningskeletonfarmerexploding bodypigthreatened with a knifewaterfallbearqueenstylized violencestrong female characterhenchmandestinyburned alivespearassassination attemptheavy raincagecatfightvillainesseccentricgiantjumping from heightirishskullstrong female leadaction heroinefemale killerbar fighteaten alivefull moonretirementvisiontarget practicebraverydual wieldson3 dimensionalstabbed in the headoiltime lapse photographydark heroaerial shotknife fightwisecrack humorrainstormdeerdisfigurementdemonic possessiontragic heroblack magicburned to deathexorcismteleportationfemale fightergiant monstertwo man armyworld dominationfemale spyhired killertavernassistantpremonitionman kills a womantrollwoman kills a manstabbed in the shouldersole black character dies clichebladejumping into waterstabbed in the faceclawgravestonepitchforkchosen oneapprenticearmorypitregenerationvillain turns goodmentor protege relationshiptragic villainhorse drawn carriagenetgold coinaxe fightbrandingpendantleopardtalismanwarlockgiant creatureturned to stonebased on young adult novelcaged humancaught in a netwitch huntfemale thiefsilvercrisis of consciencetailtroubled productioncloakbell towerfighting in the airwoman murders a manmaster apprentice relationshipshape shiftingsororicidecauldronaxe throwingbookshelfgemstonesceptertough womanwoman murders a womanwitch hunterrolling down a hilltapestryfarmboydark forestwitch burningopening creditswoman kills a womanblood moongood witchcarry onrolling downhillcliffhanginglancashire (See All)

Exodus: Gods And Kings (2014) is one of the best movies like Robin Hood: Prince Of Thieves (1991)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Exodus: Gods And Kings (2014)

Epic adventure Exodus: Gods and Kings is the story of one man's daring courage to take on the might of an empire. Using state of the art visual effects and 3D immersion, Scott brings new life to the story of the defiant leader Moses as he rises up against the Egyptian Pharaoh Ramses, setting 600,000 β€¦ slaves on a monumental journey of escape from Egypt and its terrifying cycle of deadly plagues. (Read More)

Subgenre:
black comedyepicchrist allegorybiblical
Themes:
courageweddingmurderdeathrevengesurrealismreligionpoliticsfearescapefuneraldeath of fatherbrutalityparanoiagrief β€¦illnessfaithhopecrueltypanicdyingfreedomhuntingstarvationcooking over a campfire (See All)
Mood:
raindarkness
Locations:
villagebeachboatdesertfarmshipcavecampfirestormship explosion
Characters:
thieffamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipbrother brother relationshipboybrother sister relationshipsoldiersister sister relationshipjewishreference to godinterracial relationshipchristianity β€¦little boybibleuncle nephew relationshipfishermanbaby boyfacial tattoo (See All)
Story:
flaming arrowbow and arrowsword held to throatsword and sandalhand to hand combatsword fightman on fireperson on firepublic hangingarcherhorseback ridingdaggerguardtorchprince β€¦battlefieldarsonstatueattackkingstabbed in the cheststabbed to deathshot in the backcombatshowdownfalling from heightswordrescueshot in the chesthorsefireknifeexplosiondogbloodviolencebondagebare chested malekissfightchasesurprise endingcryingcorpseshot to deathfoodbattlearrestlierunninginterrogationhallucinationsubjective cameraspysurvivalassassincandleold manaxemountainmontageeatingarmyimpalementsnakefishapologyno opening creditsunderwater scenesearchshot in the legdrowningpainflash forwardliarrace against timetentknocked outdeath of childlightninghangingpursuitdeath of sonthreatthreatened with a knifechickengeneralwhippingcowtrustrioteavesdroppingdestinysabotagedestructionkilling an animalspearassassination attemptmass murderheavy rainhelmetslaverydiseaseragebeardhidingfrogsheepparadeanimal attackmilkgoatcrushed to deathbroken legslaveeaten alivepromiseshieldsufferingthunderconstruction siteloss of sonstabbed in the throategyptironyshot in the faceprophecydelusionexilehit on the headsibling rivalrybelief in godarmorclifftribedead boypalacecameltombsaving a lifebarking dogsunsetjudaismmummydead animaldoubttreasoncrocodileplagueshoutingstabbed in the armwelltornadoseagullhearing voicesflyfilm starts with textpyramidadopted sonsense of smellstabbed in the shoulderempireshot in the throathonestymaggotcaravanstabbed in the facefather son reunionwaking upmilitary trainingmonumenthorse and wagonshepherdfloggingancient egyptvillain not really dead clichethronehebrewoverhead shotchantinglootingcatastrophemercylambfalling off a cliffcobraquarryrunning for your lifemessengerhusband wife reunionegyptiandead babyguerilla warfarepharaohgallowssandstormembroiderydead fishtidal wavebased on the bibleexodusomenkiss on the foreheadwalking in the rainmarriage ceremonysphinxgrapeanimal sacrificechariotclappingvenomemancipationlanceswarmencampmentbedouinpriestesscarrying a dead bodydivine interventionold testamentreference to abrahampassovertalking to godweavingeldermosesbuilding explosioncatfishinhumanityadvisorbolt upright after nightmarecavalry chargecovered wagonwading in watergiant wavereunited familylocustnile riverburning a dead bodyadopted brothercradleface paintinghaillandslideloomoxenmudslidered seaspinning wheelhorse drawn wagonshiveringmountain roadten commandmentstrampled to deathviceroycrocodile attackact of godboildeath of a horseescape from slaveryseditionvolley of arrowsbiblical plaguesburning bushcamp sitedead duckgrand vizierox cartcanaanwedding vowsbody soreswarm of insects (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Ladyhawke (1985)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Ladyhawke (1985)

