Please wait - finding best movies...
Jeff is an anguished man, who grieves and misses his young son that was killed by a driver in a car accident. He has become obsessed for revenge against the man and reckless with his wife and daughter. When Dr. Lynn Denlon, who has troubles with her marriage, is abducted by the deranged Jigsaw's app β¦rentice Amanda, she is brought to a gruesome warehouse to keep John Kramer alive in spite of having a terminal brain tumor. Amanda puts a necklace gadget full of explosives around Dr. Lynn's neck connected to John Kramer's life support system, and tells her that if he dies the device will explode. Meanwhile, Jeff is submitted to a sick game of forgiveness with surprising dark consequences. (Read More)
Subgenre: | sadistic horrorsurvival horror |
Themes: | murder of a police officerhome invasionsadismbrutalitypsychopathextramarital affairtorturebetrayalinfidelitykidnappingrevengemurderdeath |
Mood: | gore |
Locations: | hospital |
Characters: | self mutilationpolice detectivepolice shootoutsingle fatherdetectivenurseserial killerdoctorafrican americanpolice |
Story: | brain surgerybooby trapnecklace bombfemale psychopathfreeze to deathsuffocated with plastic baggame of deathfamous themepig slaughterhead spinplaying goddrill in the headpig maskexposed brainsplit head β¦murderer duohypothermiamurder of a nude womanentrailscriminal masterminddummystabbed in the footpower drillfrozen bodyevil dollno endingbrain tumorbroken necksevered foothookapprenticefemale copshot in the throatslaughterhousescene of the crimeloss of childgun in mouthmind gamescalpeldrunk drivingacidreturning character killed offshot in the necksequel to cult favoritetimebombsuffocationgothsevered legbroken armchainaccidental killingexploding headdisembowelmentstabbed in the headshot in the facegash in the facereverse footagebroken legswat teamloss of wifevideotapecaucasianlifting someone into the airmutilationgothicsyringechainsawsingle parentsurgerydismembermentsevered armexploding bodytrapwitnessevil manrace against timelocker roomlatex glovesshot in the legdrowningthird partchild in perilsevered headjudgenonlinear timelinestabbed in the chestthroat slittingaxedecapitationshot in the backrevolverbombheld at gunpointvomitingslow motion sceneshot in the headshotgunshot in the chestcar accidentblood splattercorpseshootoutpistolsurprise endingknifephotographfemale full frontal nudityfemale frontal nuditybare chested malefemale nudityviolenceflashbackbloodsequelfightgun (See All) |
Jigsaw and his apprentice Amanda are dead. Now, upon the news of Detective Kerry's murder, two seasoned FBI profilers, Agent Strahm and Agent Perez, arrive in the terrified community to assist the veteran Detective Hoffman in sifting through Jigsaw's latest grisly remains and piecing together the pu β¦zzle. However, when SWAT Commander Rigg is abducted and thrust into a game, the last officer untouched by Jigsaw has but ninety minutes to overcome a series of demented traps and save an old friend or face the deadly consequences. (Read More)
Subgenre: | survival horrorpolice procedural |
Themes: | sadismbrutalitytorturekidnappingmurderdeathrevengerapepregnancyinvestigationobsessiondepressionmadness |
Mood: | gore |
Locations: | hospitalschoolhotelpolice stationmotelabandoned factory |
Characters: | self mutilationpolice detectivepolice shootoutdetectiveserial killerpolicehusband wife relationshipprostitutepolice officerhostagelawyerpimpengineercoroner |
Story: | booby trapgame of deathfamous themepig maskexposed brainevil dollapprenticeslaughterhousemind gamescalpelreturning character killed offshot in the neckgothsevered legaccidental killing β¦exploding headdisembowelmentgash in the faceswat teamloss of wifevideotapedismembermentsevered armtraprace against timesevered headnonlinear timelinestabbed in the chestthroat slittingaxerevolverheld at gunpointshot in the headshotgunshot in the chestblood splattercorpseshootoutpistolsurprise endingknifephotographflashbacksequelfightbloodviolencenumber in titlemale nuditymale frontal nuditybeatingshot to deathfistfightmachine gunrescuebrawldead bodyinterrogationcriminalf wordbound and gaggedmassacreimpalementstabbed to deathsuicide attempttied to a chairchild abusepolice officer killeddrug addictbeaten to deathkeyfbielectrocutionmissing personkicked in the facethreatened with a knifekillingcorrupt coprevelationsociopathcomafbi agenthammerfourth partsevered handrapistcrushed to deathpresumed deadcrime scenefight to the deathstabbed in the throatgunshot woundmutebroken glassjunkiestabbed in the legthrown through a windowautopsyone dayeye gougingdisfigurementstabbed in the eyeabusive fatherdead woman with eyes openlasersightpunchabusive husbandbloodbathmiscarriagemoral dilemmaphysical abuseintestinesbarbed wireclinicpolice interrogationglasswrist slittingdripping bloodcrushed headsawhanged manbleeding to deathshot through the mouthtwo way mirrorrighteous ragecut into pieceshit with a hammerblack copex wifecaptivityserial rapistfire alarmhooded figuretortured to deathmausoleumpregnant woman murderedhotel managerwriting on a wallbodily dismembermentscalpingviolent sexdeath trapstomachmouth sewn shutseedy moteleyes sewn shutfbi profilerloss of babymeat processing factory (See All) |
When detective Eric Matthews is called to a crime scene of a victim of Jigsaw, he finds a lead to the place where he is hidden. Once there, he realizes that Jigsaw trapped his son Daniel Matthews with three women and four men in a shelter, and they are inhaling a lethal nerve gas. If they do not use β¦ an antidote within two hours, they will die. Eric follows with increasing desperation the death of each member of the group in monitors, while trying to convince Jigsaw to release his son. (Read More)
Subgenre: | sadistic horrorsurvival horror |
Themes: | sadismbrutalitytorturekidnappingdeathmurderdrug usecancerpanicdrug addictionpolice brutality |
Mood: | gorenightmare |
Locations: | bathtubelevator |
Characters: | self mutilationdetectiveserial killerpolicefather son relationshippolice officer |
Story: | booby trapgame of deathfamous themeplaying godpig maskevil dollsevered footmind gamegothbroken leglifting someone into the airgothicsyringetraplatex gloves β¦child in perilstabbed in the chestthroat slittingvomitingslow motion sceneshot in the headblood splattercorpsepistolsurprise endingbare chested maleviolenceflashbackbloodsequelfireshot to deathsecond partflashlightdrug dealerimpalementsuicide attempttoiletargumentdrug addictelectrocutionbaseball batheroinarsoncorrupt copburned alivehypodermic needletape recordercrying womanvillainesscrying manmale underwearsurveillance camerajunkiespecial forcessafeblood on shirtpolice raidjuvenile delinquentcharacters killed one by oneneedleshoutingshot in the eyedripping bloodrazor bladesawcowardcop killerflamepsychological torturespitting bloodman on firesole survivorracial stereotypetrapdoorcrooked copvcrknife in the chestantidotecrematoriumoxygen maskbodily dismembermentbroken fingerlifting a female into the airlifting an adult into the airfurnaceboxer briefsflamesviolence against a childtorture deviceviolent copnerve gasvillain escapesneedlesthroat slit (See All) |
Detective Hoffman is deemed hero after he saves a young girl and "escapes" one of Jigsaws game, or do it seems. Special Agent Strahm is suspicious of him after his assistant, Agent Perez dies. While Strahm dives into Hoffman's past, a group of 5 people who all helped burn a building which was suppos β¦edly abandoned are put to a series of tests, set up by the Jigsaw Killer. (Read More)
Subgenre: | survival horror |
Themes: | kidnappingrevengeinvestigationblackmailguilt |
Mood: | gore |
Locations: | hospitalwaterelevator |
Characters: | self mutilationdetectiveserial killerdoctortattoobrother sister relationshipself surgery |
Story: | booby trapgame of deathfamous themepig maskreturning character killed offgothbroken armexploding headdisembowelmentstabbed in the headgash in the facevideotapeexploding bodyevil mandrowning β¦severed headthroat slittingdecapitationbombheld at gunpointshot in the headshot in the chestblood splattercorpsepistolsurprise endingbare chested malefightflashbacksequelviolencebloodexplosioncell phoneshot to deathpunched in the facemasknumbered sequelreporterstabbingpolice officer killedstabbed in the backkeyelectrocutionspeechex convictarsoncorrupt coprevelationhead buttfbi agentloss of loved onepuzzlecrushed to deathbald manstabbed in the throatimpostorstabbed in the neckbroken glassjunkiestabbed in the legdeath of protagonistdeath of sisterblood on shirtboxfifth partnewspaper clippingframed for murderprequeltorso cut in halfelectricityneedlegerman shepherdpromotiondouble barreled shotgunrazor bladesawbleeding to deathburnt bodyteamworkcountdowncut handdragging a bodysliced in tworogue coptied to a tabletime limitdecapitated bodycollarjigsawplanting evidencecrushed handfalse evidencependulumtape playercopycat murdertracheotomyswastika tattoocellular phone tracevideo willhead bracesafe deposit box keystrongboxprequel to sequelloose ends (See All) |
Waking up in a undisclosed location in a unknown room two men, adam and gordon are trapped into a single room with a dead body. Given random tools with riddles hidnen around the room. Wondering who could have done this there are clues to who might of done it; the jigsaw killer. The question is not j β¦ust who but why would a serial killer leave two men in a room. Both adam and gordon hiding secrets they must trust and work together to get out or die...can they survive jigsaws game or die trying? (Read More)
Subgenre: | sadistic horrorsurvival horrorindependent filmcult filmslasher flick |
Themes: | home invasionpsychopathextramarital affairtortureinfidelitykidnappingmurdermarriageescapecancerinsanityclaustrophobiaself harm |
Mood: | gorecar chaseslasher |
Locations: | hospitalhotelurban setting |
Characters: | self mutilationpolice detectivedetectiveserial killerdoctorpolicehusband wife relationshipfather daughter relationshipphotographerhostagekiller |
Story: | booby trapgame of deathfamous themeplaying godpig maskevil dollsevered footmind gamedisembowelmentgothicchild in perilthroat slittingrevolvershotguncorpse β¦pistolsurprise endinggunflashbackviolenceone word titlecamerasecretbathroombound and gaggedstabbed to deathtoiletpolice officer killedclownpuppetperson on firepoisonfirst partburned aliveslow motiontape recorderblockbusterparking garageblack humorbarefootcrime scenetrappedbody countextortionimprisonmentvideo surveillancehiding in a closetrestroompolaroidelectric shockamputationbased on short filmsawaudio cassettechainedextreme violencemacabredarkroomtwo way mirrorpsychological torturelocked in a roomflashback within a flashbackvillain not really dead clichebludgeoningbear trappretending to be deadrepentanceorderlyforced suicidechild in dangerdeath trapbad guy winstrapped in a roomdioramavillain escapeswalking on broken glass (See All) |
Arkin escapes with his life from the vicious grips of "The Collector" during an entrapment party where he adds beautiful Elena to his "Collection." Instead of recovering from the trauma, Arkin is suddenly abducted from the hospital by mercenaries hired by Elena's wealthy father. Arkin is blackmailed β¦ to team up with the mercenaries and track down The Collector's booby trapped warehouse and save Elena. (Read More)
Subgenre: | sadistic horrorsurvival horrormartial artshorror b movie |
Themes: | torturekidnappingmurderrevengedeathescapetrauma |
Mood: | gore |
Locations: | hospitalnightclub |
