Please wait - finding best movies...
Molly Mahoney is the manager of Mr. Magorium's Wonder Emporium, the awesome toy store owned by Mr. Edward Magorium. Molly was a promising composer and piano player when she was a girl, and now she is a twenty-three year-old insecure woman who feels stuck in her job. Among the costumers of the Empori β¦um is the lonely hat collector, Eric Applebaum, who has only Molly and Mr. Magorium for friends. When the last pair of shoes that Mr. Magorium bought in Toscana is worn, he hires the accountant, Henry Weston to adjust the accounts of the Emporium. Furthermore, he claims that he is two hundred and forty-three years old and his time to go has come; he gives a block of wood called Congreve cube to Molly and asks Henry to transfer the Emporium to her name. Molly tries to convince Mr. Magorium to stay in his magical toy store instead of "going". (Read More)
Subgenre: | independent film |
Themes: | inheritancechildhoodmagicfuneraldeathfriendship |
Locations: | cemeterybeachnew york cityhospital |
Characters: | little boymusiciandoctor |
Story: | magic shopreference to rachmaninoffreference to shakespeare's king learanthropomorphic toyreference to thomas edisonlemurpogo stickreference to napoleonmotivationaltoy storezebrasheet musiccity parkgoosereference to abraham lincoln β¦reference to albert einsteinrhyme in titlescooteraccountantsurprise after end creditsscene after end creditsshopping malljob interviewchild's point of viewimaginationanthropomorphismpart animationcomposereccentrichatfaintingperiod in titlereference to william shakespearepianistpuppetgravevoice overpianoapostrophe in titletearspunctuation in titlecharacter name in title (See All) |
In Bedridge, Professor Parker Wilson finds an abandoned dog at the train station and takes it home with the intention of returning the animal to its owner. He finds that the dog is an Akita and names it Hachiko. However, nobody claims the dog so his family decides to keep Hachi.
Themes: | funeralfriendshipdeathlovechristmasjealousypregnancyweddingmemorydeath of fathertheatre |
Mood: | raintearjerker |
Locations: | cemeteryschoolsnowairplanebathtubkitchenjapanstormshed |
Characters: | family relationshipshusband wife relationshipfather daughter relationshipmother daughter relationshipafrican americanfriendboyteachergirlstudentdancerbabyjapanesegrandfather grandson relationshipgrandmother grandson relationship β¦human animal relationship (See All) |
Story: | reference to thomas edisonmotivationalreference to william shakespearepianistpianoapostrophe in titletearspunctuation in titlecharacter name in titleflashbackdogsex scenekissdancingbased on true story β¦telephone callcryingremakewatching tvcomputercatcamerabeeranimal in titlebedclassroomsubjective cameranewspaperdeath of friendmontagewidowanimalcoffinforeign language adaptationbathflash forwardsuburbbased on short storychampagnecharacter's point of view camera shotflowersdeath of husbandballetclasssleepingblack americanheart attackpickup truckapplauseloyaltywhat happened to epilogueslow motioncagetold in flashbackrailway stationmilkinterracial friendshipremote controlwindmobile phoneballbookstoresnowingpuppywedding receptionphoto albumposterstairwayfencepopcornbellballerinatrain tracksepiloguecollege professorgravestonereference to shakespeare's hamletpolaroid camerashared bathwaitingdog moviebride and groomnewspaper reporterstreet vendorpoodlehot dog standskunkdog lovertalking to a dogbutcher shoprhode islandlost dogdog poundbarkinglocked in a cageboy dog relationshiptripping and fallingdoghousehot dog vendorreference to christopher columbusremake of japanese filmremake of asian filmanimal's point of viewcommuterart restorationmaster dog relationshipbarbecue grillwatching through a windowwedding photographbaggage handlerchange of seasonsdog cagefrench poodlestation masterdog's point of viewanimal licking someoneakitabaseball on tvmusic professorplaying fetchschool report (See All) |
When 'Walt Disney' (qv)'s daughters begged him to make a movie of their favorite book, 'P.L. Travers' (qv)' _Mary Poppins (1964)_ (qv), he made them a promise - one that he didn't realize would take 20 years to keep. In his quest to obtain the rights, Walt comes up against a curmudgeonly, uncompromi β¦sing writer who has absolutely no intention of letting her beloved magical nanny get mauled by the Hollywood machine. But, as the books stop selling and money grows short, Travers reluctantly agrees to go to Los Angeles to hear Disney's plans for the adaptation. For those two short weeks in 1961, Walt Disney pulls out all the stops. Armed with imaginative storyboards and chirpy songs from the talented Sherman brothers, Walt launches an all-out onslaught on P.L. Travers, but the prickly author doesn't budge. He soon begins to watch helplessly as Travers becomes increasingly immovable and the rights begin to move further away from his grasp. It is only when he reaches into his own childhood that Walt discovers the truth about the ghosts that haunt her, and together they set Mary Poppins free to ultimately make one of the most endearing films in cinematic history. (Read More)
Subgenre: | disney |
Themes: | childhooddeathfilmmakingdeath of fatherdysfunctional familycelebrityalcoholism |
Locations: | bartrainswimming poolhotellos angeles californialondon englandtaxiairportrural settingaustralia |
Characters: | musiciandoctorhusband wife relationshipfather daughter relationshipmother daughter relationshipsingerbabywriterlittle girlalcoholicmaidfilmmakeraustralianyounger version of characterself pity |
Period: | 1960syear 1964year 1961 |
Story: | sheet musicreference to albert einsteincomposerperiod in titlepianistvoice overpianotearscharacter name in titlebloodinterviewflashbackdancingphotographsinging β¦three word titlebased on true storycryingsongcorpsehorsewatching tvbookrunningbritishriverreporterwomansuicide attemptnonlinear timelinedrawingbartenderlimousineauthormicrophonebankspeechloss of fatherstagecinemachickentypewritersisterpoemapplauseshavingtape recorderfameagenthollywood californiamovie theaterrehearsalaudienceguardmovie theatreremote controlfanpet dogpost traumatic stress disorderawardsketchfilm producersongwriterabbreviation in titlehorse and carriagecrowdmusic bandnannychauffeurwifegateautographstewardessbillboarddrunkardbankershow businessmovie studiopalm treepressbased on real personcarouselscripttheme parkhorse and wagonmerry go roundkangaroostraight razorbuddhaairlinerspinsterice cream conebedriddenfairgroundliquordisneylandpremiereoil lampstorytellergalareference to walt disneyaudio tapesongwritingscriptwriterspeakerclotheslinescreenstuffed toymistrusthorsebacklyricsreference to vincent van goghpast and presenttraumatic childhoodcherry blossomreference to laurence oliviersick fatherpeargiving a speechjellychildren's authorcoughing up bloodabusive childhoodyear 1906premierreference to mary poppinsmaking of a moviereference to franklin delano rooseveltreference to alec guinnessreference to frida kahlo (See All) |
James' happy life at the English seaside is rudely ended when his parents are killed by a rhinoceros and he goes to live with his two horrid aunts. Daringly saving the life of a spider he comes into possession of magic boiled crocodile tongues, after which an enormous peach starts to grow in the gar β¦den. Venturing inside he meets not only the spider but a number of new friends including a ladybug and a centipede who help him with his plan to try and get to New York. (Read More)
Subgenre: | cult film |
Themes: | magicsurrealismtravelrivalryblindness |
Mood: | nightmare |
Locations: | new york cityseaengland |
Characters: | little boyfamily relationshipsfriend |
Story: | surprise after end creditsscene after end creditschild's point of viewpart animationcharacter name in titlebased on novelbased on bookdreammirrordrinkswordfalling from heightbirthdaymanhattan new york cityorphan β¦child abusetransformationtreeskeletongiftloss of fatherloss of motherrunawayropewhat happened to epiloguelifting someone into the airspidersharkviolinanthropomorphic animalhungerauntcar troublehot dogseagullcheesefriends who live togetherpart live actionbagcalendarmysterious strangergiant spiderfruit in titlerhinocerosgiant insectempire state building manhattan new york citylifting male in airpart animatedneglected childvagabondpeachcentipedegrasshopperearthwormgiant wormchicken as foodanthropomorphic insectpart stop motion animationroald dahlshark fin above water (See All) |
The world is astounded when Willy Wonka, for years a recluse in his factory, announces that five lucky people will be given a tour of the factory, shown all the secrets of his amazing candy, and one will win a lifetime supply of Wonka chocolate. Nobody wants the prize more than young Charlie, but as β¦ his family is so poor that buying even one bar of chocolate is a treat, buying enough bars to find one of the five golden tickets is unlikely in the extreme. But in movieland, magic can happen. Charlie, along with four somewhat odious other children, get the chance of a lifetime and a tour of the factory. Along the way, mild disasters befall each of the odious children, but can Charlie beat the odds and grab the brass ring? (Read More)
Subgenre: | cult filmcoming of age |
Themes: | inheritancemagicsurrealismdancepovertyredemptionrivalrygreedwealth |
Mood: | poetic justice |
Locations: | restaurantschoolboatelevatorurban settinggermanytunnel |
Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipchildrenboyteachergirlsingle mothergrandfather grandson relationship |
Story: | goosechild's point of viewimaginationeccentricfaintingpunctuation in titlecharacter name in titlebased on novelslow motion scenecomputerbirthdayrivertelevisionspyfactory β¦split screencontestgiftsix word titleclass differencesampersand in titletv newsflyinglifting someone into the airfbi agentimpersonationwhite houseransomdwarfinventorchild protagonistarizonadisfigurementcaneauctioncontractchocolatecandylaundrytv reporterprizechewing gumfriends who live togethertour guideschoolteacherrags to richesluckfamous scoreforgeryhonestypsychotherapytrapdoorreclusemontanaticketrecipeindustrialistminiaturizationspoiled bratscreenplay adapted by authorwish fulfillmentlifting male in airinvalidspoiled childgluttonyindustrial espionagecandy barbelchpleadingpaperboygeesegrandparentnewsstandwallpapersteamboatcandy storeoverweight childused car salesmanchocolate factorymanufacturersudden change in sizecouch potatoused car dealertelevision addictionimaginary creaturelaundresstest of characterpaddlewheel boattinkercompeting businessesconfectionerscanimate (See All) |
While Andy is away at summer camp Woody has been toynapped by Al McWiggin, a greedy collector and proprietor of "Al's Toy Barn"! In this all-out rescue mission, Buzz and his friends Mr. Potato Head, Slinky Dog, Rex and Hamm springs into action to rescue Woody from winding up as a museum piece. They β¦must find a way to save him before he gets sold in Japan forever and they'll never see him again! (Read More)
Subgenre: | martial artscult filmcomputer animationcgi animation |
Themes: | friendshipkidnappingescapeherotheftredemptionhopegreedadoption |
Mood: | nightmarecar chase |
Locations: | airplaneairportelevatorouter space |
Characters: | little boyhusband wife relationshipfriendbabytough guysingle mothervillainself referential |
Period: | 1990s |
Story: | anthropomorphic toytoy storereference to abraham lincolnanthropomorphismhatnumber in titleviolencesequeldogfightchaseshootoutdreamdigit in titlefistfight β¦mirrorrescueslow motion scenebattlegunfightbrawlfalling from heightshowdownsecond partnumbered sequelfightingapologyno opening creditskaratesuburbcowboymistaken identitydollopening action scenetragic eventsevered armdestinyloyaltyflyingtoyblockbusterjumping from heightvisitpart of trilogylaserdinosaurbroken armlaser gunbloopers during creditsohiocartoon dogpenguinrace carcartoon violencefriends who live togethertour guideoverweightcollectorclawstealthchoicehopelessnesssuper nintendocomic herosecond in trilogytoy comes to lifebarbie dollcgi filmbattering ramconveyor beltbarbielicense platepiggy bankyard saleprospectorshot with a laser gunself fulfillmentchicken suitmr potato headcancellationetch a sketchcartoon penguintroll dollbuzz lightyeartraffic coneairplane cargoslinky dogsqueeze toy (See All) |
Jesse Aarons trained all summer to become the fastest runner in school, so he's very upset when newcomer Leslie Burke outruns him and everyone else. Despite this and other differences, including that she's rich, he's poor, and she's a city girl, he's a country boy, the two become fast friends. Toget β¦her, they create Terabithia, a land of monsters, trolls, ogres, and giants and rule as king and queen. This friendship helps Jess deal with the tragedy that makes him realize what Leslie taught him. (Read More)
Subgenre: | coming of agesupernatural |
Themes: | childhoodmagicfriendshipdeathartangerdysfunctional familygriefboy girl friendshipdeath of best friend |
Locations: | churchforestwoodsrural settingfarmpolice carmuseumschool busschool teacherart museumschool bullynew girl in townschool friend |
Characters: | little boyfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipfriendbrother sister relationshipteenage girlteenage boyteacherpolice officerstudent β¦artistbest friendlittle girlbullyteacher student relationshipchildhood friendlove letterbest friendsblonde girlnew friend (See All) |
Story: | child's point of viewimaginationpianisttearsbased on noveldogdancingphotographsingingthree word titlebased on bookpunched in the facewatching tvpaintingplace name in title β¦runningbirthdayclassroomdeath of friendbridgedrawingkingkeyfantasy sequenceproduct placementstorytellingdolltragic eventqueenbirthday cakeroperacelifting someone into the airloss of friendguitaristcrushcgirealitypet dogbelief in goddeerswingkingdomatheistdead girlbirthday presentfemale teacheroutsidertween girlcrownsquirrelgreenhousefantasy worldblackboardtrollanguishrunnerchurch servicegrievingcreeknext door neighbororganistsocial outcastlifting a female into the airgirl next doornonconformityschoolyardfalling from a treelittle sisteranimal trapreference to leonardo da vincineglected childsketchbookbelief in hellpoor familyfemale bullyclubhousereality vs fantasysinging happy birthdaymake believeschoolboy crushtwo friendsfoot racetree houseanimate treeteacher crushreference to theodore rooseveltoff screen deathswinging on a ropemusic classtree swingsobbing femaleimaginary worldfear of hellrope swingrunning racedog as a giftcatching someone who fallsreference to teddy rooseveltknocked to the groundlost keysmuseum tripreference to pieter bruegelwooden bridgelog bridge (See All) |
'Louisa May Alcott' (qv)'s autobiographical account of her life with her three sisters in Concord, Massachusetts in the 1860s. With their father fighting in the American Civil War, sisters Jo, Meg, Amy and Beth are at home with their mother, a very outspoken women for her time. The story tells of ho β¦w the sisters grow up, find love and find their place in the world. (Read More)
Subgenre: | coming of age |
Themes: | deathmarriagechristmaspregnancydysfunctional familyillnesstheatrehopewritingfirst love |
Mood: | affection |
Locations: | new york citysnowparis francerural settingusa |
Characters: | doctorfamily relationshipshusband wife relationshipfather daughter relationshipmother daughter relationshipsingerteenage girlfemale protagonistgirlsoldierbabywritersister sister relationshipartistlittle girl β¦maidprofessorpregnant wife (See All) |
Period: | winter19th century1860s |
Story: | sheet musicreference to william shakespearepianistvoice overpianotearsf ratedbased on noveldancingsingingpartytitle directed by femalecatletterpainting β¦neighboroperacandleold manchild abusepaintermarriage proposalbinocularscostumechristmas treechildbirthreunionstageactingtwincivil warfireplacedressbirthrealitypet dogfeministchristmas evemay december romanceice skatingyoung loveboarding schoolgrowing upplayhorse and carriageviolinistvictorian eragiving birthtriple f ratedepidemicpublisherreading aloudtween girltomboysicknessenvykittenmailboxtutoramerican civil warbroken heartloss of sistermassachusettsmanuscripttelegramhorse and wagonpet catexpectant motherchristmas carolhomeworkboarding housechristmas decorationsnightgownreference to charles dickensgovernessoil lampstorytellerchalkboardfalling through icebuggyboarderu.s. civil warpost civil warfood shortagecurlingcanvasreference to walt whitmanreference to goethepantaloonemotional healingpregnant sisteremotional depressionreference to friedrich schillerscarlet feversnow sleddingbirth of twinsdance ball (See All) |