Philipe Gastone, a thief, escapes from the dungeon at Aquila, sparking a manhunt. He is nearly captured when Captain Navarre befriends him. Navarre has been hunted by the Bishop's men for two years, ever since he escaped with the Lady Isabeau who the Bishop has lusted after. Navarre and Isabeau have β€¦ a curse that the Bishop has placed on them that causes Navarre to be a wolf during the night and Isabeau to be a hawk during the day. Navarre insists that Philipe help him re-enter the city to help him kill the heavily guarded Bishop. (Read More)

Subgenre:
sword and sorcerysword and fantasy
Themes:
prison escapetheftmagicmurderdeathloveprisondrinkingescapeevilreligious tolerance
Mood:
rain
Locations:
castleforestchurchsnowwatercampfiretunnelsewer
Characters:
thiefpriestdancerhorse actor
Story:
shot with an arrowbow and arrowkilled with a swordcorrupt priestblack horsesword fighthorseback ridingmedieval timescrossbowknightbattlefieldpassionstabbed in the cheststabbed to deathcombat β€¦riverfalling from heightswordrescuehorsebloodviolencekissfightdancingtitle spoken by characterchasecryingdreamfoodbattletearsrunningjailprayerswimmingaxemountainimpalementprisonerchildbirdfictional wartransformationcursefugitivemissionrabbithangingpursuitcrossreunionunderwatergardenicewolfspearelectronic music scoreslow motionquestjail cellmousehuntersheepmonkdark herodungeonrainstormarmorkingdomspellsunsetpickpockettowerdiggingwellsunrisebishopsword fightingcathedralstar crossed loverstragic loveinnhorse and wagonhawkchurch belleclipsetalking to selfbear traphuman becoming an animaldawnladyfalconfalling through iceanimal traplovers reunitedpicking a locklock pickrider horse relationshiparrow in chesttalking to goddrawbridgegirl horse relationshipbell ringingbareback ridingdrainenchantmenttrapperduskriding barebacksword throwingevil spellluteplanetary alignmentwoman horse relationshipboy horse relationshiptransformfemale horse riderleg hold trapandalusianbird of preyman horse relationshipspeaking in rhymegirl riding a horsestabbed with an arrowstabbed with swordtalking to a horsehooded cloakfalconerfalling from a towerblack knightcastle ruinscow skulltrained horseturned into a birdtwo riding a horse (See All)

Seven Samurai (1954)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Seven Samurai (1954)

A veteran samurai, who has fallen on hard times, answers a village's request for protection from bandits. He gathers 6 other samurai to help him, and they teach the townspeople how to defend themselves, and they supply the samurai with three small meals a day. The film culminates in a giant battle w β€¦hen 40 bandits attack the village. (Read More)