Characters: | self mutilationserial killerhusband wife relationshipfather daughter relationshipbrother sister relationshipfatheryounger version of charactermysterious villainserial murdererkiller dog |
Story: | booby trapsevered legbroken armexploding headgash in the facebroken legswat teamsyringedismembermentsevered armexploding bodytrapchild in perilsevered headstabbed in the chest β¦throat slittingslow motion sceneshotgunshot in the chestblood splattercorpsepistolsurprise endingknifebare chested malefemale nuditysequelbloodviolenceflashbacktwo word titledancingtitle spoken by characterexplosionpartylesbian kisschaseshot to deathfistfightpunched in the facecar crashsubjective cameramassacredeath of friendimpalementstabbed to deathanti heronews reportcharacter repeating someone else's dialoguestabbed in the backperson on firecharacter's point of view camera shotkicked in the faceskeletoncharacter says i love youmercenaryex convictobscene finger gesturegrenadeburned alivekilling an animalwarehousemass murdertied to a bedstabbed in the stomachspiderskullmexican standoffcrushed to deathmasked mancamera shot of feetswitchbladetrappedsevered fingerteamjunkietitle appears in writingthrown through a windowassault rifleknife fighttitle at the endslaughterbody landing on a carraised middle fingerlens flarerescue missionmasked killerfirefightertorso cut in halfimpersonating a police officerserial murdercrucifixionstabbed in the handbrainwashingmazekilling a doggerman shepherdstandoffstabbed in the armhanging upside downbody in a trunkcrashing through a windowheld captiverazor bladecrushed headravestabbed in the shouldergraphic violencecheating boyfriendstabbed in the facehomeless personcut into piecesclose up of eyegrindhouse filmcaptivityreturning character with different actorcoercionbear traphung upside downflickering lightwoman punches a manswattied to a tablecadavercircular sawbreaking a car windowsevered tonguegiallo esquehearing aidstrapped to a bombpeepholearm casthuman skeletonstabbed through the chinlocked in a cageteam uptrip wireabandoned hotelhung from a hookiron maidenrube goldberg machinebuilding firefusepleading for helpclimbing down a ropenailed to a wall (See All) |
It's been seventeen years since Leo Barnes (Frank Grillo) stopped himself from a regrettable act of revenge on Purge Night. Now serving as head of security for Senator Charlie Roan (Elizabeth Mitchell), his mission is to protect her in a run for president and survive the annual ritual that targets t β¦he poor and innocent. But when a betrayal forces them onto the streets of D.C. on the one night when no help is available, they must stay alive until dawn...or both be sacrificed for their sins against the state. (Read More)
Subgenre: | survival horrormartial artsblack comedysuspenseconspiracydystopiapolitical conspiracy |
Themes: | home invasionsadismbrutalitypsychopathbetrayalkidnappingdeathrevengemurderfriendshippoliticsfearescapedeceptioncorruption β¦paranoiainsanitysurveillanceexploitationhopepaniccourageself sacrificenear death experiencemurder of family (See All) |
Mood: | gorenightslasher |
Locations: | churchhelicopterairporturban settingtruckrooftoptunnel |
Characters: | self mutilationafrican americantattoopriesthostagetough guywarrioraction herosniperrussiansniper rifle |
Period: | near future |
Story: | booby trapshot in the throatreturning character killed offshot in the neckstabbed in the headshot in the facechainsawexploding bodytrapevil manrace against timeshot in the legthird partsevered headstabbed in the chest β¦axedecapitationshot in the backrevolverbombheld at gunpointslow motion sceneshot in the headshotgunshot in the chestblood splattercorpseshootoutpistolknifephotographbare chested malesequelbloodfightflashbackviolenceexplosionchasefirecell phonebeatingshot to deathfistfightmachine gunrescuepunched in the facewritten by directorswordgunfightbrawlshowdownriflebeerhand to hand combatcar crashcombatf wordsurvivalflashlightbound and gaggedgangambushmassacreambulancedeath of friendmontagestabbed to deathmixed martial artspoliticianimmigranttied to a chairmapman with glassesno opening creditsanti herodisarming someoneone man armyhit by a carritualvannews reportshot in the foreheadracial sluron the runflash forwardattempted murderdrug addictbinocularscharacter repeating someone else's dialoguedangerstabbed in the backcostumeprologueperson on fireelectrocutionfugitivemissionproduct placementknocked outkicked in the facebaseball batstreet shootoutshot in the shouldermanipulationamerican flagbodyguardthreatlaptopelectionthreatened with a knifemercenaryshot in the armsilencerobscene finger gesturesacrificeclass differenceswashington d.c.ak 47hand grenadeburned aliveassassination attemptmass murdermacheterace relationstouristsociopathhelmetsecurity camerawalkie talkieoverallskicked in the stomachwristwatchpress conferencerebelcovered in bloodrebellionparking garagemexican standoffwhite housegun fuinterracial friendshippreachercrushed to deathsocial commentarymasked manmexicandamsel in distressshopliftingbraverycynicismministerresistancedual wieldstabbed in the throathatredhit in the crotchmanhuntmercilessnesschaosstabbed in the neckconvenience storespecial forcessenatorpunched in the chestassault rifleghettoaerial shotknife fightblood on shirtcommandoschoolgirl uniformbulletproof vestbody landing on a carraised middle fingertied feetduct taperescue missionjuvenile delinquentethnic slurburned to deathmoral dilemmapolitical corruptiongatling gunmedia coveragebullet timetracking devicetext messagingshot through a windowhappy endingface maskfinal showdownbrainwashingtaserskinheaddronemilitiayoung version of characterstabbed in the armneo nazicommando unitparamedicanarchyhit by a truckwhistlingstreet fighthanged manbullet woundfight the systempresidential electioncathedralfilmed killingcommando raidstabbed in the facetragic pastdeath of familygarbage truckgang memberresistance fighterassassination plotsocial decayattempted robberyguillotinemaceslow motion action scenedetonatorwriting in bloodcrushed by a carbarricadeipodreference to george washingtonwashington monumentwhite supremacistmasked womanprotectorsouth africansecret tunnelfemale politicianhanged bodyritual sacrificependulumdelineo fascismbutterfly knifehit by a vanlincoln memorialemergency broadcast systemburning bodyhotwiringaid workerarrow through the headfemale senator (See All) |
3 backpackers are in Amsterdam where they get locked out of their youth hostel. They are invited into a man's house where he tells them of a hostel somewhere in eastern Europe where the women are all incredibly hot and have a taste for American men. When they get there, everything is too good to be β¦true - the hostel is "to die for" (Read More)
Subgenre: | sadistic horrorsurvival horrorcult filmconspiracyslasher flick |
Themes: | sadismbrutalitypsychopathtorturekidnappingrevengemurderdeathsuicidedrinkingfearescapedeceptionseduction β¦travelpolice brutality (See All) |
Mood: | gorecar chaseslasher |
Locations: | trainpolice stationbrothelmuseumtrain stationsex in a bathroom |
Characters: | serial killerfriendprostituteamerican abroadslasher killer |
Story: | drill in the headpower drillslaughterhousescalpelsevered legmutilationgothicchainsawsurgerydismembermenttrapchild in perilsevered headthroat slittingshot in the back β¦held at gunpointvomitingshot in the chestblood splattercorpsepistolphotographfemale frontal nuditybare chested malefemale nudityviolencebloodone word titlethreesomemale rear nudityfemale rear nuditydancingtitle spoken by characterpantiescell phonebeatingshot to deathface slapprostitutionhandcuffssubjective camerafoot chasebound and gaggedstrangulationdeath of friendtied to a chairhit by a carcontroversysearchfemme fataleshot in the foreheadpainon the runbeaten to deathscreamingcharacter's point of view camera shotmissing personcover upcollege studentdisappearanceglassespremarital sexfirst partwhippingeuropepot smokingwarehousemachetedesperationsevered handcovered in bloodsadomasochismcrying manpassportsexual desirecameorear entry sexstealing a carwhipmercilessnesspunched in the stomachtitle appears in writingscissorstitle at the endvegetarianeye gougingtoursurprise after end creditsdrugged drinkpsychopathic killermysterious manbongbag over headforeignerburnt faceamsterdam netherlandshead bashed inwoman in bra and pantiesicelandwhistlingbusiness cardunsubtitled foreign languagefinger cut offcrushed headcorrupt policekiller childextreme violencespadrillcut into pieceshit with a hammersole survivorlocked in a roomstupid victimnude photographhit by a traintorture chamberbodily dismembermentbubble gumblowtorchhostelhit with a rocksledge hammerbackpackersaladhit on the head with a rockburn injuryslovakiaachilles tendon cuthead in a toiletugly americanhit by a doorsevered toebegging for lifefanny packthrown out of a barbratislavareflection in glasshousehold cleaning gloveswhimperingkid gangtitle appears in text on screensearching for friendsearching for missing friend (See All) |
A couple are driving home when their car breaks down just as the Purge commences. Meanwhile, a police sergeant goes out into the streets to get revenge on the man who killed his son, and a mother and daughter run from their home after assailants destroy it. The five people meet up as they attempt to β¦ survive the night in Los Angeles. (Read More)
Subgenre: | survival horrorsuspensedystopia |
Themes: | home invasionbrutalitypsychopathkidnappingdeathrevengemurderdeceptiondeath of fathersurveillancehomelessnessself sacrificehuntingnear death experience |
Mood: | goreslasherone night |
Locations: | hospitalmotorcyclelos angeles californiabusapartment |
Characters: | policefather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoohostagetough guywaitresssniperex husband ex wife relationshipsniper riflehomeless man |
Period: | 2020s |
Story: | booby trapshot in the throatshot in the facechainsawtraprace against timeshot in the legstabbed in the chestaxeshot in the backrevolverheld at gunpointslow motion sceneshot in the headshotgun β¦shot in the chestblood splattercorpseshootoutpistolsurprise endingknifephotographbare chested maleviolencebloodsequelexplosionfirecell phoneshot to deathmachine gunrescuewritten by directorsecond partcar crashf wordsurvivalfoot chasegangambushambulancemansionstabbed to deathtied to a chairsubwayexploding carno opening creditsanti herohit by a carnews reportshot in the foreheadon the runlimousinecharacter repeating someone else's dialogueperson on firecharacter's point of view camera shotshot in the shoulderdeath of sonlaptopneck breakingdie hard scenariomercenaryshot in the armclass differencesak 47hand grenadesabotageburned alivemass murdermacheteshot in the stomachparking garagemasked manapartment buildinggas maskstealing a carresistanceassault rifleghettoone daybulletproof vestlens flareflamethrowersirengatling gunmedia coverageauctiontracking devicehit with a baseball batmolotov cocktailbag over headhiding in a closetarmored cararms dealerfilm starts with textteenage daughterman punching a womanhanged mandeath of boyfriendcar set on fireresistance fighternight vision gogglesman with no namerunning out of gaspainted facemilitantgas grenademass deathlatin americansemi truckdune buggysororicidepirate broadcastingemergency broadcast systembody in a dumpsteryear 2023 (See All) |
Subgenre: | survival horrorindependent filmcult filmblack comedysuspensefish out of waterslasher flickteen movieteen horrorpsychological thriller |
Themes: | murder of a police officerhome invasionbrutalitypsychopathtorturekidnappingmurderrevengedeathfriendshipfearescapeparanoiainsanitypanic β¦cannibalismcouragehuntingwildernessnear death experience (See All) |