In this update of Disney's masterpiece film mixture of animation and music, new interpretations of great works of music are presented. It begins with an abstract battle of light and darkness set to the music of Beethoveen's Fifth Symphony. Then we see the adventures of a Humpback Whale calf and his β¦pod set to "The Pines of Rome." Next is the humourous story of several lives in 1930's New York City, scored with "Rhapsody in Blue." Following is a musical telling of the fairy tale, "The Steadfast Tin Soldier" set to Dmitri Shostakovich's Piano Concerto No. 2. Then a goofy Flamingo causes havoc in his flock with his yo-yo to the tune of the finale of "Carnival of the Animals." This is followed by the classic sequence from the original film, "The Sorcerer's Apprentice" starring Mickey Mouse and followed by "Pomp and Circumstance" starring Donald Duck as a harried assistant to Noah on his Ark. Finally, we see the awesome tale of the life, death and renewal of a forest in a sequence featuring the composition, "The Firebird." (Read More)
Subgenre: | fairy taledisneybiblical |
Themes: | magicdeathsurrealismjealousyfearartnatureangertheftunrequited lovehopeunemploymentfreedombook of magic |
Mood: | rainarchive footagepoetic justice |
Locations: | new york citytrainswimming poolforesthotelcarsnowboatnightclubdesertbicyclewatertaxielevatorwoods β¦apartmentlakeshiptruckrooftopcaveoceansewerforest fire (See All) |
Characters: | musicianfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipteacherpolice officerdanceractorartistlittle girlbullywaitresscomedianfisherman |
Period: | 1930swinter |
Story: | zebrasheet musiccity parkanthropomorphismpart animationfaintingpianistpianotearsnumber in titlesequeldogkissdancingknife β¦chasefirecryinghorsemirrorremakerescuecatfalling from heightbookrunningcaferiversubjective cameranewspaperaxemountainsubwaysnakefishdream sequencedrawingfishingsearchanthologycoffeepaintreeportraitumbrelladragondollrabbitlightningscreamsadnessratunderwaterbearnewspaper headlinemonkeyjazzicewolffireplacedestructionperformanceelephantmagicianmousetoyoverallsclassical musicfrogtennisrailway stationviolinmilkorchestragoatclockembarrassmentapplepresumed deadfloodtrappedthunderhypocrisymisunderstandingpet doganthropomorphic animalrejectionhungerdespairdrummerballlaughterlionbutterflyice skatingvolcanodaydreamshadowspyingdeerturtlecliffduckboxhorse and carriageflightweathercoinbatjoycamelspellimaxhandshakenew jobmagic trickclosetconstruction workerfountainwhalefoxadvertisementpaintdoubtremorsebottlestonechoreographyescalatorwoodtemptationbeeperformerpopcornfalling into waterseagulllavaquitting a jobjacketsorcerercloudhostgreat depressionballerinadisappointmentimmaturityeaglealligatorasheshammockcrabmeteorpart computer animationrainbowhonestymistakeapepart live actiondrillpolar bearclumsinessconductorgymnasticskangaroowindowmiseryspringabstractcourtshipdoormanapprenticelocketgiraffenoiseblanketdoverebirthunicornrevolving doordance lessonregenerationstreet vendorice rinkbroombaldnesspaperdance classfaunaconformityflorasignextinctionnetsubway trainbucketbubblecoatphonograph recordvasehornrhinoceroswheelbarrowabstract artmovementfloatingostrichchestjazz clubfigure skatinghard hatleashvolcanic eruptioncartcollisionnoseorganisticebergskunksunlightcarrying someonehippopotamusimpressionismimitationbeaverdoughnutsnobberybowling ballyo yonight shifttoy comes to lifecraneindividualitysoundtrackperseveranceillustratorhigh risegrand central station manhattan new york cityjack in the boxlunchboxoxygen tankbad singingneon lightbowldisney animated sequelone legged manswimming lessonflamingopet storeelkiciclemarqueenoah's arkmilkmanfatiguehopscotchmusic lessonscubalife jacketramppuddlestooltripping and fallingashcauldronjazz combotubewhirlpoolarkcentral parkdizzinesssupernovaspellcastingbillporcupinespritetunicoversleepingfreight elevatorwoodpeckerbreathsleeping in a chairbrushcartoon reality crossoverswallowed wholetoy boatimpatiencesinging lessonelevator operatorleakpeanutchain reactionflower petalhenpecked husbandpantaloonwalnutlinebranchteardropflipperglowing eyestepping on someone's footdevastated landscapedramatic ironygriffinchorinefirebirdflooded roomtrampleddog bonetimingfruit cartlily padmagical hatseeing starscelebrity caricatureclub the weapontin soldierblowingbuilding blockpunch clocktennis lessoncushiondrumstickgesturegymnastic ringssquirting waterflotation devicegratehornbill (See All) |
1903 London. Renowned playwright 'J.M. Barrie (I)' (qv) (James)'s latest effort has garnered less than positive reviews, something he knew would be the case even before the play's mounting. This failure places pressure on James to write another play quickly as impresario Charles Frohman needs anothe β¦r to replace the failure to keep his theater viable. Out for a walk with his dog in part to let his creative juices flow, James stumbles upon the Llewelyn Davies family: recently widowed Sylvia Llewelyn Davies (the daughter of now deceased author 'George L. Du Maurier' (qv)) and her four adolescent sons. James and the family members become friends, largely based on he and the boys being able to foster in each other the imagination of children, James just being the biggest among them in this regard. Sylvia also welcomes James into their lives, he who becomes an important and integral part of it. Among the six of them, the only one who does not want to partake is Sylvia's third, Peter Llewelyn Davies, who is still grieving the reality of their lives, where his father was there one day planning an outing for the family, and gone the next. Two other people who don't appreciate James in the Llewelyn Davies' lives are: his wife, Mary Barrie, who always feels the need to be the responsible one in their relationship and who feels threatened by his friendship with an unmarried woman; and Emma du Maurier, Sylvia's overbearing mother, who sees him as an obstacle to Sylvia moving on with her lβ¦ (Read More)
Themes: | childhoodfuneralfriendshipdeathmarriagedeath of mothergrieftheatre |
Mood: | rain |
Locations: | cemeteryhospitallondon englandengland |
Characters: | little boydoctorfamily relationshipshusband wife relationshipmother son relationshipmother daughter relationshipbrother brother relationshipboyactorwritersingle mothermaidgrandmother grandson relationship |
Period: | 19th century1900s |
Story: | city parkimaginationtearsdogtwo word titlebased on true storybased on playslow motion scenefalling from heightplace name in titleneighbororphanwidowdinnertheater β¦authorcostumeclownfantasy sequencecountrysideloss of fatherstageloss of motherbearterminal illnesschesscircusapplausepiratelifting someone into the airloss of friendloss of loved onedysfunctional marriagerehearsaltimesheepcompassionorchestracannoncamera shot of feetfairypet dogtheatre audienceproducermarital separationtuxedocanebroken armloss of husbandnewspaper clippingpipe smokingunhappy marriageinspirationperformerplaywrightstage playcottagetheatre productioncoughingkitemarriage problemscountry housepark benchspoonbow tiesailing shipred winesittingcricketdying youngpremierejumping on a bedinvestormusic conductorplayingplatonic lovebuggyedwardian eraopening nightreference to peter panhook for handcynicmake believetheatrical troupewalking the plankchildren's authoryear 1903reference to rudyard kiplingtear on one's cheekcough foreshadows deathnewfoundland dogtheatre ownerpremiere party (See All) |
Soon after moving in, Beth, a brainy, beautiful writer damaged from a past relationship encounters Adam, the handsome, but odd, fellow in the downstairs apartment whose awkwardness is perplexing. Beth and Adam's ultimate connection leads to a tricky relationship that exemplifies something universal: β¦ truly reaching another person means bravely stretching into uncomfortable territory and the resulting shake-up can be liberating. (Read More)
Subgenre: | independent film |
Themes: | funeralinfidelityjealousyadulterydrinkingfearextramarital affairdeath of fatherguiltunfaithfulnessadoptionautismradiationgay adoption |
Mood: | moving |
Locations: | cemeterynew york cityrestauranttrainschoolsnowapartmentpolice carcourtroomofficeouter spaceschool director |
Characters: | little boyhusband wife relationshippolicefather daughter relationshipmother daughter relationshipafrican americanboyfriend girlfriend relationshipchildrenteacherpolice officerstudentpolicemanbabywriterlawyer β¦sister sister relationshiplittle girlemployer employee relationshipchineseengineerlesbian mother (See All) |
Story: | reference to albert einsteinaccountantjob interviewgravetearscharacter name in titlesexone word titlekissfightphotographtitle spoken by characterpartytelephone callvoice over narration β¦cryingcell phoneunderwearfoodmirrorwatching tvcomputerdrinkbookliebedcafeneighborclassroommanhattan new york citysubjective camerabedroomnew yorkcaliforniaeatingfalse accusationjudgeapologytrialvangraveyardflash forwardparktheaterauthorargumentfired from the jobchampagnemassagedollreadingflowerscourtamerican flaglaptopcharacter says i love youflowerloss of motherclassblack americantwenty somethingwaiterhugginganswering machinetealooking at oneself in a mirrorgay parentstrangerclockapartment buildingwatching televisionpromisetelescopestarnew jerseyplaygroundboxer shortsanxietyco workertheatre audiencefirst kisslesbian couplerefrigeratorsnowingnotelooking at self in mirrorplaybenchflagpresentshynessface maskloss of jobclosetlaundrytestimonycentral park manhattan new york citylast will and testamentreading aloudfencebroken mirrortheatre productionmessageastronomyforeplayquarreluniversetour guidepark benchreference to john f. kennedywashing machinegalaxylunchcalendarraccoonbreaking a mirrorinterracial adoptionspacesuitbroomcourthousequeens new york citysexual arousalreference to harry potterfired from a jobsolar systemfreezerasperger's syndromepadlocktelling a jokejoke tellingcartobservatoryastronomerlooking for a jobroutineschoolyardpre schoolchildren's bookcuddlinggrand central station manhattan new york cityreference to thomas jeffersonreference to mozartlaundry roomgrocerieslooking for workreference to wolfgang amadeus mozartbig bangjob applicationplanetariumtoy makerbreakfast cerealbig bang theorycentral parkreference to f. scott fitzgeraldreference to julia robertsreading to a childsaturn the planettv dinnerpicture booklonely man29 year oldcracked mirroroff broadwaychildren's authorsitting on stepsjail sentencesuspected paedophiledestroying a roommen's clothing storesurrogate unclewestchester new yorkreference to samuel beckettwatching a playkicking a canmacaronireference to clarence darrowwashing a windowfrozen foodsweeping a floorvoice recognitionpeople watchingreference to the little princetoy designer (See All) |
Alice is a daydreaming young girl. She finds learning poems and listening to literature boring. She prefers stories with pictures and to live inside her imagination. One day, while enduring just such a poetry reading, she spots a large white rabbit...dressed in a jacket and carrying a large watch. H β¦e scurries off, saying he's late, for a very important date. She follows him through the forest. He then disappears down a rabbit hole. Alice follows, leading her to all manner of discoveries, characters and adventures. (Read More)
Subgenre: | cult filmfairy tale2d animation |
Themes: | magicsurrealismanger |
Locations: | beachforestseaenglandocean |
Characters: | female protagonistgirlsister sister relationship |
Period: | 19th century1860s |
Story: | child's point of viewimaginationanthropomorphismhattearscharacter name in titlebased on noveldogtitle spoken by charactersingingpartychasethree word titlefirecrying β¦dreamcatfalling from heightbirthdayfishjudgetrialbirdanimalbirthday partyunderwater scenekingcreaturetransformationsmokingtreekeyumbrellarabbitflowersunderwatergardenflowertwinfireworksqueenmoonsisterteaeggtalking animalcakemousehammerblockbusterladderrealityeaten alivesandanthropomorphic animalrosesunbutterflycaneirreverencevictorian erainvisibilitybottlelizardcrownharmonicajurypocket watchfantasy worldtoastgiving a toastcookiemushroompipereading a bookaltered version of studio logomatchredcarpenterparallel universecarrotlobstercardsecret passagealternate dimensioncalendardooralice in wonderlandsugarlabyrinthcaterpillartitle appears in songminiaturizationdaydreaminghedgehogangryshrinkingoystertalking cattea partykeyholesneezeplaying cardit was all a dreamwhiteshoremalletwhite rabbitdimensionsentenced to deathcroquetflamingopaintbrushbad temperwalrusrocking horsestarfishmustardharehookahteapotspiderwebfalling into a holejamwonderlanddoorknoblift skirtsudden change in sizebird's nestrose gardenchanging sizesmoke ringteacupangry womanhybrid animalmad hatteranthropomorphic rabbitbloomersdodogrowing in sizerabbit holeanimal wearing clothesanthropomorphic flowergiantesscharacter shaped holecheshire catdodo birdenlargementlewis carrollno narrationqueen of heartsanthropomorphic sunred paintpied pipermispronounciationtalking flower (See All) |
Following the death of his father in Mexico, Stephane Miroux, a shy insecure young man, agrees to come to Paris to draw closer to his widowed mother Christine. He lands a boring job at a calendar-making firm and falls in love with his charming neighbor Stephanie. But conquering her is no bed of rose β¦s for the young man and the only solution he finds to put up with the difficulties he is going through is escape into a dream world... (Read More)
Subgenre: | independent filmabsurdismvideostop motion animation |
Themes: | magicfriendshipdeathlovesurrealismsuicidejealousydrinkingdrunkennessescapeartmemorytraveldeath of fathertime travel β¦dating (See All) |
Mood: | nightmaremoving |
Locations: | barparis franceboatbathtubtaxiapartmentpolice carfrancerooftopmexicomexico city |
Characters: | musicianfamily relationshipshomosexualfather son relationshippolicemother son relationshipfriendboyfriend girlfriend relationshipsingerboypolicemandancerwriterartist β¦interracial relationshipfrenchemployer employee relationshipsingle fatherneighbor neighbor relationship (See All) |
Story: | imaginationpart animationcomposereccentrichatpianistpianosexfemale nuditybloodmale nudityfemale frontal nudityflashbackmale frontal nudity β¦kisscigarette smokingdancingphotographmale full frontal nuditysingingpartypantiestelephone callfirevoice over narrationsongdreamunderwearhorsemirrorwatching tvdrinkletterpaintingbooklierunningbedcar crashlow budget filmneighborhallucinationmale pubic hairguitarrivertelevisiontelephoneswimminggay slurbedroomcookingbandconcertold mandrug dealerbridgewidowjokedinnerapologydream sequencedrawingbathold womanmarriage proposalparkspermcharacter's point of view camera shothalloween costumelong takedatesleepingtypewritersubtitled scenemoonbirthday cakeeyeglassesdisasterpornographyanswering machineshavingflyingbreaking and enteringslow motiontape recorderhelmetmagicianbuttocksflatulencevirtual realityhome movieschizophreniarealityearthquakecelebrationremote controlreverse footagetrappedshoesconstruction siteinventorbackstagerejectiondrummerairplane crashvolcanoalternate realityskiingturtlevoice over letterbalconybriefcasefieldbenchlandlordbraintelepathydrumshorseback ridingcoffee shopreflectionearphonesconfusionnew jobmagic trickbandagerepeated scenetime machinestairwayfenceinventiontrashbroken windowskyscraperclimbingteasinglanguage barriercloudlandladyhead injurysense of smellmoving incowarddarkroomacoustic guitarsushipark benchfeetgrassknittingcircular staircasedrillfart jokepillowcollectionman on firetelevision setschizophrenicunwanted kissdreamingorganspaghettishopping cartcalendarpeep holeclimbing out a windowsleepwalkingfootprintmodern artcutmuraljumping out a windowtalking to selftv hostbasssweatervoice over inner thoughtsfreezerdinner tablebody imagehand injurymirror balldaydreamingsubconscioustv setfloatinghead bandagecat costumedoor bellfalling out a windowgirl next doorpaper airplanereference to aristotlepitylive televisionsinkcross culturalfree loveillustratorfigurinemulticulturalismchalkdream worldphotocopierstuffed animal toymother's boyfriendopening nightreference to mozartlesbian slurart collectionbear costumeanimal costumereference to wolfgang amadeus mozartmake believesideburnsthermometerframeski liftstocking capbicycle helmetfeng shuihole in the wallparallel worldssleepwalker3d glasseslandlord tenant relationshipthe color redpraying mantiswoman as objectcardboardelectric razormonorailparallel timebackwardstelevision broadcastingarmpitreference to martin scorsesedreamscapeelectric drillvolcano eruptionmultiple languagesgraphic artistportfolioupright pianographic designerarmsclothes hangercopying machinereference to duke ellingtonsoaking feetfrench womanhandednessinner childbig bosschairliftgiant handsmall carbackground singerdrum rollnude imagepointy earscellophanedream machineno smoking signloft bedmechanical horsesubconsciousness (See All) |