Subgenre:
martial artscult filmepiccult classic
Themes:
couragefriendshipdeathloverevengesuicidefeardrunkennessherodeceptionangergriefhopedeath of wifepanic β€¦falling in lovesamuraistarvation (See All)
Mood:
rain
Locations:
villageforestjapanfarmcampfiretown
Characters:
action herowarriorthiefhusband wife relationshipfather daughter relationshipchildrenhostagetough guyold friendcrying babysamurai swordsamurai warrior
Period:
16th century
Story:
shot with a bow and arrowbow and arrowstabbed with a swordhand to hand combatsword fightstabbed with a spearpeasantswordsmanstick fightsiegebattlefieldarsonattackdueldisarming someone β€¦combatrivershowdownswordhorsefiremale rear nuditynumber in titleviolencebare chested malegunkisssingingchaseshot to deathslow motion scenebattlesecretrifleorphanold manprisonermapfishingchild in perilold womantrainingfarmerhorse ridingpremarital sextied upmercenarywaterfallflowerlove interestclass differencesspearhappinessmale bondingcrying womanforbidden lovefollowing someonehonorcrying manburialmoralitycelebrationsufferingkatana swordmisunderstandinghungerdespairensemble castyoung lovearmorblind mantragic heromoral dilemmacrowdmudtombbanditkatanakendostrategyassumed identitystandofffencingoffscreen killingilliteracyhumormusketvictorybo staffhouse on firevillagerhillman with no namehostage situationstraight razorharvestlootingflintlock rifleweepingchopping woodricekneelingmoral ambiguitybarricadebarefoot womansicklejidai gekilong black hairmillwashing hairelderly womanpracticemockeryoutburstrecruitingshot with a guncaptive womanhead shavinggenealogyelderly manmaster apprentice relationshiproninsabresakecherry blossomnumber 7 in titlefalling off a horsecult favoriteweeping womandragged by a horseweeping manfalse alarmrice paddywater millsheathplaying flute1570sadmirationrain fightbarleyhot headedcatching fish by handvillage elderdejectionfather hits daughterhorse drawn plow (See All)

Conan The Barbarian (1982)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Conan The Barbarian (1982)

A village is attacked by the evil ruler of the Snake Cult, Thulsa Doom ('James Earl Jones' (qv)) and his evil warriors, when Thulsa Doom and his warriors kills his parents, a young boy named Conan ('Jorge Sanz (I)' (qv)) is enslaved. Years later, Conan grows up and becomes a mighty warrior and is tr β€¦ained as a fighter. After years as a slave and as a gladiator, Conan is set free. Conan sets out on a quest as he vows to avenge his parents and solve the riddle of steel. Joined by a archer named Subotai ('Gerry Lopez (I)' (qv)), a beautiful thief who falls in love with Conan, Valeria (sandahl Bergman') and a Chinese wizard ('Mako (I)' (qv)), Conan and his companions sets out to rescue Princess Yasmina ('Valerie Quennessen' (qv)), daughter of King Osric ('Max von Sydow (I)' (qv)), from the Snake Cult, and get his revenge on Thulsa Doom and avenge his parents. (Read More)

Subgenre:
sword and sorcerymartial artscult filmepicalternate historysword and fantasychrist allegory
Themes:
murder of fathermagictorturemurderfriendshipdeathrevengesuicideghostfuneralseductiondeath of fatherbrutalitydeath of mothercannibalism β€¦vengeanceself sacrificemythologysamuraimurder of mother (See All)
Mood:
poetic justicegore
Locations:
villagedesertseatown
Characters:
witchaction herowarriorthieffather son relationshipmother son relationshipboytough guysamurai swordrevenge motiverevenge seeker
Story:
sword duelbow and arrowsword and sandalhand to hand combatsword fightperson on firearcherbarbarianbattlefieldkingstabbed in the cheststabbed to deathgood versus evilcombatshowdown β€¦falling from heightswordrescueshot in the headface slapfemale nuditycharacter name in titlebloodviolencefemale frontal nuditybare chested malesex scenefightthree word titlevoice over narrationblood splatterbattledemonorgykung fudecapitationname in titleaxethroat slittingarmyimpalementsnakesevered headcultanti heroone man armypart of seriesnarrationfictional warfemme fataleprincessfirst of seriesevil manpremarital sexsacrificerunawaytwenty somethingwolfathletekilling an animalspearslaverymutilationwitchcraftsevered handpart animationserieskatana swordfight to the deathcannibalwizardpsychotronicbooby trapcapturedeath of loved oneblack magiccamelheroismnarrated by characterbreak incrucifixionkendomusclemannarratorstandoffmegalomaniacsorcererarenahypnotismmasteractual animal killedsword fightingfinal battlehandfamous scoreprehistoric timesorchestral music scoregladiatorharemwarlordquotationcounter culturevultureloinclothalternate versionstabbed in the mouthinterspecies sexfuneral pyreserpentdeath of petreference to friedrich nietzscheevil powerstone ageancientgiant snakesteelevil sorcererfilm starts with quoteeating human fleshtwo against onewarrior womanavengerquotewarrior racehead on a stakerevenge killingmongolmuscleskilled by a dogpeplumman beastsymphonic music scorecannibal cultblueberrybroken swordfilm starts with a quoterobert e. howardavengebased on pulp magazinelotusbased on multiple workspaleolithic agesnake pitman versus beast10000 b.c.100th century b.c.hyborian agemute villainsacrificing own lifesword forging (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Your Highness (2011) is one of the best movies like Robin Hood: Prince Of Thieves (1991)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Your Highness (2011)