Mood: | goreslasher |
Locations: | forestbathtubwoodspolice cartruckcavegas station |
Characters: | self mutilationteenagerboyfriend girlfriend relationshipteenage girlteenage boypolice officerhostageinterracial relationshipslasher killer |
Period: | 2000s |
Story: | booby trapslaughterhousesevered legbroken legdismembermentsevered armshot in the legsevered headstabbed in the chestaxedecapitationshot in the backslow motion sceneshot in the headshotgun β¦car accidentblood splattercorpsepistolsurprise endingknifebloodviolencesexcigarette smokingexplosionchasefirecryingcell phonebeatingshot to deathrescuefalling from heightshowdownriflecar crashmarijuanacollegesurvivalfoot chaseflashlightbound and gaggedambushmountaindeath of friendstabbed to deathtoiletmapexploding cardisarming someonehit by a carpolice officer killedtreestalkerdangerstabbed in the backprologuescreamingperson on firefirst of seriesdollcollege studentscene during end creditsprankstalkingfirst partthreatened with a knifewaterfallnewspaper headlinearsonpickup truckpot smokingbow and arrowmachetemutantgroup of friendstied to a bedjumping from heighttorchredneckdamsel in distressstealing a carbraveryjob interviewcannibalmercilessnesspolice officer shotengagementaerial shotblood on shirtone daydisfigurementgasolinebody countaxe murdercharacters killed one by onearrowtank topsmokeflat tiresouthern accenthit with a baseball batbarbed wirecar troublemolotov cocktailjunkyarddead animalold dark househuman monstermental retardationarcheryshot in the eyedeputyhillbillycabin in the woodsroadblockoffscreen killingcdmedical studentdeath of boyfriendstabbed in the shouldertow truckarcherexploding housepsychological tortureroadpool of bloodrock climbingstupid victimvillain not really dead clicheclimbing out a windowpolice officer shot in the headextreme close upleg woundsinistershot with a bow and arrowbear trapsevered eargas station attendantcar wrecksurprise during end creditsabandoned cardead teenagerwest virginiaham radiostate trooperclichelatin americanwatchtowerdragging a dead bodyhead cut in halfevil laughteraxe murdererdenturesinbreedingmountain mandeath trapdeath of fiancevictimizationamateur radiowoman wearing a tank toprolling down a hillradio towercell phone out of rangeno cell phone signalstabbed through the mouthgas tankpine forestreference to a white picket fenceboiling potwrong turntreating a woundranger tower (See All) |
In Ruggsville, Texas, the police under the command of Sheriff John Quincy Wydell attack the house of the sadistic serial killers Firefly family (a.k.a. The Devil's Reject) and they arrest mother Firefly, but Otis B. Driftwood and Baby Firefly escape from the siege. Tiny is wandering nearby the house β¦ and also escapes. Otis and Baby call their patriarch, the mad clown Captain Spaulding and they schedule to reunite at an isolated motel in the desert. When Otis and Baby arrive, they kidnap two families of singers, using sadism and violence against the harmless persons. Meanwhile, Sheriff Wydell promises to capture and kill the runaways, seeking revenge for the death of his brother, the Deputy George Wydell. (Read More)
Subgenre: | sadistic horrorindependent filmcult filmblack comedypsycho thriller |
Themes: | murder of a police officersadismbrutalitypsychopathtorturebetrayalkidnappingdeathmurderrevengefriendshipsuiciderapefearescape β¦deceptionseductionangerdeath of fatherdeath of motherparanoiainsanityhumiliationevilexploitationcrueltycannibalismvengeanceself sacrificepolice brutalitymadnessnear death experiencemurder of family (See All) |
Mood: | gorenightmareambiguous ending |
Locations: | barbathtubpolice stationfarmroad tripmotelgas stationtexasbrothel |
Characters: | police shootoutnurseserial killerpolicefamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoobrother brother relationshipbrother sister relationshipprostitute β¦police officerhostagetough guyvillainmaidsheriffterrorpimpaunt niece relationshipsuicide by copmurder of a prostitute (See All) |
Period: | 1970syear 1978 |
Story: | female psychopathpig maskentrailsshot in the throatreturning character killed offshot in the neckgothsevered legevil manshot in the legchild in perilstabbed in the chestthroat slittingaxeshot in the back β¦revolverheld at gunpointvomitingslow motion sceneshot in the headshotgunshot in the chestblood splattercorpseshootoutpistolknifephotographfemale full frontal nuditybare chested malesequelflashbackviolencebloodmale rear nuditydogsex scenefemale rear nuditycigarette smokingtitle spoken by characterexplosionchasepantiesshowerfirewoman on topbeatingdreamshot to deathmachine gunhorseface slaprescuepunched in the facewritten by directorarrestgunfightsex in bedbare buttshowdownriflebeersecond partdead bodylow budget filminterrogationmarijuanajailhandcuffscriminalf wordsurvivalfoot chasegay slurbound and gaggedambushstrangulationdeath of frienddrug dealerimpalementcocainestabbed to deathfemale pubic hairtied to a chairwhite pantiescultdream sequenceanti herodouble crosspolice officer killednews reportcigar smokingshot in the foreheadracial sluron the runbeaten to deathstabbed in the backscreamingclownelectrocutionpay phonefugitiveknocked outopening action sceneattempted rapefarmershot in the shouldermanipulationdeath of brothersplit screendeath of sonpigbasementneck breakingmurdererthreatened with a knifechickenprofanityshot in the armobscene finger gesturewhippingcult directorcowfreeze framestylized violencemaniachead buttmass murderlooking at oneself in a mirrorscene during opening creditsragecowboy hatstabbed in the stomachkicked in the stomachphone boothcovered in bloodgrindhouserapistfemale killerinterracial friendshipmasked mangas maskwatching televisionrampageredneckcrime scenestealing a carstabbed in the throathatredhit in the crotchcannibalmercilessnessstabbed in the neckbutcherescape attemptreference to satancigarette lighterstabbed in the legdeath of protagonistpunched in the chestjumping through a windowthrown through a windowwisecrack humorblood on shirtone daybounty hunterslaughterhighwaybulletproof vesttough copdisfigurementknife throwinggasolinebarbecuebody countaxe murderranchsexual assaultkilling spreedeath of loved onefemale in showernewspaper clippingmedia coveragesouthern accentclose up of eyesnews reportershot through a windowmarijuana jointpervertserial murderpsychopathic killerreference to elvis presleyprayingbad guymadmanface maskstabbed in the handnecrophiliaforced to stripspit in the facehomagepistol whipmisogynisthuman monstersexual violencestandoffhomicidal maniacvulgaritytrailer homefilm starts with texthit by a truckdeputyman kills a womantrailer parkman punching a womanfemale villainsole black character dies clichemacabrecarjackinggraphic violenceexploding housedeath of familyreference to star warsknife murderbutt slappsychological torturecross countryfilm criticfemale victimcocaine snortinghouse on firemurder spreemass murdererbutcherygrindhouse filmevil clownbilingualisminnocent person killedcrime spreereturning character with different actorknife in the chestserial rapistslow motion action sceneno survivorssouthdutch anglemodern westernsuit of armorcult figurerunning out of gaskiller clownwriting in bloodred light districtmultiple homicidecmnffemale serial killersexual torturepossebody armorman punches a womantrailer trashpolice vigilantismblockadegas grenaderoadkillreference to jack the rippersevered faceclown makeupsatanicroadiereference to mark twainviolence against a womannail through handoral rapecattle prodmutilated bodynecrophiliacderanged womanreference to groucho marxderanged manblood bathforced nudityrape with a gun barrel (See All) |
Mankind discover the existence of the Vampire and Lycan species and they begin a war to annihilate the races. When Selene meets with Michael in the harbor, they are hit by a grenade and Selene passes out. Twelve years later, Selene awakes from a cryogenic sleep in the Antigen laboratory and meets th β¦e Vampire David. She learns that she had been the subject of the scientist Dr. Jacob Lane and the Vampire and Lycan species have been practically eradicated from Earth. But Selene is still connected to Michael and has visions that she believes that belongs to Michael's sight. However she has a surprise and finds that she has a powerful daughter named Eve that has been raised in the laboratory. Now Selene and David have to protect Eve against the Lycans that intend to use her to inoculate their species against silver. (Read More)
Subgenre: | martial artsconspiracydystopiafish out of watercyberpunkdark fantasy |
Themes: | home invasionkidnappingrevengemurderdeathescapemonsterinvestigationsupernatural powersurveillancepolice brutality |
Mood: | goredarknesspoetic justice |
Locations: | helicopterelevatorpolice stationrooftopsewer |
Characters: | self mutilationpolice detectivedetectivedoctorpolicefather son relationshipmother daughter relationshipfemale protagonisthostagevampirewarriorlittle girlsecurity guarddaughter |
Period: | future2010s |
Story: | shot in the throatscene of the crimescalpelstabbed in the headshot in the facegothicsevered armexploding bodylocker roomshot in the legchild in perilsevered headstabbed in the chestthroat slittingaxe β¦decapitationshot in the backrevolverbombheld at gunpointshot in the headshotgunshot in the chestcar accidentblood splattercorpseshootoutpistolsurprise endingknifephotographbare chested maleviolencebloodsequeltwo word titleexplosionchasefirebeatingshot to deathfistfightmachine gunrescuepunched in the facebattleswordgunfightbrawlfalling from heightshowdownhand to hand combatcar crashhandcuffscombatkung fuscientistsubjective cameragood versus evilsurvivalflashlightstrangulationmassacreimpalementstabbed to deathcolon in titlemixed martial artsno opening creditsanti herohit by a carfictional warunderwater scenecreaturesearchnews reporttransformationshot in the foreheadone against manycharacter repeating someone else's dialoguebeaten to deathstabbed in the backattackcharacter's point of view camera shotcover upkicked in the facetough girlshot in the shoulderinjectionneck breakingmercenaryshot in the armhenchmanexperimentwerewolfhand grenadekilling an animalhypodermic needlesecurity camerakicked in the stomachfourth partgiantjumping from heightparking garageaction heroineanimal attackgun fucrushed to deathsocial commentaryback from the deadfemale warriorstealing a carexplosivestabbed in the throatwhippartner3 dimensionalresurrectionstabbed in the leg3dpunched in the chestjumping through a windowthrown through a windowbody landing on a carknife throwingstabbed in the eyemutationflamethrowertelepathytorso cut in halfdesert eaglesuper strengthstabbed in the armshot in the eyegenetic engineeringdamman kills a womanbitten in the neckepiloguestabbed in the shoulderopen endedcurestabbed in the facewoman fights a manheart ripped outone woman armyfemale gunfighterelevator shaftanti heroineregenerationcryogenicswoman's neck brokenmegacorporationstabbed in the mouththroat rippingantidotewoman kills mansuper speeddocksdark heroineserumbitten on the armhybridstabbed in the heartfalling through a windowwoman murders a manhole in chestknife in chestpvcfalling into a riverflash grenadewoman fights manchild vampireunderwater explosionelevator crashlatex catsuiturban gothicvampire versus werewolfopening creditscut headback to lifesexy suitdropped from heightyear 2024 (See All) |
Chucky hooks up with another murderous doll, the bridal gown-clad Tiffany, for a Route 66 murder spree with their unwitting hosts, two eloping high-school graduates.