Balthazar Blake (Nicolas Cage) is a master sorcerer in modern-day Manhattan trying to defend the city from his arch-nemesis, Maxim Horvath (Alfred Molina). Balthazar can't do it alone, so he recruits Dave Stutler (Jay Baruchel), a seemingly average guy who demonstrates hidden potential, as his reluc β¦tant protege. The sorcerer gives his unwilling accomplice a crash course in the art and science of magic, and together, these unlikely partners work to stop the forces of darkness. It'll take all the courage Dave can muster to survive his training, save the city and get the girl as he becomes The Sorcerer's Apprentice. (Read More)
Subgenre: | martial artscult filmcoming of age |
Themes: | magicdeathmurderlovesurrealismkidnappingbetrayalherodeceptionrobberysupernatural powerhome invasionself sacrificenear death experienceunlikely hero β¦book of magicbook of evil (See All) |
Mood: | car chase |
Locations: | cemeterynew york citytrainwatertaxielevatorapartmentpolice carcastlerooftopindialaboratorytunnelschool bus |
Characters: | teenagerteacherpolice officerstudenthostagetough guywarrioraction herowitchchinesegirlfriend |
Period: | 2000s2010s21st centuryyear 2010year 2000 |
Story: | surprise after end creditsscene after end creditseccentrichatfaintingapostrophe in titleviolenceflashbackdogkissfightexplosionknifechasethree word title β¦showerfirecell phonehorsecar accidentmirrorrescuebattleswordfalling from heightletterpaintingbookshowdownhand to hand combatcar crashbathroomdemonmanhattan new york cityfightingcombatgood versus evilfoot chasesword fightstrangulationaxemassacredisguisedeath of friendmontagemixed martial artsstabbed in the chestsubwaysnakechild in perilritualroommatenecklacetransformationtrainingduelflash forwardparkprologueelectrocutionumbrellamissionpossessionproduct placementdragondollstatuetough girlcollege studentlightningringdatethreatened with a knifesacrificehenchmanpizzawolffireplacekilling an animalwhat happened to epiloguegothicheavy rainquestrome italymagicianloss of loved oneimpersonationchefjumping from heightskullrailway stationmind controlparking garagecarnivaltorchanimal attackinterracial friendshipcrushed to deathback from the deadfemale warrioryogareverse footagefloodimpostoregyptresurrectionwizardimmortalitybased on storyrainstormcanenoteclassmatedemonic possessionpuppysword duelbenchalarm clockburned to deathteleportationimprisonmentspellcoffee shopimpersonating a police officerlevitationrobberfountainteenage lovespiral staircasecockroachfireballlockerworld dominationbrooklyn bridgemegalomaniacmicrosoft windowsbroken mirrorradio stationsorcererpyramidreluctant herocrashing through a windowbulleaglemuggingbritaindisembodied headtimes square manhattan new york cityflamecollege campusorchestral music scorepark benchshape shiftermiddle agesshapeshiftingsorcerysymbolsorceresscockney accenturnstatue of libertychosen oneapprenticeteenage herochrysler building manhattan new york cityradio djbroomchildhood sweetheartbased on poemmistvaseantique shoppendantbritish accentel trainempire state building manhattan new york citypepsigargoyleteenager fighting adultmuggerfire breathing dragonnight cityscapefear of heightssecret laboratorycar stuntevil sorcererlovers reunitedconfettisatellite dishbegins with narrationvintage cargreat wall of chinamagical mirrormopsplit headchinatown manhattan new york cityincantationnew york universitymagical ringmaster apprentice relationshipcircleevil wizardfight in the restroomhole in wallantennahole in chestsabredemonesslecture hallbook of the deadbrushing one's teethfire axeinanimate object comes to lifeabsorbing powerfalling objectsuccessorenchanted objectevil spellawakened by an alarm clockwashington square manhattan new york citywizardryglowing eyedeath of mentortribeca manhattan new york citytesla coilmountain dewfifth avenue manhattan new york city8th centurypassing notetrapped in a mirrorasian dragonbattery park manhattan new york citychild witchsecret hiding placepompadourtrapped soulabandoned subway stationantique dollbryant park manhattan new york city (See All) |
Retired madame Adelaide Bonfamille enjoys the good life in her Paris villa with even classier cat Duchess and three kittens: pianist Berlioz, painter Toulouse and sanctimonious Marie. When loyal butler Edgar overhears her will leaves everything to the cats until their death, he drugs and kidnaps the β¦m. However retired army dogs make his sidecar capsize on the country. Crafty stray cat Thomas O'Malley takes them under his wing back to Paris. Edgar tries to cover his tracks and catch them at return, but more animals turn on him, from the cart horse Frou-Frou to the tame mouse Roquefort and O'Malley's jazz friends. (Read More)
Subgenre: | 2d animationdisney |
Themes: | deathsurrealismkidnappingjealousydancegreed |
Mood: | night |
Locations: | trainmotorcycleparis francefrancetruck |
Characters: | singerdancerartistsingle mother |
Period: | 1910s |
Story: | gooseanthropomorphismhatpianistpianodogfightdancingtitle spoken by charactersingingsonghorserescuecatriver β¦good versus evilnewspaperwomandinnerbirdumbrelladisappearancerecord playerjazzeavesdroppingtalking animalmousefrogmilkanthropomorphic animalfather figurebutlerthunderstormfallhorse and carriagedrumseiffel tower parispaintaccordionfalling into watergramophonerailroadfriends who live togethertrumpetwindmillacoustic guitarpitchforksymboltrunktalking dogmotorcycle with a sidecarcarriagesleeping pillchopstickshayharptalking catskylinecastle thunderanimal protagonistbassistballadeerbowler hatmilkmantalking birdfishing polelead singertalking horsecroonertrumpetersinging animalanthropomorphic catdouble bassharpistexpression taken literallytalking mouseaccordionistbass voicebaritone voicespiraling eyesalto voicelead guitarist (See All) |
New York City. Melvin Udall, a cranky, bigoted, obsessive-compulsive writer, finds his life turned upside down when neighboring gay artist Simon is hospitalized and his dog is entrusted to Melvin. In addition, Carol, the only waitress who will tolerate him, must leave work to care for her sick son, β¦making it impossible for Melvin to eat breakfast. (Read More)
Subgenre: | sketch comedy |
Themes: | friendshipjealousyangertheftdepressionredemptionmental illnesshomophobiaprejudicewritingpolice investigationobsessive compulsive disorderunlikely friendship |
Locations: | new york cityhospitalrestaurantwheelchairapartmentroad trip |
Characters: | little boydoctorhomosexualmother son relationshipmother daughter relationshipafrican americanfriendpolice officernursewriterartistsingle motherwaitresspsychiatrist β¦older man younger woman relationshipgrandmother grandson relationshipgay friend (See All) |
Story: | eccentricpianistpianotearsfemale nuditynuditymale nuditybare breastsdogkissdancingtitle spoken by charactersingingbeatingurination β¦punched in the facewatching tvcomputerbare buttpaintingvomitingneighborgay slurnew yorkwomanpainterdrawingbathritualbartenderscarautomobilesingle parentnipples visible through clothingblockbustercompassionpet dogsuperstitionmusic bandage differencepublisherasthmasicknessbusiness cardkindnessopposites attractriteposingmale modelolder man younger womanposing nudeanimal in cast creditsbedriddenbigotmisanthropewalking canearm castdog trainingyounger woman older man relationshiplove hatecallboymoral transformationsurgical stitchesreference to george gershwindress codeoddballlap dogreference to henri matisse (See All) |
Peter is a composer and a likable sad sack who's devastated when his girlfriend of five years, Sarah Marshall, the star of a cheesy CSI-style crime show, dumps him. He weeps, he rails, he mopes. Finally, his step-brother Brian suggests Hawaii, so Peter heads for a resort on Oahu where, as he's check β¦ing in, he sees Sarah and her new beau, Aldous, a polymorphously perverse English rocker. The weeping and moping start again, until Peter is rescued by Rachel, a thoughtful hotel clerk who invites him to a luau and to hang out. Although he constantly runs into Sarah and Aldous, Peter starts to come alive again. Will Sarah realize what she's lost, and what about Rachel? (Read More)
Themes: | friendshipinfidelityreligionjealousydrinkingdrunkennessweddingdepression |
Mood: | satire |
Locations: | beachbarrestaurantswimming poolhotelairplanelos angeles california |
Characters: | musiciandoctorhusband wife relationshipfriendboyfriend girlfriend relationshiptattoosingerbrother brother relationshipphotographeractresslustex boyfriend ex girlfriend relationshipcheating on girlfriendairplane stewardess |
Story: | composerfaintingpuppetpianotearscharacter name in titlefemale nuditybloodmale nudityfemale frontal nudityflashbackmale frontal nuditymasturbation β¦dogbare chested malesex scenekissfemale rear nudityfightphotographmale full frontal nuditysingingknifeleg spreadingerectionshowertelephone callfondlingcryingcell phonesongwoman on topunderwearfistfightmirrorurinationface slappunched in the facewatching tvcomputercameradrinkcondomsex in bedbare buttfalling from heightliesunglassesbedcafemarijuanamale pubic hairswimmingcleavagewinebanddinnerapologyno opening creditsscantily clad femaleunderwater scenemarriage proposalbartendermicrophonemoaningactor shares first name with characterscene during end creditsfemale removes her clothespiglaptoppremarital sexchessflirtingwaiterno pantiesjumping from heightsurfingrock startorchyogarear entry sexshoesbreakupmobile phonetheatre audiencehawaiihot tubbananacliffrecording studiolandlordpiano playersurferhoneymoonold flameloud sextheatre productionresortsurfboardbleedingpearl necklaceurinalbroken heartshirthammockbutt slapfourth of julynewlywedinvitationphilosophertoilet papertreadmillleg injurystrawberrygross out humorwoman moaning from pleasurewoman moaningmoaning womancerealjumping off a clifftv show in filmreference to gandhihawaiian shirtsexually transmitted diseasedrunken sexcheating on boyfriendflasherrecording sessionhawaiianlovesickopening nighthotel desk clerkfake orgasmstarfishbeach resortpediatricianstdchess piecestepbrother stepbrother relationshipherpesrock operayoga classdesk clerkyoga instructorpublic break upcliff divingbaton twirlingsex lessoncouch potatoleihulamultiple sex positionsoutdoor weddingreference to costcoluaumen's restroomfainting at the sight of bloodreference to bert and erniereference to bert the muppetreference to ernie the muppetdracula spoofpina colada (See All) |
Three grown prodigies, all with a unique genius of some kind, and their mother are staying at the family household. Their father, Royal had left them long ago, and comes back to make things right with his family.
Subgenre: | independent filmcomedy of manners |
Themes: | childhoodfuneralfriendshipdeathmarriagelesbianismweddingartincestextramarital affairracismdivorcedeath of fatherdepressiondysfunctional family β¦redemptiongrieftheatredrug addictionwealth (See All) |
Locations: | cemeterynew york cityhospitalswimming poolhotelbathtubtaxiurban settingpolice car |
Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipbrother brother relationshipbrother sister relationshippolice officernursepriestlawyerartistlittle girlinterracial relationship β¦professorgrandfather grandson relationshiptalking to oneself in a mirror (See All) |
Story: | accountantgravecharacter name in titlesexbloodinterviewflashbackdogcigarette smokingphotographknifelesbian kissthree word titlepantiesvoice over narration β¦car accidentslow motion scenewatching tvcameracar crashfoot chasebranew yorkambulancejudgeman with glassesbirdcoffinchild in perilmassagetentskeletonactor shares first name with characterratcharacter says i love youballetheart attackrecord playerterminal illnessprivate detectivefalling down stairskilling an animaltape recordercowboy hatmousestabbed in the stomachloss of wifeservantbrother sister incesttennisforbidden loveinterracial romanceface paintshopliftingreconciliationsevered fingerattempted suicidepet dogtitle appears in writingnovelisttheatre audiencemedical examinationmedicationthrown through a windowblood on shirtmarital separationnervous breakdownplaysirengeniusmusic bandplaying cardsfiremanbisexualitymental breakdownfamily reunionphysicianreference to the beatlesclimbing through a windowplaywrightboy with glassesstage playinterracial kissballerinawrist slittingfinger cut offrazor bladewriter's blockbankruptcyshot in the handcruise shipdarkroomarcheologistboard gamechapter headingsestrangementadopted daughterdogfightracial stereotypeestranged fatherfinancechild prodigyeast indianphonograph recordbandaged handpainted facereference to the rolling stonestennis playerdelinquentfire enginefalconluxury hotelknife woundclergyshaving headextended familydalmatianfrat packfake illnesswar paintchequedeadpanneurologistdrug referencebb guntennis matchestranged family memberdeadbeat dadchild smoking a cigaretteelevator operatorhigh blood pressuremescalinebook coverplaying doctorstomach cancerex assassinliterary narrationfire drilltent indoorsrunning in traffic (See All) |
When Jane and Michael, the children of the wealthy and uptight Banks family, are faced with the prospect of a new nanny, they are pleasantly surprised by the arrival of the magical Mary Poppins. Embarking on a series of fantastical adventures with Mary and her Cockney performer friend, Bert, the sib β¦lings try to pass on some of their nanny's sunny attitude to their preoccupied parents. (Read More)
Subgenre: | stop motion animationlive action and animation |
Themes: | magicmarriagedance |
Mood: | breaking the fourth wall |
Locations: | london englandfarmrooftop |
Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboybrother sister relationshipfemale protagonistgirl |
Period: | 1910s |
Story: | job interviewchild's point of viewpart animationhatcharacter name in titlef ratedbased on noveldogtitle spoken by charactermirrorcafeneighborjokebrunetteapology β¦birddrawingumbrellaactor playing multiple rolesbankfireworksfireplacelifting someone into the aircookblockbustercannonmedicationrainstormhousekeeperlaughingunclenannynew joblevitationdual rolepenguinhorse racingtween girlbankerquitting a jobcloudkitecathedralfamous scorecarouseladmiralcockney accentstreet musicianlifting female in airjob promotionsnowglobechimneylifting an adult into the airnurserylullabytea partycartoon duckvirtual setconstablesiblings living togethersuffragettecartoon reality crossovercartoon pigfox huntchimney sweepwind stormmeasuring tapecheerfulnesscartoon penguinone man bandcarousel horsesliding down a banisterbank of englandcartoon horse (See All) |
The Addams step out of 'Charles Addams' (qv)' cartoons. They live with all of the trappings of the macabre (including a detached hand for a servant) and are quite wealthy. Added to this mix is a crooked accountant and his loan shark and a plot to slip in the shark's son into the family as their long β¦ lost Uncle Fester. Can the false Fester find his way into the vault before he is discovered? (Read More)
Subgenre: | cult filmblack comedyfish out of water |
Themes: | inheritancechristmaspregnancytortureangerdysfunctional familygreedamnesia |
Locations: | cemetery |
Characters: | family relationshipshusband wife relationshipfather daughter relationshipmother daughter relationshipbrother brother relationshipbrother sister relationshiplawyerlust for money |
Period: | 1990s |
Story: | accountanteccentriccharacter name in titlesequelsurprise endingrescuehalloweensword fightbased on comic bookmansioncigar smokingbased on tv seriesthreatbrotherfirst part β¦strong female characterchainsawoccultlifting someone into the airdysfunctional marriagefraudblockbusterscamcrossbowimpostorbutlerpassionate kissshaved headunclegothfreaktween girlfencingloan sharkmacabrereference to shakespeare's hamletopposites attractknittingtrapdoorschool playbased on comic striphunchbackstrong manconcreepylifting a female into the airdisembodied handsiamese twinsfake bloodtrailer narrated by percy rodriguezwatching someone sleepfake doctorfamily lovelong lost brotherquirkysleeping womanreboot of seriesreference to george h.w. bushreunited familyweirdescapadebased on adaptationreal tv show shown in fictional situationreference to nerotalladdams familypreteenage daughtertreasuryuncle festerloving family (See All) |