Throughout history, tales of chivalry have burnished the legends of brave, handsome knights who rescue fair damsels, slay dragons and conquer evil. But behind many a hero is a good-for-nothing younger brother trying just to stay out of the way of those dragons, evil and trouble in general. As two pr β€¦inces on a daring mission to save their land, they must rescue the heir apparent's fiancee before their kingdom is destroyed. Thadeous (McBride) has spent his life watching his perfect older brother Fabious (Franco) embark upon valiant journeys and win the hearts of his people. Tired of being passed over for adventure, adoration and the throne, he's settled for a life of wizard's weed, hard booze and easy maidens. But when Fabious' bride-to-be, Belladonna (Zooey Deschanel), gets kidnapped by the evil wizard Leezar (Justin Theroux), the king gives his deadbeat son an ultimatum: Man up and help rescue her or get cut off. Half-assedly embarking upon his first quest, Thadeous joins Fabious to trek across the perilous outlands and free the princess. Joined by Isabel (Natalie Portman)-an elusive warrior with a dangerous agenda of her own-the brothers must vanquish horrific creatures and traitorous knights before they can reach Belladonna. If Thadeous can find his inner hero, he can help his brother prevent the destruction of his land. Stay a slacker, and not only does he die a coward, he gets front row seats to the dawn of an all-new Dark Ages. (Read More)

Subgenre:
sword and sorcerymartial artsblack comedysword and fantasy
Themes:
magicweddingtorturemurderdeathrevengekidnappingdrugsbetrayaldrunkennessescapemonsterdeceptionsupernatural power
Mood:
gorespoofparody
Locations:
castleforestwoodscampfire
Characters:
witchaction herowarriorfather son relationshipbrother brother relationshipsoldierhostage
Story:
bow and arrowstabbed with a swordhorse chaseinterrupted weddinghand to hand combatsword fightdaggerstabbed in the legcrossbowtorchknightprincebattlefieldattempted rapeking β€¦stabbed in the cheststabbed to deathambushgood versus evilcombatswordrescuehorsefistfightfireknifeexplosionfemale nuditymale nuditybloodviolencetwo word titlebare chested malefightpartychasecorpseblood splatterbattlebrawlf worddecapitationfoot chaseaxearmyimpalementmixed martial artssevered headanti herobirdritualcreatureprincessskinny dippingvirginstabbed in the backmissiondragonrace against timetough girlexploding bodycharacter says i love youthreatened with a knifewaterfallsevered armfireworksbare chested male bondagestrong female charactertraitorkilling an animalquesttied to a bedgiantstrong female leadaction heroineanimal attackbar fightfemale warriorfull moondamsel in distressdwarfreverse footagesevered fingercannibalwizardprophecystabbed in the headsibling rivalrydungeonknife fightslackercapturetribekingdomrescue missionsevered legblack magiccrude humorswearingteleportationpipe smokingpalacetorso cut in halfpractical jokemazefemale fighterscene before opening creditsgiant monsterhuman sacrificeworld dominationmegalomaniacstonersorcerertavernkiss on the lipskidnappershapeshiftinganimated creditsriddletwo brothersone woman armycompassthronelong haired malehorse drawn carriageeclipsesuit of armordouble entendrestabbed in the footwarlockgiant creaturescalpingroyal weddingminotaurswordplaybest manoutnumberedwedding daybad singingevil sorcererchastity beltseerheir to the throneclothes torn offmaking facesstorybookman woman fightmanservantspeared to deathwhipping someonemagical staffthong bikinimechanical birdthrowing a speartackled to the groundsaying booarm chopped offspear in chest (See All)