Subgenre: | cult filmblack comedyconspiracysupernatural |
Themes: | murder of a police officersadismbrutalitypsychopathbetrayalkidnappingmurderdeathrevengelovesurrealismmarriagemoneypregnancyfear β¦escapeweddingdeceptionseductionrobberysupernatural powerparanoiaredemptionunrequited lovepanicpolice brutalitypolice corruptionnear death experienceregret (See All) |
Mood: | gorecar chaseslasherpoetic justice |
Locations: | hotelcemeterybathtubwaterkitchenpolice stationpolice carroad tripmotel |
Characters: | police detectivedetectiveserial killerpolicehomosexualteenagerboyfriend girlfriend relationshiptattooteenage girlteenage boypolice officerpriesthostagethief β¦maidgay teenagerex boyfriend ex girlfriend relationshipuncle niece relationshipgay friendself referentialmurder of girlfriend (See All) |
Period: | 1990s |
Story: | booby trapmurder of a nude womanevil dollsequel to cult favoritesuffocationgothshot in the facegash in the facemutilationgothicchainsawexploding bodyrace against timelocker roomstabbed in the chest β¦throat slittingrevolverheld at gunpointslow motion sceneshot in the chestcar accidentblood splattercorpsepistolsurprise endingknifephotographbare chested malesequelviolencefightbloodgunsexcharacter name in titlekisscigarette smokingchasefirecryingcell phonebeatingshot to deathmirrorrescuewatching tvbare buttlettershowdownrock musiccar crashdead bodymarijuanahandcuffstelephonef wordorphanflashlightambushstrangulationmansionmontagebridgeimpalementtied to a chairexploding carfalse accusationdisarming someonecoffindrawinghit by a cardouble crossritualpolice officer killedvanfemme fatalegraveyardnews reportmarriage proposalon the runattempted murderargumentstalkercharacter repeating someone else's dialoguedangerstabbed in the backscreamingelectrocutionpay phonefugitiveumbrelladollknocked outbaseball batlightningskeletonringscarfishnet stockingsstalkingfilm within a filmchildbirthpremarital sexratsuspiciontied upobscene finger gesturenewspaper headlinearsoncorrupt copmaniacprivate detectiveflirtingpot smokingsabotagefireplacehead buttheavy rainsociopathscene during opening creditsragetoyfourth partspiderphone boothskullbirthblack humormexican standofffemale killerback from the deadmale underwearpresumed deadwoman in jeopardydamsel in distressnicknamesevered fingernew jerseyblood on facemisunderstandingdual wieldresurrectionconvenience storedark humorescape attemptcigarette lighterframe upcon artistlaughterthrown through a windowwisecrack humortitle at the endrainstormdisfigurementknife throwingraised middle fingertrailertied feetdead woman with eyes openvoodooframed for murderprivate investigatorengagement ringclose up of eyesspellmarijuana jointabandoned buildingblood on camera lensharassmenthysteriaface maskfinal showdownteenage lovescene before opening creditsabuse of powerpicturelighterpolice chieftelling someone to shut uphomicidal maniacdisposing of a dead bodytrailer homeframedmasturbation referenceburnt facebody in a trunkhit by a truckcookietrailer parkmacguffinwoman kills a mandomestic abusecleaning ladyburnt bodycar set on firechapeldisfigured facehit with a shovelrepeated linemultiple murderamuletknife murderrecreational vehiclepillowhandymantongue in cheekpentagrammass murdererstupid victimvillain not really dead clicheinnocent person killedproposalgrave diggingovenasphyxiationdecomposing bodyabusive relationshipnail polishfemale serial killernailwine bottlereference to frankensteinchange of heartdead parentshockey maskfragments of glassanti villainfemale thiefstabbed in the heartknife wounddeath of unclewaterbedplanting evidenceevil laughterfalse accusation of murderhandcuffed to a bedkiller dollairbagsoul transferencedumb policereference to martha stewartincantationlovers on the lamsee you in helltwo killersaccused of murdermultiple stabbingrunaway teensmothered with a pillowknife in backchief of policesmothered to deathwoman electrocutedexploding trailerfemale sociopathreference to jerry springerhunkbreaking a plateburnedtalking dollbig nosebiting handpiercing ripped outcleaning up bloodelectrocuted in bathtublegal guardianalpha maleelectrical firereference to bonnie and clydetight dressbreathalyzernose piercinghidden bodycriminal duoerieloss of unclemeatballspushed through a windowshot through the headbindsuitebiting an earelopingtreatcrayon drawinglip piercingreference to christian slatersinister coupleplanting drugswater bed (See All) |
A zombie is found aboard a boat off the New York coast which belongs to do a famous scientist. Peter West, a journalist, travels to the Antilles with Ann, the daughter of the scientist. On the way, they meet with with Brian, a ethnologist, and Susan. When they arrive at Matul Island, they find Dr. M β¦enard, and discover a terrifying disease which is turning the islanders into horrifying zombies which devour human flesh and seem indestructible.... (Read More)
Subgenre: | sadistic horrorsurvival horrorindependent filmcult filmsuspensecreature featurebody horrorzombie apocalypsezombie survivalitalian horrorzombie outbreak |
Themes: | murder of a police officersadismbrutalitymurderdeathfeardeath of fathersupernatural powercrueltydeath of wifeapocalypsecannibalismtrauma |
Mood: | goredarknessblood and gorezombie film |
Locations: | new york citycemeteryboat |
Characters: | nursedoctorhusband wife relationshipzombie |
Period: | 1970syear 1979 |
Story: | severed footscene of the crimeexploding headdisembowelmentstabbed in the headshot in the facegash in the facemutilationsevered armsevered headstabbed in the chestthroat slittingshot in the backheld at gunpointslow motion scene β¦shot in the headshotgunshot in the chestblood splattercorpseshootoutpistolsurprise endingfemale full frontal nudityfemale frontal nudityfemale nudityfightbloodgunviolencenumber in titlebare breastsfemale rear nuditynipplesexplosionchaseshowerfiredigit in titleshot to deathmirrorface slapcameragunfightthongbare buttdead bodyislandsciencemanhattan new york citycombatnew yorkmassacrestabbingdeath of friendfemale pubic hairpolice officer killedshot in the foreheadpaincursebeaten to deathscreamingperson on firescreamundeadspearvirusgrindhousesharknaked womanend of the worldback from the deadeaten aliveinvasionobesitycannibalmercilessnessgunshot wounddeath threathit on the headautopsyblood on shirteye gougingslaughterstabbed in the eyedark pastvoodoodeath of loved oneworld trade center manhattan new york cityintestinesliving deadmolotov cocktailhead woundhead blown offblood stainbullet ballethead bashed instatue of liberty new york citybitten in the neckcrushed headscuba divingcarnagebody bagextreme violenceflesh eating zombiegraphic violencemaggotcut into piecesbloody violencezombie violencepool of bloodpsychotronic filmbreaking through a doorgrindhouse filmshark attacknewspaper reporteroutbreakzombie attackexploitation filmhead ripped offmad doctortropical islandbitebitten in the throatexit woundbitingdoomsdaypolice officer knocked unconsciousbitten on the armflesh eatingitalian cinemadrive in classiceye injuryinfamygory violenceoxygen tankeast coastvideo nastyzombificationstab woundsequel by name onlyeating human fleshbitten in the facehell on earthflesh eating zombiesmutilated bodyresident evilzombie bitedeadly diseasenotorietybitten by a zombienude reflected in mirrorwrapped in a bedsheeteye woundzombie invasioneye skeweringhuman eaten by zombiesleg bitingswim capdiving mask (See All) |
The college friends Paul, Karen, Bert, Marcy and Jeff rent an isolated cabin in the woods to spend a week together. When they arrive, a man contaminated with a weird disease asks for help to them, but they get in panic and burn the man, who falls in the water reservoir and dies. The whole group, exc β¦ept Karen, makes a pact of drinking only beer along the week without knowing where the dead body is. When Karen drinks tap water and gets the disease, the group begins their journey to hell. (Read More)
Subgenre: | survival horrorindependent filmcult filmblack comedysuspenseb movieabsurdismpsychological thrillerbody horror |
Themes: | home invasionbrutalityrevengemurderdeathfriendshipdrinkingfeardrunkennessescapeparanoiaguiltinsanityillnessunrequited love β¦exploitationpanicpolice brutalityhuntingcamping (See All) |
Mood: | goreraincar chaseambiguous ending |
Locations: | hospitalforestbathtubbicyclewaterwoodsfarmlaketruckcavegas stationcampfirebackwoodsshed |
Characters: | self mutilationdoctorafrican americanpolicefather son relationshipboyfriend girlfriend relationshippolice officersheriffhomeless mankiller dog |
Period: | 2000s |
Story: | stabbed in the footsevered footsevered legdisembowelmentstabbed in the headreverse footagedismembermentsevered armlatex glovesshot in the legsevered headstabbed in the chestaxedecapitationshot in the back β¦revolverheld at gunpointvomitingslow motion sceneshot in the headshotgunshot in the chestcar accidentblood splattercorpsepistolsurprise endingknifephotographfemale frontal nuditybare chested malefemale nuditybloodviolenceflashbackmasturbationdogsex scenefemale rear nuditycigarette smokingfingeringpartychasepantiesshowerfirecell phonewoman on topbeatingshot to deathhorseurinationblondepunched in the facewritten by directorbikinibrawlbare buttriflebeerdead bodylow budget filmmarijuanahallucinationguitarf wordswimmingcleavagesurvivalfoot chasegay slurambushmassacreambulancedeath of friendimpalementstabbed to deathtied to a chairbrunettefalse accusationscantily clad femaleradiohit by a carshot in the foreheadracial slurskinny dippingbinocularsblack pantiesbeaten to deathstabbed in the backkaratescreamingperson on fireproduct placementstorytellingvacationknocked outbaseball batcollege studentscene during end creditsisolationpigpremarital sexthreatened with a knifedirectorial debutshot in the armobscene finger gesturevigilantecult directorcowcorrupt copblack americanpickup truckeavesdroppingfireplaceburned aliveshot in the stomachgroup of friendsdiseasevirushuntereccentriccovered in bloodgrindhousetorchanimal attackpeeping tomeaten alivesexual desirerednecktensionstealing a carunderage drinkingstabbed in the throatstabbed in the neckconvenience storerowboatescape attemptmedical examinationstabbed in the legscene after end creditspunched in the chestinfectionracistslaughterdeerdisfigurementranchcharacters killed one by oneflat tiresouthern accenttorso cut in halfwoman in bathtubhit with a baseball batdead dogmarijuana jointdirector cameopromiscuous womandrifterdead animalhomagehead blown offepidemiccanoemental retardationabandoned houseraftsquirreldouble barreled shotgunaccidental shootingdeputyhillbillybowling alleycabin in the woodsmercy killingoffscreen killingn wordfevercorrupt policeburnt bodymacabrequarantinehit with a shovelspitting bloodhit with a hammerdog attackimprovised weaponhermitanimal killingstupid victimcamera focus on female buttblond boyno survivorsbanjodecomposing bodybitten handposseskatergeneral storeleft for deadlemonadeclicheblood vomitingcampfire storymarshmallowporch swingkilled with a hammerreservoirinfectious diseasecontaminated waterstabbed in the eardead pigstabbed with a screwdrivertoasting marshmallowsrabbit suitreference to shirley templeburning bodyleg shavingball peen hammerhit with a guitarwild dogno cell phone signalbitten in the handdumb copgroup of fivebitten in the armstabbed with a stickhuman eaten by a dogflesh eating virusreference to smokey the bear (See All) |