Tom Popper grew up having very little interaction with his father who was off exploring the world. When he grows up he spends most of time on his work and ignores his children. One day his father sends him an unusual gift: a penguin. Popper can't help but wonder why his father would send him a pengu β¦in. He tries to get rid of it, but accidentally orders five more. When his children and ex-wife show up to celebrate his son's birthday, the kids are taken with the penguins. And Popper finally gets to connect with his kids while his work suffers. (Read More)
Themes: | inheritancechristmasescapememorydeath of father |
Locations: | restauranthelicoptersnowbathtubtaxielevatorocean |
Characters: | little boyfamily relationshipsfather son relationshipfather daughter relationshipteenage girlpolice officerlawyerex husband ex wife relationshipchinese food |
Period: | 1980s1970swinteryear 1980year 1976year 1981year 1978 |
Story: | city parkperiod in titleapostrophe in titletearspunctuation in titlecharacter name in titlebased on noveldancingsingingthree word titlecryingcell phonewatching tvcomputerletter β¦animal in titlemanhattan new york citycandlevideo camerabridgebirdold womanmicrophonechampagnechristmas treetrapsistericeapplauseeggwatching a moviebridebirthcgiremote controlzooshovellaughterice skatingmarital separationabbreviation in titlemidlife crisiswilhelm screammusic bandlaptop computerbriberywifelast will and testamentfirst datepenguinstreet marketreference to the beatlesreal estatesecurityold ladyhusbandstethoscopeassistantreference to donald trumpteenage daughtermercedes benzsoccer ballbadgebird in titlesnowmannew york skylinestatue of libertydoormanantarcticanew york city new yorkmultiple time framesreference to winston churchillreference to charlie chaplinsnowballsnowglobedeath of parentice cubenesttaxi ridesquidfamily vacationnext door neighborreference to ernest hemingwaycartgalaicebergthe beatles songham radiobondinghockey stickhigh riserusepartnershiphdtvreference to fred astairereference to martha stewartslidenoisy neighborzookeepercell phone cameraice skatesreal estate developerreference to beyonceskating rinkford motor companyreference to howard hughesidreading of willhatching egglincoln automobilereference to morgan freemanreference to the doorsanimal controldance routineoverflowing bathtublost letternosey neighborapple macbookhockey fanflatiron building manhattan new york cityhatchlingiphone 4reference to james stewart (See All) |
Set on a colorful Greek island, the plot serves as a background for a wealth of ABBA songs. A young woman about to be married discovers that any one of three men could be her father. She invites all three to the wedding without telling her mother, Donna, who was once the lead singer of Donna and the β¦ Dynamos. In the meantime, Donna has invited her backup singers, Rosie and Tanya. (Read More)
Subgenre: | cult film |
Themes: | friendshipmoneypregnancydrinkingdrunkennessdanceweddingmemory |
Mood: | breaking the fourth wall |
Locations: | beachnew york citybarchurchhotelmotorcycleairplanenightclubtaxirooftopoceanyacht |
Characters: | musicianhomosexualfather daughter relationshipmother daughter relationshipfriendsingerfemale protagonistdancerwriterpriestsingle motherolder woman younger man relationship |
Story: | faintingpianistpianotearspunctuation in titlef ratednuditymale nudityflashbackmale rear nuditydogsex scenekissdancingejaculation β¦photographsingingpartycryingsongtitle directed by femalemirrorslow motion scenedrinkthongbare buttfalling from heightletterbookislandguitarswimmingbandwomanbridgetoiletinternetfishno opening creditsdrawingbartenderlimousinebinocularsfantasy sequencesuitcaseflowersscene during end creditsdiaryexclamation point in titlesplit screencloseted homosexualtouristlifting someone into the airtitle based on songbarnoverallsarchitectbuttocksblockbusterbrideladdergoatearthquakepassportbarefootdivinginterracial romancehippiegreecewedding ringferryreckless drivingwedding receptiondonkeypeasantharbortriple f ratedlaundrydocksailboatold flameraftmailmailboxillegitimate childmusic boxjumping into waterbagpipesbride and groomcanceled weddingpaternitylifting female in airbridesmaidcrossing selfgirl bandbiological fathermediterraneanlifting an adult into the airbased on stage musicaltoilet stallplaying against typebachelorette partygreek islandmiddle age romancescubapushed into waterair guitarpromiscuous pasttitle sung by characterengaged couplenubile womanjukebox musicalfeather boapaddle boatresort hotelswinging on a ropesummer romancewindchimeabbafalling through the ceilingflower powerreference to aphroditeswim flippers (See All) |
A master chef, Kate, lives her life like she runs the kitchen at upscale 22 Bleecker Restaurant in Manhattan--with a no-nonsense intensity that both captivates and intimidates everyone around her. With breathtaking precision, she powers through each hectic shift, coordinating hundreds of meals, prep β¦aring delicate sauces, seasoning and simmering each dish to absolute perfection. (Read More)
Themes: | deathpregnancydrinkingdeath of motherdepressiongrief |
Mood: | rain |
Locations: | cemeterynew york cityhospitalrestaurantschoolsnowkitchen |
Characters: | doctorfamily relationshipsmother daughter relationshipsingerboygirlstudentdancersister sister relationshipartistactresssingle motherwaitressgrandmother grandson relationshipaunt niece relationship |
Story: | job intervieweccentricgravetearssexkisscigarette smokingdancingphotographsingingtelephone callfirevoice over narrationcryingcell phone β¦songfoodcar accidentremakeslow motion scenewatching tvdrinklettercafeneighbormanhattan new york cityorphansocceroperacookingwinecandlemontageeatingaccidentfishsearchgraveyardparkdollblindfoldloss of mothertherapypizzarunawaypickup truckwaiteranswering machinebabysittercooktoytherapistchefhome moviebirthgrocery storeshoppingabsent fatherdeath of sistervoice over lettersnowingwishalarm clockphoto albumcartoon on tvrunning awayschool principalquitting a jobguardianloss of sisterscarfhiding under a bedgame playingopposites attracttai chilobstergoth girlspaghettiprecocious childpillow fightrecipepancakecrossword puzzlefatal accidentcuisinemealsteaksidewalk cafefish marketstuffed animal toyapronchinatown manhattan new york cityitalian foodcookbookmonopoly the board gamerefusing to eatwatching a cartoon on tvfemale chefbistrotruffleculinary artssense of tastefoie grasquailsous chefrestaurant criticsecret ingredientreference to puccinirestaurant reviewpeacock featherpulling tablecloth from under dishes (See All) |
New York, 1959. Max Bialystock was once the king of Broadway, but now all his shows close on opening night. Things turn around when he's visited by the neurotic accountant Leo Bloom, who proposes a scheme tailor-made for producers who can only make flops: raise far more money than you need, then mak β¦e sure the show is despised. No one will be interested in it, so you can pocket the surplus. To this end, they produce a musical called Springtime for Hitler written by escaped Nazi Franz Liebken. Then they get the insanely flamboyant Roger De Bris to direct. Finally, they hire as a lead actress the loopy Swedish bombshell Ulla (whose last name has over 15 syllables). As opening night draws near, what can go wrong? Well, there's no accounting for taste... (Read More)
Subgenre: | gay interestslapstick comedybroadway musical |
Themes: | friendshipdeathmurdermarriagemoneybetrayalprisondeceptionguiltwritingcheating |
Locations: | new york citymotorcycletaxicourtroomfrancerooftopusa |
Characters: | husband wife relationshippolicemother son relationshipfriendsingerpolicemandanceractoractresssecretarygermanolder woman younger man relationshipgerman soldierself esteem β¦theatre director (See All) |
Period: | world war two1950s |
Story: | surprise after end creditsaccountantscene after end creditsreference to william shakespearepianistpianotearssextwo word titlekissfightdancingphotographsingingparty β¦knifetelephone callcryingsongtitle directed by femaleblondeface slapremakeshootingbookliebeerbathroomjailbritishprayermanhattan new york citynewspaperjudgebirdpainterdouble crossold womanlooking at the cameravirgincostumeliarchampagneumbrellaauditionmassagereadingcourtmanipulationwigbased on filmnewspaper headlinetrusttransvestiteapplausedrag queenreference to adolf hitlerfriendship between menhelmethappinesshidingfraudrehearsalirishrapists&mbreakfastbroken legcelebrationprison guardbuddybackstagepartneranxietytheatre audiencesafeswedenvolcanoknife fightpolandsailormustachecanepigeonpostercontracthysteriaclosetswastikacentral park manhattan new york cityschemepostcardneo naziplaywrightjurybillboardbroken mirrorrabbitheatre productionshow businessreceptionistpocket watchpursehillbillyunhappinessstrait jacketrio de janeiro brazilconsciencelucktimes square manhattan new york citybroadway manhattan new york citynervousnessblack catpillowbronx new york citybuenos aires argentinachoreographerblanketchrysler building manhattan new york citysausagespotlightmotorcycle with a sidecartap dancingwater fountainswedishwardenthird reichbad luckreference to winston churchillhandkerchiefgun held to one's headniagara fallsverdictcrutchcrookreference to george washingtonreference to friedrich nietzschebased on stage musicalbannerwalkergerman accentstanding ovationdebutantedishonestyopening nightdirty old mancostume designerheil hitlerreference to queen elizabeth iicontortionistleg in a castwishing someone good luckreference to julius caesarstorm trooperbad tasteyodelingirssex maniactap dancergownmonoclesinging to the cameralederhosentony award sourceeighty somethingpretzelbank checkreference to gloria swansonbricklayerhitler spoofset designerchorus girlcollie dognew york times the newspaperball and chaintheatre producerconga linedoodlingstableboyunderstudyfunny nazireference to a white picket fencereference to ethel mermanadding machinealliterationoverturereichstagtheatre reviewvisorcombing one's hairstrudelbased on stage musical based on filmcherokee tribedairy queenmilk maidsing sing prison new yorkbeer steinbrown shirtcpahunleavenworth (See All) |
When a devastating event befalls the city of San Fransokyo and catapults Hiro into the midst of danger, he turns to Baymax and his close friends adrenaline junkie Go Go Tomago, neatnik Wasabi, chemistry whiz Honey Lemon and fanboy Fred. Determined to uncover the mystery, Hiro transforms his friends β¦into a band of high-tech heroes called "Big Hero 6." (Read More)
Subgenre: | martial artssuperherofuturisticcgi animationdisney |
Themes: | funeralfriendshiprevengebetrayalescapedeceptionterrorismgriefself sacrificeartificial intelligence |
Mood: | car chase |
Locations: | cemeterykitchenpolice stationsan francisco californialaboratorycar in water |
Characters: | father daughter relationshipteenagerbrother brother relationshipteenage boyprofessoraunt nephew relationshipself referentialrevenge motive |
Story: | scootersurprise after end creditsscene after end creditschild's point of viewflashbackexplosionchasesurprise endingfirefistfightrescueslow motion scenecatarrestpainting β¦based on comichand to hand combatcafecollegerobotislandscientistgood versus evilbased on comic bookmansionmontageno opening creditsdrawingunderwater scenenews reporttrainingcollege studentdeath of brotherbodyguardexploding bodygeneralsacrificeicenerdtraitorsabotageflyingcomic bookgroup of friendstoyexploding buildingpress conferencefaked deathlaserandroidmasked mannicknamemourninginventor3 dimensionalbutlermarvel comicshologrameye patchsecret identityflamethrowerloss of brotherteleportationfinal showdownmini dressportalcomic reliefno title at beginningfall from heightsuperhero teamsoccer ballhigh techcollege campushot air balloonmasked heromasked villaingolden gate bridgealternate dimensionabandoned warehouseteenage herofictional citychild prodigyindustrialistexhibitionhidden roomel trainbubble gumnanotechnologyteenage superheroanti villainsupervillainfear of heightscostumed herorobot versus robottalking robottoy robottrue identity revealedboy geniusrobot suitfemale astronautfalling from a windowflying robotmarvel animatedspace capsuleschool mascotattempted revengescene at a windowscience labscience show (See All) |
The impressionistic story of a Texas family in the 1950s. The film follows the life journey of the eldest son, Jack, through the innocence of childhood to his disillusioned adult years as he tries to reconcile a complicated relationship with his father ('Brad Pitt' (qv)). Jack (played as an adult by β¦ 'Sean Penn (I)' (qv)) finds himself a lost soul in the modern world, seeking answers to the origins and meaning of life while questioning the existence of faith. (Read More)
Subgenre: | independent filmcoming of ageepic |
Themes: | inheritancechildhooddeathmarriagereligionjealousypregnancyfearmemorytheftdysfunctional familyguiltgriefbullyingeducation β¦photographyhopecrueltyafterliferegret (See All) |
Mood: | rainavant gardemoving |
Locations: | cemeterybeachrestaurantschoolchurchswimming poolforestsmall townairplanebathtubdesertbicycleelevatorwoodsurban setting β¦police carseacourtroombaseballouter spaceoceanchinatexasstormrunning into water (See All) |
Characters: | little boymusicianfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipafrican americanchildrenbrother brother relationshipboypolicemanbabypriestthief β¦christianreference to godbullywaitresschristianitycatholicchinesegrandmother grandson relationshipengineeryounger version of characterpregnant wifecrying babydeath of boydeath wish (See All) |
Period: | 1950s |
Story: | faintingpianotearsflashbackdogbare chested malekissfightdancingexplosiontelephone callfirevoice over narrationcryingcell phone β¦foodmirrorface slapslow motion scenecatarrestpaintingbooklierunninglingeriedead bodycafeclassroomprayerguitarriverswimminghalloweensurvivalnewspaperflashlightcandlebridgeeatinghousesnakefishnonlinear timelinechild abuseapologyman with glassescoffinbathunderwater scenesearchjourneygraveyarddrowningpaingunshotflash forwardtreeclownsuburbfired from the jobliarstorytellingreadingbaseball batflowerscourtdeath of brotherchildbirthdeath of songardenwaterfallflowerclasssleepingtrustkillingredheadhateblack americanrecord playermachismoeyeglassesdestinybreaking and enteringlooking at oneself in a mirrorlistening to musicrecordingvandalismguitariststealingplanetswimsuitsharkladderbirthfollowing someoneend of the worldambitiondinosaurpromisewindsufferingthundermourningloss of sonchild protagonistkickinginsectcigarette lighterbible quotecard playingsibling rivalrysunbutterflyvolcanoatticshadowchoirswingbarbecueexistentialismgrowing upmarital problemloss of brotherchildhood memoryfast motion sceneshamebeing followedpiano playersermonspittinggiving birthhandshake12 year oldgardeningnotebookbaptismhomecomingreading aloudstairwayescalatorlooking out a windowabandoned houselizardvery little dialogueskyscrapernaivetyseagullwhisperingenvylavabubble bathstrokebare chested boyelectric shocktrain tracksuniverseswimming underwaterbreaking a windowguitar playernewborn babyclimbing a treefailuremeteorprehistoric timestelegramreading a newspaperstarscar radiotreehousegrassdistrustdeath by drowningtoy gunsilhouettefetuswaveplant in titleexpectant motherdomineering fatheroverhead shotsaying gracecourthousedare19 year oldkneelingexpectant fatherwater hosewashing dishesice cubehand kissingplanet earthsnoopinghoselooking in a windowjigsaw puzzlejumping on a bedorganiststeamheartbeatstained glass windowtrashcanloss of innocencelaundry drying on clothes linecar repairpower plantschoolyardsparklerlawn sprinklercosmosplayingelectric fanthree brotherswind chimeembryochild as main charactersunflowerancestrylearning to readblessinglighting a candlebig bangblowing bubblessomersaultdeath in familybad newsplainplaying catchtarkovskyesquebb guncrossing oneselfwading in waterwalking on a beachstrict fatherdaily lifedestroying propertyholding head underwaterpatentpipe organwatering cantime capsulewanting to dieartificial respirationhand clapping gamebegins with a quoteresentment toward fatherlimping manreference to johannes brahmsschool bellstreetlightrolling down a hilltree swingplanting a treebegins with a quotationreference to jobhanging out washingtolling bellorigins of lifeveinair rifleelectrical shockfloating in the airglass elevatorhairbrushglass coffinpraying handswaco texaseye maskfertilizationkicking a canpineconeddtdirgejumping from a treepantheismreference to arturo toscaninisurvival of the fittestdeath notificationbirth of sonhit with a boardice traylearning to walkparents arguing (See All) |
A 14-year-old girl in suburban 1970's Pennsylvania is murdered by her neighbor. She tells the story from the place between Heaven and Earth, showing the lives of the people around her and how they have changed all while attempting to get someone to find her lost body.