Pompeii (2014)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Pompeii (2014)

Set in 79 A.D., POMPEII tells the epic story of Milo (Kit Harington), a slave turned invincible gladiator who finds himself in a race against time to save his true love Cassia (Emily Browning), the beautiful daughter of a wealthy merchant who has been unwillingly betrothed to a corrupt Roman Senator β€¦. As Mount Vesuvius erupts in a torrent of blazing lava, Milo must fight his way out of the arena in order to save his beloved as the once magnificent Pompeii crumbles around him. (Read More)

Subgenre:
martial artsmelodramaepicdisaster filmdisaster movie
Themes:
torturemurderdeathrevengekidnappingpoliticsprisondeceptiondeath of fatherdeath of motherblackmailunrequited lovemurder of family
Locations:
villageforestlondon englandwoodsship
Characters:
action herowarriorhusband wife relationshipfather daughter relationshipmother daughter relationshipsoldierhostagesister sister relationshiptough guymayor
Story:
bow and arrowsword and sandalhorse chasehand to hand combatsword fightperson on fireknife throwingstabbed in the legguardtorchbattlefieldloss of fatherkicked in the facestatuestabbed in the chest β€¦stabbed to deathcombatshowdownfalling from heightswordrescuehorsefistfightfireknifeexplosiondogbloodviolenceone word titleflashbackbare chested malekissfighttitle spoken by characterchasebeatingslow motion scenepunched in the facebattlebrawldecapitationorphanwinestrangulationaxemassacremountainthroat slittingarmyimpalementmixed martial artsprisonersevered headanti heroone man armychild in perilunderwater sceneprincesstrainingattempted murderone against manystabbed in the backrace against timelightningexploding bodyneck breakingthreatened with a knifesevered armloss of motherwhippingbare chested male bondageriotdisasterfalling down stairsdestructionburned alivespearheavy rainscene during opening creditshelmetslaveryexploding buildingkicked in the stomachforbidden lovefestivalinterracial friendshipcrushed to deathsocial commentaryearthquakeslaveshieldfloodblood on facedual wieldstabbed in the throatwhip3 dimensionaltitle appears in writingescape attemptsenatorpunched in the chestvolcanodeath of sisterdungeontribepassionate kisschainburned to deathbeheadingburied aliveshipwreckvillastabbed in the armemperorlavafilm starts with textarenastablebritainnatural disasterancient romegladiatorrighteous ragecorrupt officialdeath of familyexploding shiptsunamianimal killingwaveloinclothbitecarriagemacehorse drawn carriageno survivorsroman empirebuilding collapseromancell matevolcanic eruptionbare knuckle fightingmusculartidal wavespear throwing1st centurychariotcoastal towncelticcolosseumdoomed romancefinger bitten offsinkholehead held underwaterashgiant wavetunicwooden swordamphitheaterbeheadedtogashivslave auctionvolcano eruptionmale bondageforbidden romancepompeiimount vesuviusgolden eaglepyroclastic flowblood on backmuscular physiquemap on screentown in titlewhirlwind romance (See All)

Ben-hur (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Ben-Hur (2016)