Years after the Raccoon City disaster, Alice is on her own; aware that she has become a liability and could endanger those around her, she is struggling to survive and bring down the Umbrella Corporation led by the sinister Albert Wesker and head researcher Dr. Isaacs. Meanwhile, traveling through t β¦he Nevada Desert and the ruins of Las Vegas, Carlos Olivera, L.J., and new survivors K-Mart, Claire Redfield, and Nurse Betty must fight to survive extinction against hordes of zombies, killer crows and the most terrifying creatures created as a result of the deadly T-Virus that has killed millions. (Read More)
Subgenre: | survival horrorpost apocalypsezombie apocalypse |
Themes: | sadismbrutalityrevengeescapemonsterdeceptioncorruptioncannibalismself sacrifice |
Mood: | gore |
Locations: | deserttruck |
Characters: | zombiekiller dog |
Story: | returning character killed offsevered legstabbed in the headgash in the facedismembermentsevered armexploding bodyshot in the legthird partchild in perilsevered headstabbed in the chestthroat slittingdecapitationshot in the back β¦shot in the headshotgunshot in the chestblood splatterpistolknifefemale frontal nudityfemale nudityfightgunsequelbloodviolenceflashbackchaseshot to deathmachine gunfalling from heightshootinghand to hand combatsunglassesscientistflashlightdeath of friendimpalementradiohit by a carfemme fataleshot in the foreheadstabbed in the backkicked in the faceshot in the shoulderprofanityshot in the armlas vegas nevadahandgunsacrificeundeadbow and arrowkilling an animalmachetered dresstold in flashbackloss of loved onepart of trilogyaction heroinecrushed to deatheaten alivebased on video gameeye gougingdisfigurementknife throwingarrowwilhelm screamcloneswearingcrowdead dogsatelliteblood on camera lensbrainwashingkilling a doghit by a truckexploding truckbitten in the neckjointutahcut into piecesspitting bloodone woman armyfemale gunfighterknife in the chestmegacorporationcorporate crimeconvoybodily dismembermentbitten on the armsalt lake city utahhit by a busfirst person perspectivestabbed in the foreheadchased by a dogbitten in the faceblood on clothescorporate powerresident evilkilled by a dogclawed to deathdesolate cityprotective suitwoman leader (See All) |
Set way in the future, Earth is no longer inhabitable, so humans have colonized in outer space. One colony receives two cryogenically frozen bodies, and when they defrost them, one of the bodies turns out to be.....who else? Jason Voorhees. No longer in the forest or Camp Crystal Lake, Jason stalks β¦the colonists in a whole new environment. (Read More)
Subgenre: | independent filmmartial artsblack comedysuspensedark comedyb movieabsurdismfish out of waterteen horror |
Themes: | brutalitypsychopathdeathmurderfearescapemonstermilitarysupernatural powerparanoiaself sacrificeartificial intelligencespace travelclaustrophobia |
Mood: | goreslasherambiguous ending |
Locations: | woodslakeouter spacelaboratoryspace stationresearch stationship explosion |
Characters: | doctorteenagerboyfriend girlfriend relationshipteachersoldiertough guyvillainteacher student relationshipprofessorterrorengineerbabe scientist |
Period: | 2000s |
Story: | murder of a nude womanpower drillsevered legexploding headmutilationsurgerydismembermentsevered armexploding bodyevil manrace against timelatex glovesshot in the legsevered headstabbed in the chest β¦throat slittingdecapitationshot in the backheld at gunpointshot in the headshotgunshot in the chestblood splattercorpsepistolsurprise endingknifefemale frontal nuditybare chested malefemale nudityviolencefightsequelbloodflashbackcharacter name in titlenumber in titlesex scenekissnipplesexplosionchasefirebeatingshot to deathfistfightmachine gunface slaprescuepunched in the facecomputerfalling from heightmaskshowdownriflehand to hand combatnumbered sequelrobotkung fuscientistsurvivalflashlightambushstrangulationmassacreimpalementstabbed to deathmixed martial artsdisarming someonespaceshipunderwater scenecreaturetransformationflash forwardpilotstalkerbeaten to deathdangerstabbed in the backprologuekarateelectrocutionkicked in the facetough girlinjectionstalkingneck breakingthreatened with a knifemercenarylove interestkissing while having sexundeadsabotageelectronic music scoremass murderhypodermic needlemachetecowboy hatroman numeral in titlestabbed in the stomachspacecraftsergeantexploding buildingkicked in the stomachcovered in bloodvictimvirtual realityback from the deadandroidmasked manpresumed deadcyborgrampagenew jerseydual wieldobesityresurrectionspecial forcesjumping through a windowautopsywisecrack humorblood on shirthologramslaughterdisfigurementknife throwingfemale doctorcharacters killed one by onetank topmasked killergatling gunshot multiple timesgrenade launcherlaser guntorso cut in halftracking devicefemale soldierpsychopathic killermadmanface maskfemale fighterhuman monstersummer campslashingcameo appearanceknocked unconscioushead bashed incrash landingartifactsimulationoffscreen killingcrushed headmedical studentbody bagdeath of boyfrienddisembodied headstabbed in the shoulderextreme violencemicroscopewoman fights a manmasked villainroman numbered sequelman wearing glassesmorphinearm cut offfemale victimarmy basemass murdererstupid victimvillain not really dead clichescience runs amokarmoryspacesuitwoman in dangerx rayed skeletonregenerationearth viewed from spacecryogenicsdeoxyribonucleic acidsleeping bagsliced in twoface ripped offtenth parttrapped in spacehuman in outer spacenanotechnologyhockey maskshooting starsequel to cult filmbroken backjet packexplosive decompressionbackflipstabbed through the chestfighting in the airjason voorheessuspended animationliquid nitrogenrobot as pathosmutilated bodyspaceship crashfriday the thirteenthleg ripped offman murders a womanleg blown offmachete mutilationwarp speeddistress signalsports braspaceship settingfemale mercenaryfembotspear through chestwessex county new jerseycrystal lake new jerseykilled by machete25th centurybody enhancementbody scanaltering futureshuttlecraft (See All) |
A mid-western farm boy reluctantly becomes a member of the undead when a girl he meets turns out to be part of a band of southern vampires who roam the highways in stolen cars. Part of his initiation includes a bloody assault on a hick bar.
Subgenre: | independent filmcult filmcoming of ageblack comedysuspense |
Themes: | murder of a police officersadismpsychopathbetrayalkidnappingdeathmurderrevengefriendshipfeardrunkennessescapeinvestigationdeceptionsupernatural power β¦redemptioninsanityunrequited lovehomelessnessnear death experienceregret (See All) |
Mood: | goreneo noircar chasenightambiguous ending |
Locations: | barsmall townbuspolice stationfarmpolice cartruckmotelgas stationtexasroad moviebus stationshedcar fire |
Characters: | police shootoutsingle fatherpolicefamily relationshipsfather son relationshipfather daughter relationshipteenagertattoobrother sister relationshippolice officerhostagethiefvampirewaitresssheriff β¦truck drivershooting a police officer (See All) |
Period: | 1980s |
Story: | reverse footagegothicsingle parentexploding bodyrace against timelocker roomshot in the legchild in perilstabbed in the chestthroat slittingshot in the backrevolverheld at gunpointvomitingslow motion scene β¦shot in the headshotgunshot in the chestcar accidentblood splattercorpseshootoutpistolsurprise endingknifebare chested malefightviolencebloodgunf rateddogkisscigarette smokingexplosionchasefiretitle directed by femalebeatingshot to deathfistfightmachine gunhorseface slaprescuepunched in the facewatching tvgunfightbrawlshowdownriflebeersunglassesrunningcriminalf wordgood versus evilfoot chaseflashlightgangstrangulationmassacrestabbed to deathdinerexploding cardisarming someonehit by a cardouble crosspolice officer killedvanfemme fatalecigar smokingtransformationshot in the foreheadbartenderon the runattempted murderscreamingperson on firecowboypay phonefugitiveon the roadproduct placementmissing persondeath of childfarmermanipulationscaramerican flaghorse ridingneck breakingthreatened with a knifedirectorial debutcowarsonfreeze framepickup truckmachismoropecard gamebulletburned alivepokerelectronic music scoremass murdershot in the stomachsociopathscene during opening creditscowboy hatbarncountry musicphone boothstrangerhitchhikerhitchhikingbar fightfull moonthugredneckgypsystealing a carstarstabbed in the throathit in the crotchmercilessnesspool tablepunched in the stomachlove at first sightimmortalitypunched in the chestsunjumping through a windowoutlawblood on shirthealingdisfigurementknife throwingsiegepolice raidduct tapefemale directorburned to deathmoral dilemmaflat tiresouthern accentshot through a windowdriftermolotov cocktailveterinarianspit in the faceteenage lovehuman monsterpolice officer shot in the chestsuper strengthjukeboxquick drawstandofftrailer homedouble barreled shotgunburnt facehit by a truckdeputyexploding trucksawed off shotgunone linerwrist slittingbitten in the neckunderage smokingburnt bodykiller childstar crossed loversbadgecuremysterious womankansasrecreational vehiclevending machineshot through a doorgang leaderspray paintmass murdereroklahomainnocent person killednomadcamperchild swearingchild with a gunstabbed in the mouthlassoblood drinkingcowboy shirtmosquitobandaged handinvulnerabilityblood transfusionbalisongjumping from a carmobile homesunlightwhite horsefreight trainchild uses gunscarred facestar spangled bannerspit takestate troopercrisis of conscienceskull crushinginitiation riteamerican midwestdoomed lovebloodlustsee you in helloil wellcivil war veterantumbleweedwinnebagoblood suckingchild vampireface burntooth knocked outreflection in car mirrorconfederate soldierbutterfly knifecar showroomsleeping in a bathtubdriving through a wallsearch for sontinfoilbullet catchingslashed tiretrain trackrooster crowingspurhit with a flashlightslit wristjumping from a truckchild burningjesse jamesroaming (See All) |
Now that zombies have taken over the world, the living have built a walled-in city to keep the dead out. But all's not well where it's most safe, as a revolution plans to overthrow the city leadership, and the zombies are turning into more advanced creatures.