Subgenre: | suspense |
Themes: | funeraldeathmurdersurrealismrapedrinkinginvestigationvoyeurismmemoryobsessionredemptionpoetryhome invasionhopemurder investigation β¦death of daughterafterlifemissing child (See All) |
Mood: | rain |
Locations: | cemeteryhospitalschoolsnowbathtubbicycletaxifarmpolice carlaketaxi driverschool buskitchen firerunning in water |
Characters: | little boydoctorfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipbrother sister relationshipteenage girlteenage boyserial killerdetectivepoliceman β¦dancerphotographersister sister relationshiplittle girlgrandmother granddaughter relationship (See All) |
Period: | 1970syear 1973 |
Story: | toy storeshopping mallhattearsf ratedbased on novelbloodflashbackdogkisscigarette smokingdancingphotographtitle spoken by characterknife β¦chasethree word titletelephone callfirevoice over narrationcryingbeatingdreamcorpseblood splatterfoodwatching tvcameradrinkfalling from heightpaintingbookrunningbirthdaydead bodyneighborvoyeursubjective camerasoccerflashlightcandleaxemontageeatingno opening creditspainterunderwater scenesearchflash forwardtreestalkersuburbfantasy sequencesuitcaseevil manreadingbaseball batlightningflowerspursuitsuspicionhatestrong female characterrecord playereyeglassespoembreaking and enteringjogginghammerhidingassaultaccidental deathteddy bearladderfollowing someonecrying manrapistbreakfastback from the deadshoesfirst kissheavendead childpedophileevidencedeath of sisteralternate realitynotefieldcellarreckless drivingnewspaper clippingphoto albummudhit with a baseball batdead girlbeing followedlighthousepervertserial murdersaving a lifebad guypedophiliateenage lovechild molestationshipwrecklost lovevacuum cleanerbroken windowdigging14 year oldfalling into watercornfieldteenage crushwashing machinechild molestertrapdoorpurgatoryreturning homemolestationchild rapediverclimbing out a windowmurder victimcreepscrapbookserial rapistmultiple murderssexual predatorcuriositysnowglobechild killerwatching someonebreaking down a doorbeing watcheddollhousechild murdererdead teenagergrandfather clocknarration from the gravebased on young adult novelgazebosinkschool lockerserial child killerfigurinestuffed animal toywall safelock of hairiciclereference to coca colaclubhousesinkholewheat fieldleg in a caststocking capstraight edge razorpainting toenailsrape of a minorelectric trainserial teen killerreference to laurence oliviermodel shipfloating in spacebreaking a glass windowsoda popdelawareroll of filmmodel builderunderground hideoutfruit pickership in a bottlefilm developingcharm braceletbeauty treatmentbicycle bellbreaking glass bottlegirl driving a carhiding under floorboardsinstamatic camerastocking feetbottle openerhammer and nailsdeath of teenage girlvoice over note (See All) |
The classic stage hit gets the Hollywood treatment in the story of Elwood P. Dowd who makes friends with a spirit taking the form of a human-sized rabbit named Harvey that only he sees (and a few privileged others on occasion also.) After his sister tries to commit him to a mental institution, a com β¦edy of errors ensues. Elwood and Harvey become the catalysts for a family mending its wounds and for romance blossoming in unexpected places. (Read More)
Subgenre: | screwball comedycomedy of manners |
Themes: | friendshipdrunkennessinsanitymental illnessalcoholism |
Locations: | barnightclubtaxitaxi driver |
Characters: | doctormother daughter relationshipsingerbrother sister relationshippolice officernursepsychiatristmaiduncle niece relationshipaunt nephew relationship |
Period: | 1950s |
Story: | eccentrichatpianistpianocharacter name in titleone word titledancingtitle spoken by charactersingingpartybased on playpaintingalcoholtelephonenewspaper β¦judgebartenderrabbitflowerhypodermic needlelifting someone into the airclockrealitymental institutionguestmisunderstandingdelusionanimal name in titlechauffeurforename as titlesandwichbandagenurse uniformimaginary friendbusiness cardshocksiblingnurse outfitcommitmentlifting female in airfired from a jobpulitzer prize sourcefemale nurselifting an adult into the airremadesanitariumfree spiritencyclopediafantasy lifeend credits roll callsiren the alarmreference to jane austenafipsychiatric nursehidden characterimaginary creaturetitle character not the main characterolder sister younger brothercarefreesanity hearingpooka (See All) |
When Coraline moves to an old house, she feels bored and neglected by her parents. She finds a hidden door with a bricked up passage. During the night, she crosses the passage and finds a parallel world where everybody has buttons instead of eyes, with caring parents and all her dreams coming true. β¦When the Other Mother invites Coraline to stay in her world forever, the girl refuses and finds that the alternate reality where she is trapped is only a trick to lure her. (Read More)
Subgenre: | cult filmstop motionstop motion animationdark fantasypuppet animation |
Themes: | surrealismkidnappingghostfearmonsterangerlonelinessdeath of mothertheatre |
Mood: | rainnightmaremoving |
Locations: | forestsnowmotorcycleboatbicyclewoodstexastunnel |
Characters: | little boyhusband wife relationshipfather daughter relationshipmother daughter relationshipsingerboyfemale protagonistactresslittle girlgrandmother grandson relationshipmermaiddisappearance of one's father |
Story: | scene after end creditseccentricreference to william shakespearepianistpianotearscharacter name in titlebased on novelbloodone word titledogphotographtitle spoken by charactersingingvoice over narration β¦cryingcell phonesongdreamfoodmirrorrescuecomputercatcameraletterneighborprayerorphanbedroomflashlightcandleeatingdinnersearchold womankeybuxomangelsuitcasedolltentlightningflowersdisappearanceratstagegardensleepingpizzacircuseyeglassesteafireplacetalking animalcakelifting someone into the airmousecannoncorsetthunderticklingimpostorpet dogchild protagonist3 dimensionalinsecttheatre audiencescissorsthunderstormparachutefogshadowbalconycanepajamaslaptop computerbatreflectioncandyforename as titleneedlestuffed animalrunning awayglovesold dark housespiral staircaseeyebicyclingbugsleeptheatre productionfantasy worldmetamorphosischeesemichiganacrobatclueoregonrainbowbechdel test passedgame playingsewingriddlesecret passagepet catclothing storehide and seekspotlightcat and mousehorror for childrenbeetleblue hairsecret doorsnowglobeshakespearean quotationghost childlemonadetalking catfortune tellingwalkeralternate worldmoving vannew homecotton candystuffed animal toymilkshaketrapezetoy trainwallpaperslugspiderwebvoidparallel worldshummingbirdpraying mantisold mansionsearch for parentthreadplayer pianoknitting needlemirror as portalgarment buttonpeeling skincataloguehigh diveseashell bikinimechanical handbig topdowsing rodskipping stonemoving crewtea leavesblowing a raspberrybreaking mirrorlorgnettestuffed toy dogdowsingeye cut outpoison oaktoy chestwell shaft (See All) |
Pre-teen Jeliza-Rose's parents are hopeless drug addicts. When pa, rocker Noah, finds ma's OD'd, he fears to be charged with homicide and takes Jeliza along to his ma's place, in a desolate country region. With Noah passed out, the girl mentally transfers to a fantasy world she and her doll heads en β¦ter magically. Jeliza's adventures also star the crazy locals, notably Dell, and Dell's grown but intellectually disabled brother Dickens. (Read More)
Subgenre: | independent filmcult filmfairy taledark fantasybased on fairy talemodern fairy tale |
Themes: | deathsurrealismpregnancydrinkingfearlonelinessdeath of fathersupernatural powerdeath of motherdrug usedysfunctional familyinsanitymental illnessabusedeath of wife |
Mood: | nightmareavant garde |
Locations: | bartrainbusrural settingkitchenfarmsubmarineschool bus |
Characters: | musicianfamily relationshipsfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipsingerboybrother sister relationshipgirlreference to godgrandmother granddaughter relationshipfrench kiss |
Story: | imaginationeccentricfaintingpuppetvoice overpianosexbased on novelbloodflashbackkisscigarette smokingphotographexplosion β¦singingknifefiresongbeatingdreamcorpsefoodmirrorurinationdrinksecretfalling from heightpaintingbookvomitingriflesunglassesrunningbeddead bodyhallucinationprayerguitarswimmingorphanflashlightbandstabbingeatingrock bandchild in perilritualunderwater scenetreedrug addictscreamingfantasy sequencestorytellingsuitcasedollreadingrabbitdomestic violencescarwigcrossrock 'n' rollisolationloss of fatherloss of mothersleepingcult directorheroinheart attackflirtingpickup truckhypodermic needletalking animalguitaristdenmarkdrug abuseflatulencesharkskullfalse identitypeeping tomdrug overdoserock concertinnocenceshoeswhipjunkiemakeupdynamiteatticlipstickshadowalternate realitywedding dressfamily dinnerlanternfieldpumpkinshaved headbrainsouthern accentminingface maskdinner partymummynecrophiliapedophiliastuffed animalold dark houseeyedead fathermental retardationabandoned housebeebugfarmhousetween girlsquirrelimaginary friendwhisperinglistening to a radioelectric guitaranttrain trackstrain ridepieseizurecleaningfart jokerock musicianheroin addictaltarman childepilepsyclose up of eyedelivery boyalice in wonderlandwingspillow fightchildhood sweetheartrocking chairwagondutch anglecar wreckdecomposing bodymirror ballpassenger traintreasure chestapplying makeuptaxidermylemonademousetrapprairiefireflygrave diggerpinatapeanut buttershooting uplobotomyspider webcandy bardissectiontrain wreckpretendinggeesechild neglectphalluswatchingapple piereference to alice in wonderlanddesecrationembalmingdeath by overdosetrain derailmentwonderlandtransistor radioexploding trainfeather boajutlandtalking dollreference to barbie the dollscrubbingalonenessplaying dress upshotgun shellurinating on the groundburritodead treementally handicapped personrabbit holebroken dollpillow feathersspasticdoll's headribcagehead scarlightning bugcrushed skullfalling off a bedswim fins (See All) |
Arthur is a spirited ten-year old whose parents are away looking for work, whose eccentric grandfather has been missing for several years, and who lives with his grandmother in a country house that, in two days, will be repossessed, torn down, and turned into a block of flats unless Arthur's grandfa β¦ther returns to sign some papers and pay off the family debt. Arthur discovers that the key to success lies in his own descent into the land of the Minimoys, creatures no larger than a tooth, whom his grandfather helped relocate to their garden. Somewhere among them is hidden a pile of rubies, too. Can Arthur be of stout heart and save the day? Romance beckons as well, and a villain lurks. (Read More)
Subgenre: | music videolive action and animationhigh fantasy |
Themes: | magicmarriagepoliticsherofreedomfirst lovefear of water |
Mood: | car chase |
Locations: | barboatwatervillagerural settingfarmpolice carafricatunnel |
Characters: | family relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipboybrother sister relationshippolicemandancerwarriorvillaingrandfather grandson relationshipgrandmother grandson relationshipengineer β¦the familyboy hero (See All) |
Period: | 1960s |
Story: | child's point of viewimaginationeccentricreference to william shakespearecharacter name in titlebased on noveldogdancingchasetelephone callvoice over narrationfoodcar accidentswordmask β¦birthdayriverflashlightsword fighteatinghouseapologyfictional warkingprincesskeypay phonestorytellingdebtmissing personspeechdisappearancefirst partgardenwaterfallflowersleepinggrandmotherprincerecord playerafricanchainsawbirthday cakeapplauserecordingmousetreasurephone boothfloodtelescopegrandfatherinventormiracleinsectballheartdungeonboarding schoolalternate realitylanternwishdictatorelfinvisibilitylocal blockbusterevictionportalinventionbeefantasy worldfallingtreasure huntexplorercountry houseopen endedpart live actionmagnifying glassracial stereotypelive actionbased on children's bookphonographsnoringtotalitarianismscrapbookbeetletoy carminiaturizationbedtime storymidnightforeclosurebubbleconnecticuthusband wife reunionbreaking down a doorwater towerchild herowaspdebt collectormagical swordchimneylandownertreasure hunterbare midriffchild driving a carnative tribeblock of flatsrubyyin and yanglooking for workgarden gnometoolsirrigationdrinking strawsequel baitinggrandparent grandchild relationshipsudden change in sizevillain escapeswalnutpoppychanging sizereference to king arthurskull and crossboneschild warriorsword in stoneinvisible inkafrican maskafrican tribesmansleeping dropssubterranean worldwooden mask (See All) |
In prison awaiting execution the next morning Louis, the 10th Duke of Chalfont, sets down on paper the events that led him to his current situation. His mother has been banished from her family, the D'Ascoynes, after she married Louis' father who was considered far beneath her. After her death, the β¦D'Ascoynes refused permission for her to be buried in the family crypt. Louis then plots his revenge - and kills all those ahead of him in the succession until he becomes the Duke. Along the way, he becomes involved with the married Sibelia who, when spurned, makes sure he ends up in prison. The day before his execution Sibelia recants her testimony saving him not only from the gallows but also sets him free. Once outside the prison however, he realizes he's forgotten one little thing........ (Read More)
Subgenre: | black comedy |
Themes: | inheritancefuneralfriendshipdeathmurderrevengesuicidemarriageinfidelityjealousyadulteryprisondrinkingdrunkennesswedding β¦extramarital affairdivorcepsychopathdeath of fatherdeath of motherpovertyunfaithfulnessphotographywealthhunting (See All) |
Mood: | satire |
Locations: | cemeterychurchhotellondon englandbicyclevillageshipcastle |
Characters: | doctorfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfriendsingerboyteacherdancerphotographerbabychristianreference to godcousin cousin relationship |