Subgenre:
epicchrist allegory
Themes:
murderdeathloverevengemarriagereligionbetrayaljealousypoliticsescapedeceptionangerbrutalityredemptionfaith β€¦home invasionexecutionhopeblindnessvengeanceamnesiaforgivenessself sacrificenear death experience (See All)
Locations:
villagebeachsnowcemeterydesertwaterseashiprooftopcaveoceancampfiresea battle
Characters:
warriorfamily relationshipshusband wife relationshipmother son relationshipfather daughter relationshipmother daughter relationshipbrother sister relationshipsoldierhostagetough guyreference to godchristianityteacher student relationshipjewchildhood friend
Story:
flaming arrowshot with an arrowbow and arrowsword and sandalsword fightperson on firearcherarcheryjerusalemdaggertorchrebelprincebattlefielddisarming someone β€¦stabbed in the chestcombatshowdownletterswordshot in the headshot in the chesthorsefireknifeexplosiondogcharacter name in titlebased on novelbloodviolenceflashbackbare chested maledancingtitle spoken by characterpartysurprise endingvoice over narrationcorpseremakeslow motion scenebattlearrestorphanaxemountainmontagearmyprisonernonlinear timelinefalse accusationno opening creditsassassinationunderwater sceneracial slurtrainingflash forwardtentlightninglong takecrossgiftreunionthreatened with a knifesevered armwhippingbare chested male bondageclass differencesqueencircusassassination attemptheavy rainfriendship between menhelmetslaverycrucifixbeardrebellioncrying mancompassionsocial commentarydebateslavepresumed deadcelebrationreverse footageshieldresistancewhiphatredmercilessnessdeath threatgreecemiracleoilsibling rivalryrainstormbalconybetwar veterankingdomstadiumsevered legmoral dilemmapalaceman cryingbriberynarrated by characteroppressioncrucifixionfinal showdownspiral staircasemale friendshiphorse racingamputeegovernorraftemperordrumcheering crowdarenahead injurywagerpalm treestablefight the systemchainedparaplegicbettingancient romecarpenterbowhorse racefreedom fighterresistance fighterbanquetdreadlocksloinclothtotalitarianismnomadloss of memoryrowingroman empiredinner tablestabbed in the sideromansheikcaught in the rainjesus christlobotomydiscipleseparation from familydeus ex machinasinking shipnaval battle1st centurychariotfirst aidleprosycrucifixion of jesusroman soldierjerusalem israelcannonballzealotoarreference to julius caesarjulius caesarenslavementlepertunicshackledadopted brotherslave girlcenturionremake of remakeriding accidentroman legionchariot racepontius pilatefast forwardleper colonyadrifttrampledcapsizeroman armycarrying someone over shouldercoliseumrebel fighterroman salutewhipping scars (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Excalibur (1981)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Excalibur (1981)

The myth of King Arthur brought once again to the screen. Uthur Pendragon is given the mystical sword Excalibur by the wizard Merlin. At his death Uthur buries the sword into a stone, and the next man that can pull it out will be King of England. Years later Arthur, Uthur's bastard son draws Excalib β€¦ur and becomes king. Guided by Merlin, Arthur marries Guenivere and gathers the Knights of the Round Table. Arthur's evil half-sister Morgana sires a son with him, who may prove his downfall. (Read More)

Subgenre:
sword and sorcery
Themes:
magicfriendshipdeathsurrealismmarriageinfidelityadulteryfearescapedeceptionincestangerbrutalitysupernatural powerdying β€¦falling in love (See All)
Mood:
affection
Locations:
castleforestwaterwoodslakecave
Characters:
witchhusband wife relationshipfriendlustevil witchself injury
Story:
sword and shieldkilled with a swordhand to hand combatsword fighthalf brothermiddle agessiegemedieval timesknightpassionkingstabbed in the cheststabbed to deathstabbingcombat β€¦swordhorsefiremale rear nudityfemale nuditymale nuditynuditybloodviolenceone word titlefemale frontal nuditysex scenekissfemale rear nudityfighttitle spoken by characterbased on bookbeatingcorpseblondebattlebrawlmale pubic hairold manaxemassacredisguiseimpalementsnakebrunettefictional wartransformationpublic nuditytreelegendmissiondragonrabbithangingtragic eventdeath of husbandhorse ridingqueenspearquesthelmetmagiciancovered in bloodforbidden lovewizardfogdead maneye gougingarmorattractionowlcrowspellhistorical fictionassumed identitydying manpatricidebleedinghanged manflamebloodshedmatricidebritish renaissancewhite dressrise and falldying wordsweepinghalf sistermagical swordevil powerking arthurholy graildeath by impalementdeath of main charactercamelotexcaliburarthurian legendattempted escapebloodstainmace the weaponround tablefighting with selfjoustknights of the round tablerape by deception6th centurysword in stone5th century (See All)

Warcraft (2016) is one of the best movies like Robin Hood: Prince Of Thieves (1991)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Warcraft (2016)