Subgenre: | sadistic horrorcult filmblack comedysuspensepost apocalypsecreature featurezombie apocalypseamerican horrorzombie outbreakfrench horrorcanadian horror |
Themes: | sadismbrutalitymurderdeathsuicidefearracismgreedapocalypsecannibalism |
Mood: | goredarknessblood and goresequel to cult horror |
Locations: | urban settingcitytruckgas station |
Characters: | african americanprostitutezombievillain |
Period: | 1990syear 1995 |
Story: | severed footshot in the throatgun in mouthsequel to cult favoritesevered legexploding headdisembowelmentgash in the facedismembermentexploding bodyshot in the legsevered headdecapitationshot in the headshot in the chest β¦car accidentblood splattercorpseshootoutpistolfemale nudityviolencesequelbloodexplosionlesbian kissshot to deathmachine gunrescuearrestshootingdead bodyjailriverdeath of friendexploding cardouble crossshot in the foreheadracial slurlimousineperson on fireelectrocutionkicked in the faceshot in the shoulderratmercenaryshot in the armcult directorundeadblood spatterarsonsplatterdisasterhead buttmachetevirusfourth partassaultsevered handskateboardrocket launcherend of the worldback from the deadeaten alivesevered fingerfight to the deathshopping mallbutcherracistsiegeethnic slurtorso cut in halfmexican americanbad guybeheadingliving deadkillskyscraperslashingfortressshot in the eyemeat cleaverburnt bodyshot through the mouthextreme violenceflesh eating zombiegraphic violencewalking deadbloody violenceburn victimshot in the crotchbutcheryevil clownbody partoutbreakzombie attackpittsburgh pennsylvaniastairwellbitten in the throatliquor storehung upside downdoomsdayauto theftsliced in twofireworklawnmowerbitten handbodily dismembermentflesh eatingdisturbingevil deadanthropophagusgory violencespear guneast coastzombificationgruesomehell on earthman eaterbody partsblown to piecesdrawbridgezombie biteabandoned citydeadly diseasebrutalmonster as victimhole through torsopiercing ripped outthrowbackzombie with gunzombie invasionzombie clown (See All) |
Picking up immediately after the events in Resident Evil: Retribution, Alice (Milla Jovovich) is the only survivor of what was meant to be humanity's final stand against the undead. Now, she must return to where the nightmare began - The Hive in Raccoon City, where the Umbrella Corporation is gather β¦ing its forces for a final strike against the only remaining survivors of the apocalypse. (Read More)
Subgenre: | survival horrormartial artsconspiracypost apocalypsedystopiacyberpunkzombie apocalypsepost apocalypticcorporate conspiracy |
Themes: | brutalitybetrayalkidnappingdeathmurderrevengefearescapemonsterdeceptionangerparanoiaredemptioninsanityillness β¦surveillancehopepanicself sacrificeartificial intelligence (See All) |
Mood: | gore |
Locations: | motorcyclewheelchairrooftoplaboratorytunnelsewerhumveecable car |
Characters: | doctorfather daughter relationshipboyfriend girlfriend relationshipfemale protagonistzombiesoldierhostagesecurity guardbibleprofessorengineer |
Period: | zip lineseeing the future |
Story: | booby trapstabbed in the footsevered footreturning character killed offsevered legshot in the facesevered armexploding bodyevil manrace against timelocker roomshot in the legsevered headstabbed in the chestthroat slitting β¦decapitationshot in the backbombheld at gunpointslow motion sceneshot in the headshot in the chestcar accidentblood splattercorpseshootoutpistolsurprise endingknifebloodfightflashbacksequelviolencedogexplosionchasefirevoice over narrationbeatingshot to deathfistfightmachine gunrescuepunched in the facewritten by directorbattleswordgunfightbrawlfalling from heightshowdownhand to hand combatsunglassesrunningcar crashinterrogationcombatkung fuscientistsubjective cameragood versus evilsurvivalflashlightambushstrangulationmassacrearmyimpalementstabbed to deathmixed martial artsexploding carno opening creditsdisarming someonefictional wardouble crossunderwater scenecreaturevoice overnecklaceshot in the foreheadone against manybinocularsbeaten to deathdangerstabbed in the backprologuefired from the jobperson on fireelectrocutioncharacter's point of view camera shotmissionactor playing multiple rolescover upknocked outkicked in the facetough girltankopening action sceneshot in the shoulderscarthreatened with a knifemercenarywaterfallshot in the armobscene finger gestureundeadbattlefieldwashington d.c.stylized violencehenchmanak 47missileropetraitoruzihand grenadesabotagefireplacedestructionburned aliverevelationhead buttelectronic music scoreheroinehypodermic needlemachetesociopathdiseasevirussecurity camerawalkie talkiecrucifixmad scientistkicked in the stomachwristwatchdesperationjumping from heightsevered handstrong female leadlasergenociderocket launchertorchend of the worldaction heroineanimal attackmexican standoffwhite housegun fusocial commentaryeaten alivefemale warriorcyborgmechanicstealing a carsevered fingerfight to the deathresistancedual wieldstabbed in the throathatredbased on video gamehit in the crotchmercilessnesspower outagechaosbroken glassevacuationcigarette lighterstabbed in the legpunched in the chestairplane crashinfectionaerial shothologrambody landing on a carknife throwingraised middle fingergasolinestabbed in the eyeburned to deathsirenclonegatling gunfast motion scenebullet timerockettorso cut in halfenglishman abroadsatellitedesert eaglefemale soldierabandoned buildingbarbed wireliving deadfinal showdownfemale fighterarmored carsuper strengthgiant monsterworld dominationmegalomaniacyoung version of characterbunkerinformantstabbed in the armcommanderflarehanging upside downhelicopter crashsawed off shotgungenetic engineeringfemale herobitten in the neckwoman kills a manfight the systemfinal battleshot through the mouthsole black character dies clicheshot in the footcountdownopen endedcurejumping into watersixth partwoman fights a mandistrustsubterraneancloningcut into piecesone woman armyresistance fighterspray paintchainsanimal killinganti heroinearmoryhummerfirecrackersurveillance footageevil corporationoutbreakmad doctorlandminelast standslow motion action scenechild with a gundeoxyribonucleic acidmegacorporationantidotecorporate crimedetonatornail gunchild soldierbarricadereference to noah's arkflash drivegiant creaturepandemicsuper computerbusiness partnerlast of seriescubespikehockey stickcontact lensimplantsecret laboratorycraterbackflipice picknight vision binocularshanged bodykilled by a propellersiren the alarmhorderesident evilabandoned citylaser cutterfemale mechanicreference to genesishivewinged creaturecomputer controlraccoon cityunderground complexfemale engineer (See All) |
Driving through the backwoods of Texas, five youths pick up a traumatized hitchhiker, who shoots herself in their van. Shaken by the suicide, the group seeks help from the locals, but their situation becomes even more surreal when they knock on the door of a remote homestead. It's quickly apparent t β¦he residents are a family of inbred psychopaths, and the unlucky youths suddenly find themselves running for their lives. In hot pursuit is a disfigured, chainsaw-wielding cannibal known as Leatherface. (Read More)
Subgenre: | sadistic horrorindependent film |
Themes: | sadismbrutalitypsychopathtorturekidnappingmurderdeathsuicideinsanitypolice brutality |
Mood: | goreslasherhorror movie remake |
Locations: | barbathtubwheelchairpolice carroad tripgas station |
Characters: | serial killerpolicemother son relationshipboyfriend girlfriend relationshippolice officercrying babyevil sheriff |
Period: | 1970s |
Story: | severed footslaughterhouselifting someone into the airmutilationchainsawdismembermentsevered armevil manlocker roomsevered headaxeshot in the headblood splattersurprise endingknife β¦violencebloodvoice over narrationremakeinterrogationpianotelephoneimpalementno opening creditshit by a carpolice officer killedpigbasementchickendirectorial debutobscene finger gesturecowmoonmaniacfalling down stairspot smokingnipples visible through clothingheavy raingroup of friendscowboy hathomicidefull moonsevered fingerthrown through a windowdisfigurementbody countalienationtank topmasked killernewspaper clippingbarbed wirecar troublecrucifixionhuman monstersexual perversionterritory name in titletrailer homehillbillymercy killingwhite trashmeat cleaversewing machineshot through the mouthwet t shirtmasked villainsole survivorsaltstupid victimtruckersevered eargas station attendantclothes linesmall town sheriffbodily dismembermentobese womanpinatasevered faceforensic evidenceanthropophagusone armed manremake of cult filmbody in trunkvolkswagen buslock pickmeat hookchainsaw murderteeth knocked outhole in the wallhung from a hookrotten teethleatherfacebased on ed geinsevered nosechewing tobaccogroup of fiveharbinger of deathabandoned millmeat processing factoryobject made of body partobject made of human skintool in title (See All) |
Detective Matt Gibson chases the psychotic Detective Mark Hoffman while Jigsaw's widow Jill Tuck tries to kill him as assigned by her husband. However he escapes and Jill meets Gibson and offers to sign an affidavit listing the murders committed by Hoffman. In return, she requests protection. Meanwh β¦ile, the prominent Jigsaw survivor and leader of a support group Bobby Dagen is abducted with his wife and friends and forced to play a mortal game to save himself and his beloved wife. (Read More)
Themes: | torturekidnappingrevengedeathfeardeceptiondeath of wifepolice brutalitypolice investigationpolice corruptionrevenge murder |
Mood: | gore |
Locations: | barpolice station |
Characters: | self mutilationpolice detectivedoctorhusband wife relationshipboyfriend girlfriend relationshippolice officerlawyerlove triangleinterracial relationshipcoroner |
Period: | 2010s |
Story: | booby trapgame of deathpig maskevil dollsevered footreturning character killed offdisembowelmentgash in the faceswat teamvideotapesevered armshot in the backbombheld at gunpointslow motion scene β¦shotgunshot in the chestblood splattercorpsepistolsurprise endingknifebare chested malebloodviolenceflashbacksequelnumber in titleinterviewexplosioncell phonedigit in titleshot to deathmachine gunfalling from heightmasknumbered sequelcleavageimpalementstabbed to deathtied to a chairdream sequencehit by a carpolice officer killednews reportconfessiondrug addictcharacter repeating someone else's dialoguekeyelectrocutiondollknocked outmanipulationneck breakingcharacter says i love youcorrupt copburned alivemass murdercagesurvivorkicked in the stomachfraudcovered in bloodcrushed to deathredneckwoman in jeopardystabbed in the throat3 dimensionalstabbed in the neckjunkiepolice officer shotthrown through a windowblood on shirte mailracisteye gougingstabbed in the eyecanebody countcharacters killed one by oneburned to deathlyingtorso cut in halfshot through a windowintestinesjunkyardblindfoldedpolice officer shot in the chestskinheadx raygroup therapyfemale lawyershot in the eyeheld captivemale protagonistsawaudio cassettebody baghanged manextreme violencefemale police officercut into piecessupport grouptape3d in titlemass murderergrindhouse filmpolice officer shot in the headwoman's neck brokensoundseventh partpolicewoman killingarm ripped offtrail of blooddeath by hangingbear trapstabbed in the mouthbook signinghidden roomlawnmower3 dstabbed in the sidetricyclewriting on a wallprosthetic limbcircular sawsafe houseinternal affairslast of seriesthrown through a windshieldabsurd violencewhite supremacisthorror iconprosthetic legpublicistpublic executioncaught in a lieelectric fencepolice officer stabbedrotting corpsetooth pullingskin rippingkilled by a propellerbolt upright after nightmare8 trackboyfriend girlfriend conflicteye surgeryhung from a hookjaw ripped offman murders a womantooth extractionbulletproof glassprosthetic armhead crushing3d sequel to 2d filmwriting on mirrortape deckpolice officer neck brokenwriting on a mirroreyes sewn shutlocked in a bathroomskin torn offbuzzsawcauterizationleft to diewoman leading a man onsupergluemale antagonistpolice internal affairsself help gurufish hookkilled with a lawnmowerexposing fraudreference to the fbiexploding warehousestitching one's own woundloose endsplexiglastight blouse (See All) |
A band straying into a secluded part of the Pacific Northwest stumbles onto a horrific act of violence. Because they are the only witnesses, they become the targets of a terrifying gang of skinheads who want to make sure all the evidence is eliminated.
Subgenre: | survival horrorindependent filmsuspensepunk |
Themes: | brutalitybetrayalkidnappingmurderrevengedeathfriendshipfearescapedeceptionracismtheftparanoiapanicnear death experience |
Mood: | gore |
Locations: | barrestaurantforestbicyclewoodsrural settingpolice carcampfire |
Characters: | policeboyfriend girlfriend relationshiptattoosingerpolicemanhostagetough guywarriorjewishreference to godcousin cousin relationshipgermanblonde girlkiller dog |
Period: | 2010s |
Story: | shot in the neckbroken armdisembowelmentstabbed in the headshot in the facemutilationwitnessrace against timeshot in the legstabbed in the chestthroat slittingshot in the backrevolverheld at gunpointslow motion scene β¦shot in the headshotgunshot in the chestblood splattercorpseshootoutpistolsurprise endingknifephotographfightviolencebloodinterviewdogtwo word titlecigarette smokingcell phoneshot to deathwritten by directorgunfightbrawlshowdownbeercollegecolor in titlef wordsurvivalgay slurflashlightbandambushconcertstrangulationdeath of frienddrug dealermontagestabbed to deathdinerman with glassesno opening creditsdisarming someonedrawingvanshot in the foreheadbartenderracial slurattempted murdermicrophonedangerstabbed in the backcover uptough girlbaseball batinjectionisolationpolicewomanstagedie hard scenariothreatened with a knifeheroinrecord playerhenchmantraitorrevelationhypodermic needlemachetetape recordersociopathguitariststabbed in the stomachdesperationcrying mananimal attackeaten alivefemale warriorthugpromisecrime scenepump action shotguntensionstealing a cartrappedface paintcouchstabbed in the throatmercilessnesspower outagestabbed in the neckevacuationdrummerescape attemptcigarette lighterframe upaerial shotone daycellphonegasolinedressing roomduct tapecharacters killed one by oneethnic slurposterdrumsfire extinguisherstabbed in the handswastikagateremorseblackoutskinheadstandoffdisposing of a dead bodybunkertrailer homestabbed in the armneo naziself defensetape recordingcornfieldshot in the eyeelectric guitarman kills a womann wordwoman kills a manbleeding to deathmurder witnesssleeping in a caroregonbouncerfart jokemusic gigpool of bloodimprovised weapongang leaderanimal killingportland oregonclimbing out a windowreference to madonnavinylthroat rippingpunk musiccut armpacific northwestheld hostagegreen hairmohawk haircutradio hostreference to britney spearsconfederate flagshot in the kneewhite supremacistbar ownerstabbed in the foreheadbassistpep talk911 calldragging a dead bodymulletcleaverpitbullpunk bandbass guitarhuman shieldchoke holdbitten in the facebox cuttermeth labescalationmaulingrock clubbitten on the legkilled by a dogskating rinkreference to princereference to iggy popdrug labgas siphoningreference to simon and garfunkelreference to black sabbathbattle cryreference to ozzie osbournefalling asleep at the wheelgreen roomreference to odinreference to slayer (See All) |
Special Agent Strahm is dead, and Detective Hoffman has emerged as the unchallenged successor to Jigsaw's legacy. However, when the FBI draws closer to Hoffman, he is forced to set a game into motion, and Jigsaw's grand scheme is finally understood.