Story: | pianistgravepianotearsflashbackgunkissdancingphotographexplosionsingingpartycryingbeatingfood β¦horseshotguncameradrinkarrestlettershootingclassroomreporternewspaperwineold mandisguisebridgeeatingwidowtrialbirdcoffinmarriage proposaldrowningbinocularsfired from the jobpoisonumbrellastorytellingbankhangingwitnessgeneralclasstwinpubheart attackpoemteafireplacebow and arrowcolonelprison guardironyplot twistrowboatenglishsalesmancanechairtourhorse and carriagedaggeraristocratarroganceceremonyhandshakeestatearcherybachelorbankerstrokepoisoningswimming underwaterreverendbankruptcybreaking a windowhearsebishopheirillegitimate childdarkroomhot air balloonvaultlimpadmiralaristocracysuicide noteelopementwardenpoacherportrait paintingmemoirlorddukehand kissingmale singersuicide threatgallowsexecutionerabstinenceanimal trapsocial classscotland yardsinking shipgrapepeepholeduchessedwardian erapramcaviargenealogymurder by drowningvictrolalodgerprison visitationdressing gownfamily treesocial differenceshangmanbox of chocolatessuffragettebluffpaddy wagondetective inspectorparsonexonerationsherryweirwomen's suffragebroadswordhitlistquill penenglish nobilityhouse of lordsreprievewriting memoirsbegging on bended kneesedwardian englandgeneologyprivate secretaryreference to geoffrey chaucership collisionbearskin rugrectorsecret drinker (See All) |
Peter Pan (Williams) has grown up to be a cut-throat merger and acquisitions lawyer, and is married to Wendy's granddaughter. Captain Hook (Hoffman) kidnaps his children, and Peter returns to Never Land with Tinkerbell (Roberts). With the help of her and the Lost Boys, he must remember how to be Pet β¦er Pan again in order to save his children by battling with Captain Hook once again. (Read More)
Subgenre: | cult filmswashbuckler |
Themes: | magicrevengekidnappingchristmasherodysfunctional familyadoption |
Locations: | snowairplaneboatlondon englandenglandbaseballcity of children |
Characters: | little boyfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipchildrenboybrother sister relationshipgirllawyerlittle girlself discoverymermaid |
Period: | 1990s20th century |
Story: | child's point of viewanthropomorphismtearscharacter name in titlebased on novelviolenceone word titledogtitle spoken by characterbased on playtelephone callcryingcell phonerescuebattle β¦swordbedislandgood versus evilorphansword fightdeath of friendman with glassesno opening creditschilddrawingfictional warold womanduelcostumeuniformstorytellinghuggingpiratecaptainslow motionlifting someone into the airblockbusterreverse footagefairyskateboardingsnowingdead boyplaysword duelvillain played by lead actoryellingbroken windowshoutingadventure herofantasy worldbaseball capbaseball gamechild kidnappingfriends who live togetheracrobatfather son estrangementoutlaw gangvictorychristmas lightsacrobaticshooksurname as titlefood fightlifting female in airstockholm syndromechristmas decorationsminiaturizationbig ben londonchild's drawingdollhouseteenager fighting adultreference to gandhicaught in a netflying manactress playing male rolefear of flyingbaseball glovechild fighting adulthook for handbattle of witstinker bellcaptain hookflying boyturbulencepants falling downgang that lives togethersheepdogslashexposed underwearopen windowexpression taken literallyanthropomorphic flowernever neverlandseashell bikinicrowingflying girlold english sheepdogthrowing a telephone out a window (See All) |
1972. Vada Sultenfuss (played by Anna Chlumsky) is an intelligent, bubbly, hypochondriacal 11-year old girl. Her father, Harry (Dan Aykroyd), is a mortician and a widower. Her best friend is Thomas J Sennett (Macaulay Culkin). Then her father hires a new receptionist, Shelly (Jamie Lee Curtis), and β¦life will never be the same again. (Read More)
Subgenre: | coming of age |
Themes: | childhoodfuneralfriendshipdeathmarriagefeardancememoryangertheftgriefpoetryphotographypanicwriting β¦death in childbirthfear of death (See All) |
Locations: | forestsmall townbicyclewoodswheelchairlakeschool teacherpennsylvania |
Characters: | little boymusiciandoctorfamily relationshipsfather daughter relationshipchildrenbrother brother relationshipboyteachergirlpolice officernursestudentwriterbest friend β¦little girlteacher student relationshipamericangrandmother granddaughter relationshipsingle fatheruncle niece relationshipchildhood friendboy girl kiss (See All) |
Period: | 1970ssummeryear 1972 |
Story: | hattearsbloodtwo word titlekissdancingphotographsingingpantiescryingcorpsewatching tvbeddead bodyneighbor β¦classroomrivertelevisionswimmingbasketballdeath of friendfishcoffinfishingtreeargumentmicrophonewidowermini skirtdeath of childscreamringdatebasementfirst partloss of motherfireworkstypewritergaragesingle parentrecord playergirl in pantiespoemapplausegamesupermarketlifting someone into the airtitle based on songloss of friendoverallsloss of wifelosstimecrushcarnivalpicnicyogaministerold agemourninghippieinsectsong in titlemedical examinationmakeupfirst kissrosedead childengagementmeditationlipstickbarbecuedivorceeuncleplaying cardspetmenstruationbeebicyclingundertakertween girlponytailtomboyboy with glassesgoldfishteasingreceptionistblackboardbikedocumentcrying femalefuneral homeallergy11 year oldfourth of julyreference to richard nixonshopping cartmortuarycasketex wifemortalityprecocious childrocking chairbingocampermorticianblond boyfunfairphonograph recordoathfairgroundfireworksenilitymakeup artistlongingjumping ropecadaverwaspdead fishlifting a female into the airbeehivebumper carfirst crushmotor homecrying childmenarchecuckoo clockpuppy lovebee stingpunched in the gutex husbandchocolate barsitting in a treecrypony tailskipping ropejoblessembalmingpledge of allegiancetubaprostate cancerstylistteacher crushmajor child rolehypochondriastashbee attackcarnival gamegender in titlethe star spangled bannerfish bowlreference to the marx brotherstree climbingwant adbell bottomslaneswarm of beescarnyinsect attackleaseproducewriting classreference to walter cronkitedeath noticemixed bloodchild killed by an animalmood ringphrenologyschwinn bicyclecrush on teacherrope skippingcosmetologist (See All) |
During WWII in England, Charlie, Carrie, and Paul Rawlins are sent to live with Eglantine Price, an apprentice witch. Charlie blackmails Miss Price that if he is to keep her practices a secret, she must give him something, so she takes a bedknob from her late father's bed and places the "famous magi β¦c traveling spell" on it, and only Paul can activate it. Their first journey is to a street in London where they meet Emelius Browne, headmaster of Miss Price's witchcraft training correspondence school. Miss Price tells him of a plan to find the magic words for a spell known as Substitutiary Locomotion, which brings inanimate objects to life. This spell will be her work for the war effort. (Read More)
Subgenre: | live action and animation |
Themes: | magicdeathfeardancemilitaryangerpanic |
Locations: | beachmotorcyclesmall townlondon englandbicyclevillageenglandcastlejunglemuseumtrain stationsubmarine |
Characters: | little boymusicianchildrensingerbrother brother relationshipboysoldierdancerpriestlittle girlwitchgermanhuman animal relationship |
Period: | world war two1940syear 1940 |
Story: | anthropomorphismpart animationpianistfightdancingexplosionsingingknifepistolfirecryingbased on booksongmachine gunmirror β¦punched in the facebattleswordletterbookriflebombrunningbedbritishislandcompetitioncombatorphansoccerflashlightcandleold manfishchilddream sequencefishingkingcigar smokingnecklacetransformationgunshotlibrarybinocularsuniformfantasy sequencetentrabbitscreampursuitcountrysideunderwaterbearmonkeyapplauseropewaitercaptainentertainmentgrenadebow and arrowathleteflyingspearperformancelifting someone into the airrageelephantmagiciancaptivemousetoyenemywitchcraftfraudaudienceparadecolonelfull moonshieldexplosiveinvasionanthropomorphic animalevacuationdrummerballcon artistlaughterlionarmorcliffraidsailortrophypigeoncrowdmusic bandposterrefereeplaying cardsimprisonmentspellauntmagic tricknotebookchoreographystreet marketbicyclingperformergorillatween girlwhistlecrowndrummedalcottageold ladyfortressshow businessnewspaper articlebellstretchermegaphonelistening to radiometamorphosisunsubtitled foreign languagepotionpalm treealligatortrumpetdocumentexperiment gone wrongentertaineroctopuscellsorceresspigtailscockney accentkangarooapprenticeliquidpet catanimal that acts humangiraffelockballroomvulturehookmarchstreet vendorbroomretreatscottishcupmacejugglingnetcommunicationhuman becoming an animalgoalbattle axeeast indianspectatorrascalturbanmatchmakerleopardlongingostrichvicarkiltoil lampfootball matchhead scarfsaxophonistnurseryfurrypart animatedlagoonflea marketbraidsmodel traincheeringhalf dressed cartoon animalgroceriesshorelinehyenaincantationmiddle age romanceflying broomcharlatancharmrhinobarefoot cartoon animalinterdimensional travelpeddlerchartwarthogcartoon reality crossoverseahorsehippoclamsinging triopartingroarcalypsochorinegoofy hollerwire cuttersanimal metamorphosisshort wave radiofinchreference to botticellideserted houseflying bedsteel drumpartially lost filmunnatural experiment (See All) |
Disney's animated classic takes on a new form, with a widened mythology and an all-star cast. A young prince, imprisoned in the form of a beast, can be freed only by true love. What may be his only opportunity arrives when he meets Belle, the only human girl to ever visit the castle since it was enc β¦hanted. (Read More)
Subgenre: | coming of agetragedyfairy taleslapstick comedyfish out of waterdisneydark fantasybased on fairy tale |
Themes: | magicloverevengesurrealismkidnappingjealousyfearescapedancemonsterdeceptionobsessionsupernatural powerdeath of motherblackmail β¦redemptionpoetryunrequited lovehome invasionhopedeath of wifepanic (See All) |
Mood: | poetic justice |
Locations: | barforestsnowparis francebathtubvillagewoodsfrancelakecastlerooftop |
Characters: | little boyfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipsingerfemale protagonistbabyhostageartistlove trianglemaidwitchgrandmother grandson relationship β¦single fatherex soldier (See All) |
Story: | anthropomorphismcomposereccentricreference to william shakespearepianocharacter name in titleflashbackdogbare chested malekissfightdancingphotographtitle spoken by characterexplosion β¦singingpartychasesurprise endingpistolfirevoice over narrationbeatingcorpsehorsemirrorshot in the chestremakerescueslow motion scenepunched in the facebattleswordkissingbrawlfalling from heightpaintingshowdownrifleheld at gunpointbedshot in the backbedroomcandlesword fightmountaindisguisewomanmontagebridgefour word titlemapfalse accusationno opening creditsbirddrawingcontroversykingcreaturetransformationbartenderflash forwardattempted murderlibrarycursedangerprologuewidowerrace against timeknocked outlightningmanipulationwigtied upgardencabinloss of motherlove interestqueenprincesingle parentchesswerewolficeropefalling down stairswolffireplacedressheroineheavy raintalking animalhunterloss of wifeblockbusterservantjumping from heightculture clashstrong female leadcgitorchcompassionanimal attackclockfull moonfight to the deathinventorfalling to deathescape attemptballensemble castbutlerrosebookstoreaerial shotmusical numberrainstormdisfigurementmustachekingdomasylumowlaristocratteleportationimprisonmentclose up of eyesspellhappy endingsidekickfinal showdownfolklorehuman monsterspiral staircasemarkettowerlibrariancomic reliefplagueyoung version of charactertrue lovebeastbased on cartoonnarcissismtavernsoupilliteracyaltered version of studio logoopera singervanitystar crossed loverswindmillfamous scoremusketclawopposites attractfrenchmansorceressreclusecockney accenthermitmagic spellfirecrackerballroomsuitorglobeflintlock rifleangry mobflintlock pistolhorse drawn carriagehorndinner tablefantasiesstudio logo segues into filmstrong femalefrozen lakecountry estatecandelabraleft for deadnarcissistred rosegay subtextreference to walt disneywardrobeanimal loverfamous songdeus ex machinasuperficialityremake of cult filmwoman in perilchauvinismlock pickerased memoryharpsichordteapotcrossdressingman with a ponytailchauvinistbeauty and the beastwhimsicallove for animalspottercandlestickinanimate object comes to lifelive action remakefeather dusterunconventional romanceteacupwolvesmoulin rougebibliophiliahorse cartcogenchantressmagic mirrorpetalglass jarmantle clockbeast's heartreference to romeo and juliet (See All) |
Living in India, Mary Lennox, a young, privileged girl, is left orphaned when her parents are killed in an earthquake. She is sent back to England where she goes to live on her uncle's estate. It is a fairly isolated existence and she has to find things to keep herself occupied. She finds a sickly y β¦oung boy...and a secret garden. (Read More)
Subgenre: | costume drama |
Themes: | childhoodmagicfriendshipnaturelonelinessdeath of fatherdeath of motherredemptiongriefhopecrueltywealth |
Locations: | bathtubrural settingwheelchairindia |
Characters: | little boyfamily relationshipsfather son relationshipfriendboygirllittle girlmaidcousin cousin relationshipemployer employee relationshipuncle niece relationshipself discovery |
Period: | 19th century |
Story: | child's point of viewpuppetfemale nudityf ratedbased on noveldogphotographtitle spoken by characterfirevoice over narrationcryingtitle directed by femaledreamunderwearhorse β¦face slapcamerasecretneighbororphanmansiondream sequenceportraitkeywidowergardenstrong female charactericelifting someone into the airelephantloss of wifeservantstrong female leadtorchearthquakereconciliationtime lapse photographyrosefrustrationyoung loveswinghousekeeperhorse and carriagebonfirepigeonunclehorseback ridingvictorian eratriple f ratedparalysismedical maskweedestatestaircasediscoverygardenerhideoutbellmusic boxhiding under a bedsick childcarriagetantrumpuppet showliverpoolsecret passagewaymanor househidden doormaster servant relationshipoil lampjigsaw puzzlesunlightwhite horseseedneglecttemperorphan girljigsawchild as main characterneglected childcomfortspiritual healingivorystrange noisebluebellsrobintapestryemotional healingshut inwidowed fatheryorkshire englandinner strengthchange of seasonswater lilymaharajaenglish gardenwoman slaps a girllearning to walk (See All) |
A young boy, recently orphaned, is taken to England by his grandmother. At a hotel in which they are staying, a group of witches have gathered to prepare a plot to rid England of all children.