When the world of the Orcs of Draenor is being destroyed by the evil fel magic that uses life-force, the powerful warlock Gul'dan creates a portal to the world of Azeroth and forms the Horde with members of the Orc clans. He also captures many prisoners to keep the portal open. The king of Azeroth,  β€¦Llane Wrynn and his brother-in-law, Anduin Lothar are informed by the apprentice of magician Khadgar that he has found fel magic in dead bodies and the king decides to summon the Guardian of Tirisfal, Medivh, to protect his kingdom. Lothar and Khadgar head to Kharazhan to meet Medivh and an ominous shadow points a book out to Khadgar, who takes it and hides. Anduin, Khadgar and Medivh and a group of soldiers are attacked by Orcs and they capture the slave Garona, who is released by King Llane, and she shows them the location of the portal. Garona is contacted by the Orc chief of a clan Durotan that wants to meet King Llane to stop the fel magic. Meanwhile Khadgar learns that the gate was opened with the help of someone in Azeroth. Shall King Llane trust Garona and Durotan, who might be the traitor? (Read More)

Subgenre:
sword and sorceryepicdark fantasysword and fantasy
Themes:
magicpregnancymurderfriendshipdeathrevengesurrealismbetrayalghostfeardrunkennessescapefuneralmonsterinvestigation β€¦deceptionangercorruptionbrutalitysupernatural powersadismexploitationhopeself sacrificeregret (See All)
Locations:
castlevillageforestchurchsnowwoods
Characters:
action herowarriorbabyhusband wife relationshipfather son relationshipmother son relationshiptattoobrother sister relationshipsoldierhostagetough guysingle fatherpregnantengineer
Story:
sword duelhorse chasesword fightdaggerraidguardtorchknightrebelprincebattlefieldchildbirthkicked in the facestatueattack β€¦duelkingstabbed in the cheststabbed to deathambushgood versus evilcombatrivershowdownfalling from heightswordrescueshot in the headshot in the chesthorsefistfightfireknifeexplosionbased on novelbloodviolenceone word titlebare chested malefightchasesurprise endingvoice over narrationbeatingcorpseshot to deathblood splatterslow motion scenepunched in the facebattlearrestbrawlbookinterrogationdemonsubjective cameradecapitationsurvivalstrangulationaxemassacremountaindeath of friendthroat slittingarmyimpalementprisonermapsevered headno opening creditsanti herobirdchild in perilfictional wardouble crossritualunderwater scenecreaturetransformationone against manytreelibrarycursecharacter repeating someone else's dialoguebeaten to deathstabbed in the backprologuewidowerelectrocutionrace against timetentevil manknocked outtough girllightningskeletonmanipulationscarexploding bodydeath of sondeath of husbandneck breakingsuspicionthreatened with a knifesevered armqueensubtitled scenestylized violencesingle parenthenchmaneavesdroppingtraitorwolfloyaltydestructionrevelationhead butthelmetslaverytold in flashbackjail cellmagiciancaptivebeardhammerexploding buildingkicked in the stomachplanetblockbustergiantpoolsevered handcovered in bloodsheepskullmind controlhonorburialaction heroineanimal attackcrushed to deathslavefemale warriorfull moonbarefootdwarfreverse footageshieldinvasionfight to the deathloss of soninventorhatredbased on video gamemercilessnesschaosstabbed in the neckshot in the faceevacuationwizardstabbed in the headswamp3dpunched in the chestdisembowelmentvolcanoaerial shotdungeontitle at the endcapturedeerdisfigurementtribedemonic possessionkingdomloss of husbandmutationblack magicwilhelm screamtelekinesisexorcismteleportationpalacetelepathyimprisonmentelfclose up of eyesfemale soldierblood on camera lensnarrated by characteranti warfinal showdownoutcastfemale fighterspiral staircasedoubtgiant monsterhuman sacrificetreasonportalworld dominationmegalomaniaccrowninterracial marriagesorcererhead bashed inreluctant heromercy killingshamanblizzardcolonialismoffscreen killingbitten in the neckcrushed headleaderwoman kills a manstabbed in the shoulderguardianfinal battlepart computer animationcamouflageshape shifterwoman fights a mandistrustjailbreakwarlordhit with a hammersymbolreclusemind readingcavalryanimal killingarmy basefade to blackapprenticedreadlocksforce fieldimmolationrookieanti heroineglowing eyesarmorypower struggleretreatmacehorse drawn carriagebarracksscrollleadershipdecomposing bodytranslationcollapsing buildingmysticwarlockbody armorgiant creaturecribdisobeying orderscouncilcaged humancubebook burninggolemburnt handclancrisis of consciencecolonizationgreen bloodevil sorcererbegins with narrationlegionpyrokinesisorcmagical ringshape shiftingevil wizardmagewarrior racesurroundedgreen skinhordetunicsceptermusclestooth ripped outfloating in spacegiant birdinanimate object comes to lifesecret meetingwar roomfictional languagefloating citytuskchieftainstabbed through the backlife force sucked out (See All)