Subgenre: | survival horror |
Themes: | sadismtorturekidnappingmurderrevengedeception |
Mood: | goredarkness |
Locations: | office politics |
Characters: | self mutilationsecurity guardsecretary |
Story: | booby trapgame of deathfamous themepig maskevil dollmind gamescalpelacidreturning character killed offgothdisembowelmentsevered armtrappistolsurprise ending β¦flashbackviolencesequelnumber in titlenumbered sequeltoiletkeypoisonsacrificebullettape recorderroman numeral in titlepuzzlecrushed to deathback from the deadpresumed deadburned to deathintestinesbroken mirrorfemale lawyerwetting pantsaudio cassettelighting a cigarettecountdownsixth partcarouselchoicepool of bloodevil corporationbear trapsafe deposit boxpadlockaudio tapefingerprintshealth caresequel to cult filmjigsawkicked in the ballsinsurance companycleaverhara kiridistorted voicehealth insurancepower cuthack sawfingerprintinginsurance salesmanone way mirrortape playerholding one's breathpower sawsequel to cult movieacid bathsafe deposit box keyactuaryflash photographysteam pipeshackle (See All) |
A new film is currently in production, and a killer is on the loose. The murders draw a reporter, ex-cop, and young woman to the set of the movie inspired by their life. They soon find out that they are dealing with a trilogy, and in a trilogy...anything can happen.
Subgenre: | independent filmmartial artsblack comedypost modernhorror spoof |
Themes: | home invasionbrutalitybetrayalkidnappingrevengedeathmurderjealousyfeardrunkennessescapefilmmakinginvestigationdeceptionvoyeurism β¦theftparanoiacelebritycourage (See All) |
Mood: | goresatirenightmareslasher |
Locations: | barswimming poolhelicopterlos angeles californiaapartmentpolice stationpolice car |
Characters: | police detectivedetectiveserial killerpolicefather daughter relationshipboyfriend girlfriend relationshipbrother sister relationshipfemale protagonistpolice officeractorhostageactresssecurity guardfilm directorex boyfriend ex girlfriend relationship β¦death of girlfriendself referentialpregnant from rape (See All) |
Period: | 1990s2000s |
Story: | booby trapcriminal mastermindreturning character killed offsequel to cult favoritevideotapeexploding bodyrace against timeshot in the legthird partstabbed in the chestthroat slittingshot in the backrevolverheld at gunpointshot in the head β¦shot in the chestcar accidentblood splattercorpsepistolsurprise endingknifephotographbare chested malesequelviolencebloodfightf ratednumber in titledogcigarette smokingpartychaseshowercell phonebeatingdigit in titleshot to deathfistfightrescuepunched in the facewatching tvbrawlsecretfalling from heightmaskshowdownsunglassesbirthdaycar crashhallucinationhandcuffsvoyeurf wordreportersurvivalfoot chaseflashlightjournalistbound and gaggedambushstrangulationambulancemansionstabbed to deathtoilettied to a chairfalse accusationno opening creditsdisarming someonecoffindouble crossbirthday partynews reportmarriage proposalshot in the foreheadracial slurstalkercharacter repeating someone else's dialoguebeaten to deathstabbed in the backcostumescreamingcover upknocked outkicked in the facetough girlbaseball batscreamprankshot in the shoulderbodyguardstalkingfilm within a filmisolationbasementpremarital sexsuspicionthreatened with a knifeactingobscene finger gesturecult directorstrong female charactereavesdroppinganswering machinefalling down stairsentertainmentsabotagerevelationhead buttsociopathsurvivorred dressstabbed in the stomachhollywood californiakicked in the stomachwristwatchjumping from heightrape victimfaked deathstrong female leadmexican standoffmasked manpresumed deadfemale warriorduct tape over mouthmovie theatrebarefootcrime scenecameobraverymobile phonestabbed in the throatpartnermercilessnessmovie setfalling to deathframe upstabbed in the legsibling rivalrypunched in the chestfilm setaerial shotblood on shirtfilm producerwedding ringbulletproof vestbalconyknife throwingraised middle fingerfemale reportercharacters killed one by onekilling spreemasked killernewspaper clippinglingerie slipmedia coveragehit with a baseball batnews reporterdirector cameoex coppromiscuous womantaserhiding in a closetlecturegolf clublighterquick drawtrailer homepopcornstabbed in the armwhodunithearing voicesbody in a trunkman kills a womanhollywood signmovie studiowoman kills a manstabbed in the shouldergassole black character dies clichemetal detectorcamcorderexploding housereference to star warsscriptpsychological tortureimprovised weaponfamous linehalf brotherman hits a womanstupid victimvillain not really dead clichewrongful arrestanti heroinebreaking a bottle over someone's headgas explosionguillotinesecret roomfratricidebullet proof vestred herringfemale journalistsittinghidden gunwomen's bathroomtalk show hostmystery killerhit with a chairsecret doorwoman punches a manhidden roomfalse nameman fights a womansecret passagewayfax machinehidden doorcounselorman punches a womanfilm reelvhs tapesequel to cult filmcounsellorfake bloodhit with a frying panthrown from heightcar phoneseclusionhit with a golf clubfalling down a hillthreatening telephone callfaking own deaththrown through a glass doorfaxphone terrortelephone terrorcopycattrailer narrated by don lafontainemovie scriptrekindled romancemetafictionthrown off a balconyvoice changerdriving in the wrong directionkilled on birthdaylock pickingcopycat killerpicking lockhall of recordscounterpartreference to lois lanereference to hannibal lecter (See All) |
Fifteen years after a horrifying experience of abduction and prolonged torture, Lucie embarks on a bloody quest for revenge against her oppressors. Along with her childhood friend, Anna, who also suffered abuse, she quickly descends, without hope, into madness and her own delusions. Anna, left on he β¦r own begins to re-experience what Lucie did when she was only twelve years old. (Read More)
Subgenre: | sadistic horrorfrench horror |
Themes: | sadismbrutalitytorturedeathrevengemurdersuicidefearescapeangersupernatural powerinsanitycrueltyafterlifemurder of family β¦starvationlesbian love (See All) |
Mood: | gorenightmarebleakness |
Characters: | self mutilationhusband wife relationshipmother daughter relationshipbrother sister relationshipgirlyounger version of charactersuicide by gunshot |
Period: | year 1971 |
Story: | murder of a nude womangun in mouthmutilationwitnessevil manchild in perilthroat slittingshot in the backvomitingshot in the headshotgunshot in the chestblood splattercorpsesurprise ending β¦photographbare chested malefemale nudityviolencebloodf ratedone word titlefemale rear nuditytitle spoken by characterlesbian kissshowercryingbeatingshot to deathurinationface slappunched in the facedead bodybathroomhallucinationhandcuffsprisonertied to a chairchild abusecultpaingravebeaten to deathmurdererhatewoundcaptivehammerphone boothgrindhousevictimladderorphanagepresumed deadhaunted by the pastsufferingpunched in the stomachplot twistdead boychloroformatheistbrainwashingmysticismtestimonysuccessfriendship between womendisposing of a dead bodyhead bashed inecstasywrist slittingheld captivemercedes benzshot through the mouthevil womanchainedextreme violencegraphic violencemartyrmurderesshit with a hammertrapdoorfemale victimdragging a bodynew ageviolent deatheyesstraight razorcaptivitybloody body of a childshacklestorture chamberlife after deathemaciationexposed breastfanaticismhandcuffed womanincarcerationskinned aliveperversitysingle locationsuperficialitytranscendencemartyrdomforce feedinghell on earthwoman as objectobjectificationabuse against womenfrench shock cinemapretensionsurvivor guiltnail in the headpseudo intellectualshroudvindicationhandcuffed behind backsecret entrancequest for knowledgelong sufferingsmashing through a windowhidden staircasehistorical referencefalling through a glass doorunderground complex (See All) |
After an experimental bio-nerve gas is accidentally released at a remote U.S. military base in Texas, those exposed to the gas turn into flesh-eating, mutating zombies out to kill. An assortment of various people who include stripper Cherry, her shady mechanic ex-boyfriend Wray, a strong-willed doct β¦or, the local sheriff, and an assortment of various people must join forces to survive the night as the so-called "sickos" threaten to take over the whole town and the world. (Read More)
Subgenre: | survival horrorcult filmblack comedyb moviecreature featurezombie apocalypsezombie survival |
Themes: | murder of a police officerpsychopathextramarital affairinfidelitydeathmurderfriendshipadulterypregnancyfearmilitaryparanoiacancerunfaithfulnesscannibalism |
Mood: | goreone night |
Locations: | hospitalbeachcarhelicoptermotorcycleelevatormexicogas stationtexastwo on a motorcycle |
Characters: | doctorhusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipboyfriend girlfriend relationshiptattoobrother brother relationshipfemale protagonistzombiesoldierpolice officertough guyaction herosheriff β¦ex boyfriend ex girlfriend relationshipstand up comedianlesbian relationshipgo go dancerevil doctor (See All) |
Period: | 2000s |
Story: | shot in the necksevered legexploding headshot in the facedismembermentshot in the legchild in perilsevered headstabbed in the chestthroat slittingaxedecapitationshot in the backheld at gunpointshot in the head β¦shotgunshot in the chestcar accidentblood splattercorpseshootoutpistolbare chested malefemale nudityviolencebloodsexdogtwo word titleexplosionfirecryingcell phonehigh heelsshot to deathtesticlesmachine gunmirrorarrestsecretfalling from heighttearsdead bodyhandcuffsstripperscientistsurvivalflashlightstabbed to deathdinerexploding carman with glassesanti herohit by a cartonguetransformationshot in the foreheadstabbed in the backperson on firedeath of childtough girlringattempted rapeglassespremarital sextwincheating wifehypodermic needlebabysittermad scientistmorguehammerspiderend of the worldrapistaction heroinebreakfasteaten alivegas maskcameosevered fingercouchunfaithful wifestabbed in the neckshovelscene after end creditsthrown through a windowassault rifleinfectionturtlestabbed in the eyebarbecuefemale doctorcastrationmutationdeath of loved oneabusive husbandgrenade launchersurprise after end creditssouthern accentleather jacketenglishman abroadbisexual womanblood on camera lensneedlehomagekilling a doghead blown offexotic dancermeatsubtitlesamputeeold flameknocking on a doorsicknessaccidental shootingjackethit by a truckexploding truckscorpionmilitary baseone linersawgarbagedirector also cinematographerflesh eating zombiewalking deadtoxic wastecut into pieceszombie violencedeformitypole dancertext messageshot in the crotchpole dancingexploitation filmmad doctorwhite coatbloody body of a childtrail of bloodchild with a guncontaminationdoomsdayhot pantsprosthetic limbreference to osama bin ladenmusic score composed by directoranthropophagusover the topdeus ex machinabiohazardcheating on husbandwaterbedmilitary veteranchild uses a gunchild shot in the headwooden legkilled by a propellerchemical weaponskicking someonechemical weapondeadly diseaseripped in halfaccidental suicidehair curlersrunning mascarabroken wristintentional goofmelting mananesthesiologistspanish languagetwin girlsdeath of an animalpainting nailspusgrabbed by the hair (See All) |
Light Turner, a bright student, stumbles across a mystical notebook that has the power to kill any person whose name he writes in it. Light decides to launch a secret crusade to rid the streets of criminals. Soon, the student-turned-vigilante finds himself pursued by a famous detective known only by β¦ the alias L. (Read More)