Subgenre: | conspiracyabsurdism |
Themes: | magickidnappingmoneyfearescapeangerdeath of fathersupernatural powerdeath of motherabductioncrueltypanicmissing child |
Locations: | beachrestaurantschoolhotelsnowsmall townbicycletaxielevatorkitchenpolice carenglandocean |
Characters: | little boydoctorfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipgirlpolice officerpolicemanbabylittle girlmaid β¦witchgrandmother grandson relationship (See All) |
Story: | hatfaintingtearsbased on novelsingingsurprise endingcryingbased on bookunderwearrescuecatmaskpaintingrunningbirthday β¦subjective cameragood versus evilfoot chaseorphanbedroomcandlemountaindisguisesnakechildradiodrawingchild in perilsearchcigar smokingold womantransformationhotel roomstripteaseuniformfantasy sequencemissionundercoverstorytellingvacationmissing personscreamspeechdisappearancepursuitwiggiftexploding bodyloss of fatherstageblindfoldfalse eyelashesloss of motherfireworkseuropebirthday cakeeyeglassesapplauseeavesdroppingtalking animalcakecagecomic booklifting someone into the aircookmousehidingwitchcraftaccidental deathaudienceappleguestschool uniformlaughtermeetingnorwayspellchocolatepethysteriayellingcandyface masknotebookbirthday presentgloveseyebicyclingcheering crowdshoelistening to radiocabin in the woodsmetamorphosissoupconventionmeat cleaverhandtreehousecashblack catsorceresshorse and wagonpigtailsdeath of parentstrunkdelivery mandiabetesstaffpet catvillain turns goodcarriagetoadbaldnessmissing girlscottishluggagemoney falling through the airbedriddenhuman becoming an animalyoung boyrich kidhotel managershrinkingchild's drawingbaby carriagemousetrapmagical potionvillainess played by lead actressvisiting a gravehelium balloonlifting a female into the airbraided haircuisineclose up of mouthgluttonynorwegianman carrying a womancovenpastrybellhopbraidsorphan boyburpingbald womanchocolate barodorair conditionerman wearing a tuxedooverweight childtree housebaby strollerwhite roomformulagatheringlaser visionnative dressvignette formwoman wearing a one piece swimsuitgrande dame guignolkidnapping a childlanefragmentation grenademissing fingerwickednesspandemoniumhollow bookpompositybelief in witchesrubbing noseswoman dancinggrimoirehot water bottleevaporation (See All) |
Hugo is an orphan boy living in the walls of a train station in 1930s Paris. He learned to fix clocks and other gadgets from his father and uncle which he puts to use keeping the train station clocks running. The only thing that he has left that connects him to his dead father is an automaton (mecha β¦nical man) that doesn't work without a special key. Hugo needs to find the key to unlock the secret he believes it contains. On his adventures, he meets George Melies, a shopkeeper, who works in the train station, and his adventure-seeking god-daughter. Hugo finds that they have a surprising connection to his father and the automaton, and he discovers it unlocks some memories the old man has buried inside regarding his past. (Read More)
Subgenre: | steampunksilent moviesilent filmmakingfrench filmmakingdieselpunk |
Themes: | magicfriendshipdeathlovedrinkingdrunkennessescapefilmmakingmemoryangerlonelinessdeath of fatherobsessionpoetryphotography β¦theatrefalling in lovewritingdog in love (See All) |
Mood: | nightmarefilm history |
Locations: | cemeteryrestauranttrainschoolsnowparis francebathtubfrancemuseum |
Characters: | little boymusicianhusband wife relationshipfather son relationshippolicemother son relationshipfriendbrother brother relationshipboyteenage girlteenage boygirlpolice officerpolicemandancer β¦actorphotographerwriterthiefartistactresslittle girlfilmmakerfilm directorfrenchuncle nephew relationshipmermaid (See All) |
Period: | 1930s |
Story: | toy storechild's point of viewgravetearscharacter name in titleone word titleflashbackdogdancingphotographexplosionchasetelephone callfirevoice over narration β¦cryingbased on bookdreamcorpserescueslow motion scenecatcameradrinkarrestsecretbookrunningdead bodycaferobotrivertelephonesubjective camerafoot chasenewspaperorphanname in titleold manmontageno opening creditschilddrawingchild in perilbathsearchgraveyardtheaterlibraryauthorprologuekeyuniformpassionstatuereadingscreampursuitsadnessstageworld war onecinemafloweractingpoettrustcircuspoemapplauseentertainmentbreaking and enteringcagefamehappinessmagiciantoyhidingwatching a moviewristwatchtimeaudienceladderrailway stationorphanagefollowing someoneorchestraclockembarrassmentguardmovie theatregypsyinventorpet dog3 dimensionalwizardtheatre audiencemakeup3dlaughterfilm setdrunksketchbookstorecapturesnowingnotelanternbonfireholding handsmusic bandposterbeing followedsaving a lifeforename as titlemagic tricknotebookrunning awayeiffel tower parisspiral staircasefilm clipmachinefilm projectortween girlflaskshow businesspocket watchfallingtrain tracksindustryfilm studioashescollectorentertainercarpenterhiding placevaultcarousellimpcinematographercollectionenigmalobstermovie cameramerry go roundkiss on the cheekpenhouse fireapprenticeloudspeakerhookspotlightguard dogoverhead shotmovie posterwrenchcard tricktantrumboy girl relationshipspectatorreference to charlie chaplinmusetrain conductormausoleum3 dmovie projectordead brotherstreet kidshopkeeperoil lampinkdead parentsgalasideshowsteamfake beardleg bracefire breathing dragontoy soldierseine riverdobermanscavengerdreamerlooking through a keyholerepairmanclock towerdeath of uncletrain wreckscreenpastrypicking a locklarge format cameramementomagician's assistantlock picknewsstandpost world war onepresentationslidewar injurydachshundtoolscupboardeiffel towerauteurnotre dame cathedraljazz combobook sellernightshirtreference to london england3d glassesdestroying propertymagic actillustrationtrain derailmentrailroad trackshistory of cinemalong underwearreference to rudolph valentinowind up toyclimbing a wallcroissantwearing clothes in a bathtubfilm preservationmechanicalreference to jules vernetraveling circusclockworkfilm restorationautomatoncrankreference to buster keatoninnovatorfilm historianwicker basketdoberman pinschertrain enginereference to douglas fairbanksreference to harold lloydtrampledantiquariandream within a dream within a dreamlistening at a doorreelgodfather goddaughter relationshipsense of timearc de triomphebroken chaircelluloidclockmakerovationpurpose in lifereference to georges meliesarmoireflower selleryear 1895film academygearsreference to the lumiere brothersbass fiddlehand crankedoil canstanding on a chairwind upfootlightsmechanical dragonmechanical manreference to hal roachshoe heelsmelling a flower (See All) |
Growing up can be a bumpy road, and it's no exception for Riley, who is uprooted from her Midwest life when her father starts a new job in San Francisco. Like all of us, Riley is guided by her emotions - Joy, Fear, Anger, Disgust and Sadness. The emotions live in Headquarters, the control center ins β¦ide Riley's mind, where they help advise her through everyday life. As Riley and her emotions struggle to adjust to a new life in San Francisco, turmoil ensues in Headquarters. Although Joy, Riley's main and most important emotion, tries to keep things positive, the emotions conflict on how best to navigate a new city, house and school. (Read More)
Subgenre: | cult filmcoming of agecomputer animationcgi animationdisney |
Themes: | childhoodmagicfriendshiplovefearmemoryangerforgiveness |
Mood: | nightmaremoving |
Locations: | trainschoolbuscityroad moviesan francisco californiaschool teacherbus stationmoving to city |
Characters: | family relationshipspolicefather daughter relationshipmother daughter relationshipafrican americanchildrenboyfemale protagonistgirlpolice officerstudentbabylittle girlfathercrying baby β¦chinese foodbaby cryinggirl crying (See All) |
Period: | 2000s2010s |
Story: | motivationalimaginationanthropomorphismtearsf ratedflashbacktwo word titlecryingdreamcatclassroomcaliforniahouseapologyclown β¦dragonscene during end creditsglassessadnessratbearsleepingpizzarunawayeyeglassesballooncopcageelephantstealinghammerblockbustergiantdinosaurface paint3 dimensionalice skatingcartoonice hockeyboyfriendcliffmustachegrowing uptrophychildhood memoryhockeyjoynew jobfire extinguisherrunning awayfemale teacherelementary schooltomboyimaginary friendlavadolphinkidcloudfemale heromovie studioafrican american womannewborn babyschoolteacherredhonestygreenbechdel test passed11 year oldiphonedemolitiongolden gate bridgeminnesotakidskangaroobow tiehandbagraccooneyespre teentear on cheekmiddle schoolunicornmindblue hairbluecerealfalling off a cliffnew housenecktielight bulbnewbornsubconsciousfrench friesnosegreen hairhomesicknesspinkfirst day of schoolmoving vaneveryday liferunning away from homechased by a dogsneaking outyellowstudentsblonde childerased memoryapathydisgustschool kidsbreakfast cerealcamera shot from inside human bodyemotionpurplehouse of cardsbig noselazysan franciscotryoutsbroccoliopening creditswaking up from a nightmareemotionsmemory erasurecomputer generated imageryred squarecrybabydizzybig eyesfirst placefrench frypunishedrolling eyes (See All) |
Adam ('Tom Hiddleston' (qv)), an underground musician, reunites with his lover for centuries ('Tilda Swinton' (qv)) after he becomes depressed and tired with the direction human society has taken. Their love is interrupted and tested by his wild and uncontrollable little sister ('Mia Wasikowska' (qv β¦)). (Read More)
Themes: | deathmurdersuicidemoneydrinkingfearmemoryillnessdyingmythologyself obsession |
Mood: | nightdarknessdeath of vampire |
Locations: | hospitalairplanebicycletaxipolice car |
Characters: | musiciandoctorhusband wife relationshipsingerteacherzombiedancerwritersister sister relationshipvampirefrench |
Period: | 2010syear 1968year 1975 |
Story: | reference to albert einsteincomposerreference to william shakespearefemale nuditynuditybloodmale nuditybare breastsbare chested malegunkisscigarette smokingdancingphotographsinging β¦pistoltelephone callcryingsongcorpseurinationface slapslow motion scenewatching tvwritten by directordrinksecretbooksunglassesrock musicdead bodybathroomreference to jesus christguitartelephonescientistf wordsurvivalflashlightbandmontagerock bandmicrophonereadingskeletonrock 'n' rollsleepingrecord playerchessapplausebulletlistening to musictape recorderrecordingguitaristviolinstreet lifepassportbarefootcellphoneviolinistabandoned buildingearphonesglovesdetroit michiganlooking out a windowmachineguitar playingoutsiderfemale vampireblood stainrumorflaskknocking on a doorstethoscopeelectric guitarsaxophonemushroomguitar playerreference to youtubereference to shakespeare's hamletvampirismreference to adam and evereference to charles darwingogglesstarvingleg woundoverhead shotlong haired malecontaminationarabicdrinking blooddoorbellnight lifeenginegigfangsgarlicreference to isaac newtonpopsiclevampire bitereference to draculareference to mark twainvinyl recorddead body in a car trunkfatiguegongalchemistdressing gownanonymityair guitareternal lifereference to london englandabandoned cityreference to nikola teslareference to franz schubertreference to lord byronreference to copernicusfamous peoplereference to galileocar parkreference to faustwedding photographreference to los angeles californiatangier moroccoreference to italyreference to pythagorasvampire teethreference to henry fordsuicidal thoughtabandoned theatre45 recordingancient vampireleg bandagefungipretending to be a doctorpeek a booreference to chet atkinsreference to cleveland ohioreference to dr. watsonreference to mary wollstonecraftselling bloodyear 1868 (See All) |
To Greg Heffley, middle school is the dumbest idea ever invented. It's a place rigged with hundreds of social landmines, not the least of which are morons, wedgies, swirlies, bullies, lunchtime banishment to the cafeteria floor - and a festering piece of cheese with nuclear cooties. To survive the n β¦ever-ending ordeal and attain the recognition and status he feels he so richly deserves, Greg devises an endless series of can't-miss schemes, all of which, of course, go awry. And he's getting it all down on paper, via a diary - "it's NOT a diary, it's a journal!" Greg insists, preferring the less-sissyfied designation - filled with his opinions, thoughts, tales of family trials and tribulations, and (would-be) schoolyard triumphs. "One day when I'm famous," writes Greg, "I'll have better things to do than answer people's stupid questions all day." So was born the Wimpy Kid's diary. (Read More)
Subgenre: | ghost story |
Themes: | friendshiprevengechristmasbetrayalfearwrestlinghumiliationbullying |
Mood: | rainbreaking the fourth wall |
Locations: | new york cityschoolforestsnowbusbicyclewoodsschool busschool bullyschool danceschool friend |
Characters: | little boymusicianfamily relationshipsfather son relationshipmother son relationshipfriendchildrensingerbrother brother relationshipboyteenage boyteachergirldancerphotographer β¦best friendbullyasian americangrandfather grandson relationshipchildhood friend (See All) |
Story: | child's point of viewfaintingpianistpianobased on novelflashbackbare chested malefightdancingphotographsingingtelephone callvoice over narrationcell phonesong β¦underwearmirrorurinationwatching tvcomputercamerarunningclassroomcompetitionmanhattan new york cityhalloweenflashlighttoiletrock bandno opening creditsvantalking to the camerafive word titlelibraryfantasy sequenceumbrellaauditiondiaryhalloween costumeprankfilm within a filmfirst partclassgarageprivate detectivepickup truckcoachnerdwoman with glasseswalkie talkieamerican footballwatching a moviejanitorreconciliationspanishanimated sequencechild protagonistatticfriendship between boystitle at the endclassmatebroken armalarm clockwilhelm screamowlwrestlert shirtnarrated by characterporn magazinecandyfire extinguishercafeteriascene before opening creditstrick or treatingjournaltween girlboy with glassespeer pressureschoolboylistening to a radiopopularityplaying a video gamecheesealtered version of studio logooverweighttimes square manhattan new york citybadgesitting on a toiletsnowmanmolespray painttoilet paperjunior high schoolschool playjack o'lanternmiddle schoolpirate costumeboy girl relationshipdental bracescanteenanimated opening creditsstudio logo segues into filmguatemalakindergartenbroken handrottweilerbreakdancinggym classgym teacherbratbreaking the fourth wall by talking to the audienceschool lockerfirst day of schoolprecociousnessstuffed animal toyfat boygingerhand bandagereference to the wizard of ozboys' bathroomolder brotherschool cafeteriagarage bandtwister the gamegroup of teenagersfriends falling outwedgiebleachersschool yearbookarm in a castsleeping in a bathtubhaunted forestarm in a slingbobble head dollhole in the groundphysical educationcymbalsnotgirl on boys teamleaf blowerptaschool clubwimpthrowing water on someoneweed whackervenetian blindsvoice over diarymouth guardphotograph comes to lifeschool gymschool newspapersinging auditionteenage bandbroken friendshippotty trainingcleaning a bathroomestranged friendwrestling coachmiddle childschool electioncootiespink eyepottysecret languageunicorn costumewriting on an arm cast (See All) |
Charlie St. Cloud is a young man overcome by grief at the death of his younger brother, Sam - so much so that he takes a job as caretaker of the cemetery in which his brother is buried. Charlie has a special lasting bond with his brother though, as he can see him, meeting up with Sam each night to p β¦lay catch and talk. When a girl comes into Charlie's life, he must choose between keeping the promise he made to Sam or going after the girl he loves. (Read More)
Subgenre: | melodrama |
Themes: | funeraldeathghostherotheftgrief |
Mood: | tearjerker |
Locations: | cemeteryforesthelicopterwoodsbaseball |
Characters: | brother brother relationshipboyteenage boy |
Story: | gooseperiod in titlecharacter name in titlebased on novelbare chested malecar crashhallucinationprayerdeath of brothertwenty somethingcannonpromisekaraokesaving a lifesunset β¦harborgateshipwrecktombstonesailboatsailingparamediccaretakercutmedalliondead brotherpacific northwestpepsibaseball glovewet jeansseeing dead peoplemonopolyplaying catchkilled in a car accidentstanford universitytalking with the deadbrought back to lifehasbrono reflectionfear of abandonmenthit in the crotch with a ball (See All) |
In the final days of World War II, the Nazis attempt to use black magic to aid their dying cause. The Allies raid the camp where the ceremony is taking place, but not before a demon - Hellboy - has already been conjured. Joining the Allied forces, Hellboy eventually grows to adulthood, serving the c β¦ause of good rather than evil. (Read More)
Subgenre: | martial artsblack comedysuperheroparanormal phenomenasteampunkparanormal investigation |
Themes: | magicfuneralmurderherowrestlingapocalypse |
Locations: | cemeterynew york cityrussiamuseumtunnel |
Characters: | love triangleaction heroprofessorself mutilation |
Period: | world war two1940s |