The Hobbit: The Desolation Of Smaug (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Hobbit: The Desolation Of Smaug (2013)

After successfully crossing over (and under) the Misty Mountains, Thorin and Company must seek aid from a powerful stranger before taking on the dangers of Mirkwood Forest--without their Wizard. If they reach the human settlement of Lake-town it will be time for the hobbit Bilbo Baggins to fulfill h β€¦is contract with the dwarves. The party must complete the journey to Lonely Mountain and burglar Baggins must seek out the Secret Door that will give them access to the hoard of the dragon Smaug. And, where has Gandalf got off to? And what is his secret business to the south? (Read More)

Subgenre:
sword and sorcerymartial artscoming of agedark fantasysword and fantasy
Themes:
magicmurderdeathrevengedrunkennessescapemonsterdeceptionredemptionunrequited lovehome invasiongreed
Mood:
rainnightmare
Locations:
castlevillageforestsnowsmall townboatwoodscave
Characters:
action herowarriorthieffather son relationshipfather daughter relationshipbrother sister relationshipsoldierhostagetough guylove trianglemayorsingle father
Story:
shot with an arrowbow and arrowhand to hand combatsword fightperson on fireknife throwingballadeerfriends who live togetherstabbed in the legguardgoldkingstabbed in the cheststabbed to deathambush β€¦good versus evilshot in the backcombatriverfalling from heightswordrescueshot in the headshot in the chestfistfightfireknifeexplosioncharacter name in titlebased on novelbloodviolencesequelflashbackfightphotographtitle spoken by characterpartychasedreamshot to deathblood splatterwritten by directorbattlearrestbrawlsecond parthallucinationsubjective cameradecapitationfoot chaseassassinstrangulationaxemountainthroat slittingbridgearmyimpalementmixed martial artsmapfishsevered headno opening creditschild in perilfictional warunderwater scenecreatureshot in the legtransformationshot in the foreheadcharacter repeating someone else's dialoguestabbed in the backkeyfantasy sequencepoisoncharacter's point of view camera shotdragonrace against timeknocked outtough girlskeletonringshot in the shoulderscarneck breakingtrapwaterfallshot in the armpubsubtitled scenestylized violencesingle parenticefalling down stairskilling an animalspearassassination attemptquestbarnjail celltreasureblockbustergiantskullaction heroineanimal attackgoatfemale warriordwarfshieldburglarflooddual wieldstabbed in the throat3 dimensionalstabbed in the neckshot in the facewizardprophecystabbed in the headfogcapturedisfigurementstabbed in the eyeeye patchlens flarekingdomprequelteleportationpipe smokingtorso cut in halfelftombfemale soldierinvisibilitydirector cameoshot in the neckfemale fightergiant monsterbeeamputeestabbed in the armwellshot in the eyecrystaldammushroomstabbed in the shoulderclimbing a treeshot in the throatdisfigured faceopen endedcorrupt officialshapeshiftingsubterraneanjewelfreedom fighterbarrelclose up of eyeanimal killingforce fieldarmoryleg woundburning buildinghumangiant spiderchopping woodstabbed in the mouthgold coinwheelbarrowhidden doorwine cellargiant creaturelost in the woodsorbdog sledfire breathing dragoncliffhangerspider webhealing powerstaringcocoonsignalhobbitmoonlightprequel and sequelnecromancersinger offscreenflying dragonminstrellive action remaketapestryflatterywinged dragonwhite mouseapprehensiongold ringstone bridgetalking dragongold statuepoisoned arrowsilver coinbare foot manpile of goldsleepyglowing crystalthrush (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Showing Top 50 Matches Above.
Do you need specific genre & keyword selection to find films similar to Robin Hood: Prince Of Thieves?
<< FIND THEM HERE! >>