Story: | surprise after end creditsgravecharacter name in titlebloodone word titletitle spoken by characterexplosionpistolfireshootoutcorpseshot to deathfistfightcar accidentface slap β¦battleswordgunfightbrawlfalling from heightbased on comicshowdownhand to hand combatdemonrevolvergood versus evilhalloweenassassinsword fightbased on comic booknew yorkthroat slittingimpalementstabbed to deathmixed martial artsstabbed in the chestsubwaybrunetteno opening creditsanti heroone man armyhit by a carunderwater scenecigar smokingshot in the legone against manystabbed in the backfbiperson on fireelectrocutionpay phonecover upkicked in the faceopening action sceneshot in the shoulderexploding bodytrapfirst partoccultdestinygrenademutantfbi agentexploding buildingsevered handmilkcrushed to deatheaten alivemental institutionreverse footagevisionstabbed in the throatresurrectiontitle appears in writingfather figureaquariumstabbed in the legsouldisfigurementwilhelm screamtelepathytorso cut in halfcartoon on tvoutcastportaltrafficmegalomaniacstabbed in the armkittenhanged manrepeated lineroofgarbage truckcarouselalternate dimensionhit by a trainrosarydecomposing bodyrubik's cubenarration from the gravesevered tongueclairvoyancecandy barpyrokinesisfighting in the airslide locked backtinnitusdark horse comicsnazi occultismmale soldierman eating monsterreanimated corpseinterspecies romancenazi experimentsecret government organisationsix packoccult detectiveowning many catscombat photographymoldaviawebbed fingersaquatic humanoidbreathing apparatustentacled monsterblue flameshumanoid demon (See All) |
Inventor Gepetto creates a wooden marionette called Pinocchio. His wish that Pinocchio be a real boy is unexpectedly granted by a fairy. The fairy assigns Jiminy Cricket to act as Pinocchio's "conscience" and keep him out of trouble. Jiminy is not too successful in this endeavor and most of the film β¦ is spent with Pinocchio deep in trouble. (Read More)
Subgenre: | fairy tale2d animationdisneybased on fairy tale |
Themes: | magic |
Mood: | rainnight |
Locations: | boatseaitaly |
Characters: | father son relationshipboy |
Period: | 19th century1880s |
Story: | anthropomorphic toyanthropomorphismpuppetcharacter name in titlebased on novelone word titledancingtitle spoken by charactersingingfirecryingmirrorcatbooklie β¦beerislandcandlefishchildunderwater scenespankingcigar smokingtransformationumbrellalifting someone into the airblockbusterpoolfaked deathcarnivalapplestarunderage drinkingfairytitle appears in writingbilliardswishsmokecoinlyingdonkeyforename as titlewhalefoxgoldfishmetamorphosisconsciencealtered version of studio logounderage smokingfamous scorestarssnoringcarriagehuman becoming an animalyoung boyreading a letterwish fulfillmentmagic wandstudio logo segues into filmmarionettesneezingpadlocknosepuppeteerrotoscopingpinocchiocuckoo clockcricket the insectjackassschool kidsmona lisafishbowlswallowed wholepuppet theaterafipet fishcagedevil smilestorybook in opening shotwishing on a starhitting oneselfanthropomorphic insectsplashing water on one's faceblowing one's nosecharacter turns greenwirelessjiminy cricketanthropomorphic foxtalking foxunable to sleep (See All) |
Years before meeting Shrek and Donkey, the adorable but tricky Puss in Boots must clear his name from all charges making him a wanted fugitive. While trying to steal magic beans from the infamous criminals Jack and Jill, the hero crosses paths with his female match, Kitty Softpaws, who leads Puss to β¦ his old friend, but now enemy, Humpty Dumpty. Memories of friendship and betrayal enlarges Puss' doubt, but he eventually agrees to help the egg get the magic beans. Together, the three plan to steal the beans, get to the Giant's castle, nab the golden goose, and clear Puss' name. (Read More)
Subgenre: | fairy talecgi animationswashbucklerbased on fairy tale |
Themes: | magicfriendshipbetrayalescapeherorobberytheftredemption |
Locations: | canyon |
Characters: | friendtattoobully |
Period: | zip line |
Story: | goosehatcharacter name in titleflashbacktitle spoken by characterchasethree word titlerescuecatswordmaskanimal in titlejailguitarfoot chase β¦sword fightname in titledisguisebridgemapdouble crossold womancoffeechampagnemurdererbank robberywaterfallhateeggspin offhidinggiantjumping from heightorphanagehonorfull moonbootsinventor3 dimensionalshadowduckanimal name in titlebarking dogkittensaloonfall from heightbullskycapesurrogate motherbeltblack catgrudgecartoon catwanted postergiant animalanimal that acts humanstraight razorfootprintdrinking from a bottleboarcaged animalslow motion action scenewagonflintlock pistolhornfalling asleeprancherextreme closeuplaundry drying on clothes linebaskettalking catwild boarbridge collapseriding a horsepicking a lockpactaurora borealisspyglassgliderwanting a babydust stormrubber duckbased on folk talecovered wagonwhirlpoolcyclonemale in a bathtubglass of milkfriend turned foegiant birdblood oathcommandantbeanstalktabby catframed for crimebirthplacegolden egggiant apejellybeanlocked in a celldesk bellhorse drawn wagonwater wheelflamenco dancejack and the beanstalkpuss in bootsthrowing stonesaccidental heronarrated by title characterscrambled eggcorkhumpty dumptyjumping from a bridgejumping on a moving vehicleblood pactfinger ringfoilmother searches for missing daughterrunning on roofviaductwooden spoonbag of coinscatnipjack and jillrapid growthwalking on a cloudbellowsbig eyesmagical bean (See All) |
GRAND BUDAPEST HOTEL recounts the adventures of Gustave H, a legendary concierge at a famous European hotel between the wars, and Zero Moustafa, the lobby boy who becomes his most trusted friend. The story involves the theft and recovery of a priceless Renaissance painting and the battle for an enor β¦mous family fortune -- all against the back-drop of a suddenly and dramatically changing Continent. (Read More)
Subgenre: | black comedyconspiracyabsurdismmadcap comedy |
Themes: | inheritancefriendshipdeathmurdermarriagemoneyjealousyprisonescapeweddingracismtheftpsychopathhumiliationpoetry β¦greedwealthprison escapeescape from prisonmurder of sister (See All) |
Locations: | cemeterytrainchurchswimming poolhotelsnowmotorcyclebathtubbusbicycletaxielevatorcourtroomrooftopgas station β¦museumsewercable cartwo on a motorcyclehotel kitchen (See All) |
Characters: | little boypolicemother son relationshipmother daughter relationshipfriendboyfriend girlfriend relationshiptattooboybrother sister relationshipsoldierpolice officerpolicemanwriterlawyersister sister relationship β¦thiefartistmaidfrenchgermanolder woman younger man relationshippolice arrestbaker (See All) |
Period: | 1980s1960s1930swinteryear 1968year 1985 |
Story: | part animationgravevoice overtearssexfemale nuditybloodmale nudityviolenceinterviewflashbackdogbare chested malegunkiss β¦cigarette smokingphotographtitle spoken by charactersingingknifechasepistoltelephone callcryingshootoutcorpsefoodface slappunched in the facecatarrestgunfightsecretletterpaintingbookrifleplace name in titlerunningbirthdaydead bodyreference to jesus christtelephonef wordsubjective cameradecapitationbisexualfoot chasegay slurnewspaperorphanflashlightwinecandleold manstrangulationaxemountainstabbingmontageeatingarmywidowstabbed to deathprisonerimmigrantnonlinear timelinejudgesevered headnuntrialno opening creditspaintercoffindrawingfictional warbathold womanmarriage proposallooking at the cameratalking to the cameragunshotflash forwardconfessiontheaterauthorhotel roombinocularsuniformpay phonechampagnefugitivepoisonstatuepursuitgiftwitnessratcinemahandgunrefugeetypewriternewspaper headlineeuropehatehenchmanflirtingeyeglassespoemwaiterfarcelawtreasurehidingwatching a movienosebleedphone boothservantaudiencebrideladderfollowing someonemonkguardbloody noseattorneytelescopesevered fingerguestanimated sequencetitle appears in writingblack and white scenebutlerrosedeath of sisterblack eyefascismconvictskiingcliffsnowinglanternsirenpajamaspipe smokingimprisonmentman cryingbeing followednarrated by charactersaving a lifepresentbarking doghandshakemonasterypost warspiral staircaselast will and testamentsubtitlesalarmpolice chiefmotorbikeconfessionalsecret societytombstoneborder crossinghideoutjuryflaskold ladyfall from heightcookiebunk bedcripplesense of smellcheesedocumentheirperfumevanitycowardprison breakcodetelegraminmatereading a newspaperfacial scarspaplancarouseldead catblack catfiring squadmonumenteastern europefirst person narrationmemorialalpstoy gunhappy birthday to youtrapdoormerry go roundflashback within a flashbackstaffcaskettear on cheekwedding gownmentor protege relationshiptennis courtcentral europeluggagemultiple time framesbirthmarkfictional countrysledfingerreading a lettersuit of armortrolleyhooded figureoathstreetcarturbanhaypassenger trainvisawillalibiart theftskiersnitchobservatoryhotel lobbyborder guardmotorcycle ridingcologneluxury hotelpenis slurstabbedon the lamspeakerconciergeinternment campswitchhit with a rifle buttbullhornpoisonedpastrywall safebellhopabbeyexhibitbondthree sistersconfession boothhotel ownerdeath squadspeaking to audienceyear 1932depositionscentstolen paintingcatacombsrope ladderknocking on doorpantrytrap doordumbwaiterelevator operatorpastry chefdelivery truckpushed off a cliffsleddingpastry shopski jumpkissing a dead bodyshoeshine boywicker basketpersian catpompositybobsledlaundry chuteloaf of breadstrychninebunkclubfoothanging from a ledgepolice whistletalking to a corpsesommelier84 year oldcoat checklying in statevaluable paintingchapter titlespastry boxreference to egon schiele (See All) |
Comical goings on at an exclusive golf club. All the members are wealthy and eccentric, and all the staff are poor and slightly less eccentric. The main character is 'Danny'; he's a caddy who will do almost anything to raise money to go to college. There are many subplots, including the assistant gr β¦een keeper's pursuit of a cute (obviously stuffed) gopher. (Read More)
Subgenre: | cult filmabsurdismslapstick comedy |
Themes: | drugsangergamblingcheating |
Mood: | rain |
Locations: | barswimming poolboatlakeyachtboat accident |
Characters: | little boymusiciandoctorhusband wife relationshipteenagerteenage girlteenage boypriestlittle girllustmaidgrandfather grandson relationshipfishermanpregnant teenagercheating on one's girlfriend |
Period: | 1980s |
Story: | reference to albert einsteineccentricfaintingtearssexfemale nuditynudityviolenceone word titlebare breastsfemale frontal nuditymale frontal nuditymale rear nuditybare chested malekiss β¦cigarette smokingdancingnipplestitle spoken by characterexplosionsingingleg spreadingpantiesshowercryingunderwearurinationblondeslow motion scenecameraundressingbikinibrawlsex in bedbare buttvomitingriflelingeriebedmarijuanaalcoholswimmingfoot chasebedroomflashlightbraold manjudgechildscantily clad femalefishingold womanbartenderpaingunshotpublic nuditybinocularslocker roomuniformmini skirtchampagneumbrellamassagelightningfemale removes her clothesdatepremarital sexfirst partblindfoldkissing while having sexclass differencesflirtingpoemapplausegolfnipples visible through clothingfarceinjuryred dressrageflatulencefrogtournamenttowelpeeping tommale underwearcelebrationdivingreverse footagebloody noseexplosivethunderhit in the crotchbribethunderstormlaughterbetinsultpierpassionate kisstrophybriefsgadgetsports carunclemusic bandrefereeplaying cardscrowinterrupted sextaking a photographsunsetirish americanplaying poollockerblonde womangolf clubchoreographybicyclingwhistlefilm cameramaking outelectric shocklistening to radiojock strapwagermeat cleaverpool partyman in swimsuitpalm treebishopgolf coursescholarshipwhite briefsslappingcamouflagebettingspeedboatpitchforklifeguardpolaroid camerareference to richard nixonscythespeedosmoking potscottishnightgownlarge familymarinasexual intercoursespectatorlong blonde hairseaplanenebraskadance hallniecestruck by lightningman undressingwater skiingorganistgolf ballcountry clubsnobberycandy barbullhorndiving boardgenerositypalm readingsailing boatgolferhorsebackreference to cary grantrodentreference to bob hopeplastic explosiveland developerscoped riflesynchronized swimmingirish accentpregnancy scareplaying golfgroundskeeperlightning strikenikon cameralightning boltloudmouthobnoxiousnessreference to bob marleyreference to jean paul sartrebumblerklutzshoulder massagehuman versus animaljubilationslobgopherback rubreference to the dalai lamacaddysnotcollege boundnose pickingreference to amelia earhartspringboardsprinklergolf caddyhit with a golf ballyacht clubnouveaux richesbaby ruthreference to dick cavetttequila shotfeces in a swimming poolreference to sonja henie (See All) |
After a gentle alien becomes stranded on Earth, the being is discovered and befriended by a young boy named Elliott. Bringing the extraterrestrial into his suburban California house, Elliott introduces E.T., as the alien is dubbed, to his brother and his little sister, Gertie, and the children decid β¦e to keep its existence a secret. Soon, however, E.T. falls ill, resulting in government intervention and a dire situation for both Elliott and the alien. (Read More)
Subgenre: | cult filmmelodramavideofish out of waterchrist allegory |
Themes: | friendshipdeathdrunkennessdancelonelinessspace travelmissing child |
Mood: | car chase |
Locations: | schoolforestbicyclebaseballouter spaceschool busschool nursecar bicycle chase |
Characters: | little boydoctorfamily relationshipsmother son relationshipchildrenbrother brother relationshipbrother sister relationshipgirlnursealienlittle girlsingle motheralien friendship |
Period: | 1980s |
Story: | rhyme in titlechild's point of viewperiod in titlecharacter name in titledogchasebeersunglassesrunningrock musicscientisthalloweengay slurflashlightcalifornia β¦disguiseradioacronym in titlespaceshiplatex glovescostumesuburbmissionproduct placementrace against timedollrabbitscreamflowerufopizzaeyeglassesgameflyingnipples visible through clothingelectronic music scorelifting someone into the airloss of friendtoybeardspacecraftblockbusterclassical musicfrogfull mooninnocenceplaygroundconstruction sitechild protagonistresurrectionmiracleheadphonesabsent fatherhearthealingrefrigeratorgovernment agentextraterrestrialyellinglevitationcartoon on tvexpeditionneedlehiding in a closetmedical maskstuffed animaltrick or treatingstrandedinventionschool principalstethoscoperoadblockmoustachefamous scorequarantinerainboworchestral music scorepizza deliveryalien contactcarrotfamous lineraccoonnoisespacesuitsittingchild swearingyoung boypenis jokeauto theftsurgical gownheadbandghost costumeempathyhazmat suitencounterdefibrillationdefibrillatorimitationketchupmultiple cameosmockerydissectioncoors beerburgerchild driving a cara cappellacurly hairmale tearsbalaclavalifting a male into the airbowler hatfake illnesstransmitterdolly zoomstorm drainhooded sweatshirtcardiopulmonary resuscitationfirst contactr&bstar wars referencetool shedcontemporary settingsetisymphonic music scoreelectrocardiogrambicyclistshot in sequencechildhood innocencefriendly alienscally capbaritonefawnleitmotifrollextraterrestrial alienhealing giftinterspecies friendshipalien visitationfamous entrancepez dispenserbass voicealto voiceeegoldies musicvoice impersonationsearch team (See All) |
In Manhattan, the British limousine driver Alfie is surrounded by beautiful women, most of them clients, and he lives as a Don Juan, having one night stands with all of them and without any sort of commitment. His girl-friend and single-mother Julie is quite upset with the situation and his best fri β¦ends are his colleague Marlon and his girl-friend Lonette. Alfie has a brief affair with Lonette, and the consequences of his act forces Alfie to reflect and wonder about his life style. (Read More)
Subgenre: | melodrama |
Themes: | funeralfriendshipdeathmarriageinfidelitychristmasadulterypregnancydrinkingdrunkennessseductionextramarital affairunfaithfulnessdeath of wifeabortion β¦regret (See All) |
Mood: | rainbreaking the fourth wall |
Locations: | cemeterybeachnew york citybarrestaurantsnowmotorcyclebathtubnightclubtaxikitchencityusasex in car |
Characters: | doctorhusband wife relationshipmother son relationshipafrican americanfriendboyfriend girlfriend relationshiptattooprostitutebabybest friendsingle motherinterracial relationshipemployer employee relationshipolder woman younger man relationshipchinese american β¦cheating on girlfriendself centeredness (See All) |
Period: | winter |
Story: | scootertearscharacter name in titlefemale nudityone word titlethreesomefemale frontal nudityflashbackdogsex scenekissfemale rear nuditycigarette smokinginterracial sexdancing β¦singingpartyknifelesbian kisserectionpantiesbased on playfirevoice over narrationcryingcell phonewoman on topunderwearfoodurinationremakedrinkcondomthongvomitingbeercafemarijuanabritishrivermanhattan new york cityalcoholmenage a troiscleavagewomanmontagewidowmodelapologyscantily clad femalecoffinbirthday partygraveyardtalking to the cameralimousineargumentsplit screenpremarital sexcharacter says i love youflowerobscene finger gesturefreeze frameflirtingmachismopot smokingbeer drinkingheavy rainred dressmale bondingdrug abusepoolone night standteddy bearwomanizerinterracial friendshipinterracial romancebootsbreakupunfaithful wiferejectionsex talkmedical examinationchristmas evebilliardsred pantiescasual sexpromiscuityarrogancechauffeurenglishman abroadimpotencenarrated by characterforename as titlecentral park manhattan new york citymen's bathroomjukeboxbrooklyn bridgeselfishnessbubble bathlollipopunplanned pregnancywalkingmusic boxreference to john f. kennedyreference to james bondred brafemale bartendernew york skylinecommitmentclothing storesocialitemortalitymotor scooterunwed pregnancynew year's eve partydoctor's officewhite male black female relationshipflower shopmirror ballrainy nightcrutchsex on pool tablefear of commitmentcucumberred roseegoismerectile dysfunctionbullfighterlimousine driverunfaithful boyfrienddrunken sexabsinthenipple slipashtrayrainy dayegotistvespaerotic dancingroguedancing in the streetsexual dysfunctiondesigner clothesegg nogrockefeller center manhattan new york citysex on a billiard tabledrinking shotson screen narrationman refusing sexcalla lilycandle lit bathtattoo on breaststreet prostitutereference to aphroditebiopsydriving capwaldorf astoria hotel manhattan new york city (See All) |