Subgenre: | independent filmblack comedyconspiracy theoryteen horrorsupernatural horror |
Themes: | betrayalkidnappingdeathrevengemurdersurrealismsuicidesupernatural powerbullyingpolice investigationnear death experience |
Mood: | goreanimehigh schoolcar chasepoetic justice |
Locations: | hospitalrestaurantpolice stationpolice carfire truck |
Characters: | self mutilationpolice detectivesingle fatherdetectiveafrican americanpolicefather son relationshipboyfriend girlfriend relationshiptattooteenage girlteenage boypolice officer |
Story: | playing godexploding headswat teamcaucasiansingle parentexploding bodyrace against timesevered headheld at gunpointslow motion scenecar accidentblood splatterpistolsurprise endingphotograph β¦bare chested maleviolencefightbloodguntwo word titlekisstitle spoken by characterexplosionchasefirecell phonemachine gunpunched in the facefalling from heightcar crashf wordsubjective camerafoot chaseanti herodisarming someonehit by a carunderwater scenefemme fatalenews reportlimousinehotel roombased on tv seriesfbibased on mangamini skirtproduct placementamerican flagcharacter says i love youobscene finger gesturelove interestnewspaper headlinesubtitled sceneheart attackfalling down stairshand grenadeelectronic music scoreheavy rainice creamfbi agentexploding buildingpress conferencejumping from heightladdermind controlparking garagefollowing someonecameotokyo japanstealing a carconstruction sitestabbed in the throatpower outageplot twistundercover agentbulletproof vestcellphoneraised middle fingersecret identitynewspaper clippingmoral dilemmaprivate investigatorseattle washingtonmedia coveragetext messagingblood on camera lensvillain played by lead actormysterious manbloopers during creditsnotebookpistol whipold dark houseteenage lovespiral staircasebully comeuppancepocket watchvigilante justiceferris wheeloffscreen killingbased on animefilmed killingrepeated linerighteous ragechild molesterlive actionprivate jetpsychotronic filmabsent motherhostage situationadaptationdutch anglesurprise during end creditsskypecheerleadinghigh school footballgym classteenage angstsex offenderhidden identitynew york statemass deathmass suicideevil laughterevil godstolen police carwoman murders a manstabbed with a forkwaking up from a comadeath in titleblack lives matterfemale sociopathprom nightvow of silenceseattle space needlechased by policejumping to deathopening creditscomputer roomlive action remake of animeshinigamiten years (See All) |
A vigilante homeless man pulls into a new city and finds himself trapped in urban chaos, a city where crime rules and where the city's crime boss reigns. Seeing an urban landscape filled with armed robbers, corrupt cops, abused prostitutes and even a pedophile Santa, the Hobo goes about bringing jus β¦tice to the city the best way he knows how - with a 20-gauge shotgun. Mayhem ensues when he tries to make things better for the future generation. Street justice will indeed prevail. (Read More)
Subgenre: | cult filmblack comedyb movieabsurdismpunk |
Themes: | murder of a police officersadismbrutalitytorturekidnappingrevengemurderdrugsrobberyhomelessnesspolice corruption |
Mood: | gore |
Locations: | hospitaltrainpolice stationschool bus |
Characters: | father son relationshipbrother brother relationshipprostitutebabypimpshooting a police officerbaby killer |
Story: | severed footgun in mouthbroken armexploding headdisembowelmentshot in the facegash in the facemutilationdismembermentchild in perilsevered headstabbed in the chestaxedecapitationshot in the back β¦shot in the headshotgunshot in the chestblood splattercorpsepistolfemale nuditybloodviolencecharacter name in titlebare breastsmasturbationcigarette smokingtitle spoken by charactertelephone callarcade gameshot to deathfistfightpunched in the facedead bodyprostitutionalcoholfoot chasenewspapergangmassacrevideo cameraimpalementcocaineone man armynews reportshot in the foreheadbinocularscharacter repeating someone else's dialoguestabbed in the backelectrocutionknocked outkicked in the facedeath of childattempted rapedeath of brotherfishnet stockingsdeath of sonvigilantenewspaper headlinecorrupt copchild murderak 47burned alivemacheteshot in the stomachscene during opening creditsspin offphone boothsevered handcovered in bloodgrindhouseblack humorgenociderapistcrushed to deathmasked manduct tape over mouthrampagepump action shotgunswitchbladesevered fingerstabbed in the neckpunched in the stomachpedophilecanecastrationlens flareflamethrowershot multiple timeshit with a baseball batblood on camera lensintestinesvideo tapebarbed wiremolotov cocktailhead blown offpolice chiefarcadehanging upside downhead bashed insawed off shotguntentaclestreet fightbased on short filmbumcrushed headski maskhanged manpawnshophomeless personwoman in a bikinifilmingdumpsterdeath of title characterspitting bloodhoboimprovised weaponshot in the crotchshopping cartimmolationbreaking a bottle over someone's headman with no namerecyclingfratricidecrime lordangry mobdrinking from a bottlecowardiceboom boxhung upside downsuit of armorflame throwerlawn mowertoastersanta claus suitlawnmowerchild killerwearing sunglasses insidewoman smoking cigarettebody armorfilicidered lighthanged womanmotorcycle ridingvhs tapebumper carhanged by the neckdeath of unclereference to mother teresacandollar billpawn shopelectrocutedfacial cutwhite suithospitalityice skatesmass child killinghack sawattempted kidnappingwearing sunglasses at nightstreet prostitutionfoiled robberypulling haircutting torchsuspended by armsmanhole coverneo 80sweapon in titleemergency surgeryhead crushedstilletoeating glasswelding maskbreaking an armbricklinrobber wearing a ski maskfire in a 55 gallon drumriding a freight train (See All) |
In a world ravaged by a virus infection, turning its victims into the Undead, Alice (Jovovich), continues on her journey to find survivors and lead them to safety. Her deadly battle with the Umbrella Corporation reaches new heights, but Alice gets some unexpected help from an old friend. A new lead β¦that promises a safe haven from the Undead takes them to Los Angeles, but when they arrive the city is overrun by thousands of Undead - and Alice and her comrades are about to step into a deadly trap. (Read More)
Subgenre: | survival horrormartial artspost apocalypsedystopiacyberpunkzombie apocalypsezombie survival |
Themes: | brutalitybetrayalkidnappingrevengemurderdeathprisonescapemonsterdeceptioncelebritysurveillanceamnesia |
Mood: | gorerainpoetic justice |
Locations: | beachhelicoptersnowairplanelos angeles californiaboatwaterelevatorjapanpolice carshiprooftoptunnelseweralaska β¦airplane accident (See All) |
Characters: | tattoobrother sister relationshipfemale protagonistzombiesoldierhostagewarriorjapanesesniperasian americansniper rifleself destructivenessself healing |
Story: | timebombexploding headshot in the facegash in the faceexploding bodytrapevil manshot in the legchild in perilsevered headstabbed in the chestaxedecapitationshot in the backrevolver β¦bombheld at gunpointslow motion sceneshot in the headshotgunshot in the chestblood splattershootoutpistolsurprise endingknifesequelflashbackgunviolencebloodfightdogexplosionchasethree word titleshowervoice over narrationpunctuation in titleshot to deathmachine gunrescuepunched in the faceswordbrawlfalling from heightsunglassesbathroomcombatf wordswimminggood versus evilsurvivalflashlightassassincaliforniamassacremountaindeath of friendarmyimpalementcolon in titleprisoneranti heropart of seriesfictional warunderwater scenecreaturetransformationshot in the foreheadbinocularsstabbed in the backumbrellakicked in the facetough girltankscene during end creditsshot in the shoulderamerican flaginjectiontied upunderwatermercenaryshot in the armsubtitled sceneundeadhenchmanropeuzigrenadekilling an animalrevelationassassination attemptsociopathsurvivorviruscooksecurity camerajail cellexploding buildingkicked in the stomachfourth partgiantjumping from heightfaked deathmind controltorchaction heroineanimal attackgun fusocial commentarygun battleeaten alivefemale warriorcamera shot of feettokyo japanfloodexplosivebased on video gamemercilessness3 dimensionalchaosblack and white scenespecial forces3daerial shotfoghologramknife throwingsiegecorporationmutationsirencloneexploding helicopterbullet timecrowtorso cut in halfsatellitestabbed in the handhead blown offmovie producersuper strengthnight visionselfishnessplane crashsuper powersraftbillboarddouble barreled shotgunbullet balletflarecameo appearancecrash landinggun actionsawed off shotgunfemale herocrashing through a windowgun duelhollywood signbitten in the neckswimming underwatersubmachine gunshot through the mouthcamcorderaspiring actressopen endedairfieldoverhead camera shotholesubterraneanfrenchmanglacierone woman armyflare gunfemale gunfighterexploding airplaneelevator shaftanti heroineglowing eyesarmoryhummerzombie attackreturning character with different actorexit woundloss of memoryjumping out a windowmegacorporationvideo diarybattle axesurprise during end creditssuper speedinvulnerabilitythrowing starhuman experimentationshurikenham radioocean linerbiohazardred eyesbackflipchild uses a gunnight vision binocularselectro magnetic pulsegenetic mutationknife in the headbungee jumpkilled by a propellerdestroyed citystorm drainresident evilamateur radiodistress signalknife in handamnesiaccamera shot from inside human bodyswimwhite room3d sequel to 2d filmsoselevator crashaustralian accentimplosionbullet dodgingabandoned prisonstop actionfalling elevatorimpaled through the headhoming devicecrash survivordialogue over end creditsknife in thighmutant dogold gloryextreme brutality (See All) |
Julie's back in college with her new friend, and they win a weekend trip to an island. On the way there, someone dies, and then the girls are tormented on the island.
Subgenre: | black comedyteen movieteen horror |
Themes: | betrayaldeathrevengemurderfearescapedeceptionparanoiaguiltnear death experience |
Mood: | gorenightmareslasher |
Locations: | hospitalbarrestaurantchurchswimming poolhotelhelicoptercemeterysmall townairplaneboatnightclubairportkitchenstorm β¦singing in a car (See All) |
Characters: | nurseserial killerdoctorfather son relationshipteenagerboyfriend girlfriend relationshipmaidfisherman |
Period: | 1990syear 1988 |
Story: | stabbed in the footno endinghooksequel to cult favoriteaccidental killingstabbed in the headlifting someone into the airrace against timestabbed in the chestaxerevolvervomitingshot in the chestcar accidentblood splatter β¦corpsepistolsurprise endingknifebare chested maleflashbackviolencebloodfightsequeldancingchaseshowershot to deathfistfightrescuepunched in the facebikinibrawlshowdownsecond partmarijuanahallucinationislandcleavagesurvivalambushdeath of frienddrug dealerimpalementstabbed to deathfalse accusationno opening creditsdream sequencescantily clad femaleroommatebartenderattempted murdercharacter repeating someone else's dialoguestabbed in the backscreamingpay phonevacationcollege studentlightninggymthreatened with a knifefireplacespearheavy rainlooking at oneself in a mirrorkicked in the stomachpart of trilogyinterracial friendshippresumed deadhaunted by the pastblood on facestabbed in the throatpower outagepunched in the stomachbroken glasskaraoketitle appears in writingstabbed in the legatticrainstormpierlens flarecharacters killed one by onevoodoofemale in showermannequinengagement ringtombmarijuana jointyellingstabbed in the handconfessionalcomic reliefstonerradio stationhurricaneresortgreenhousedance cluboffscreen killingman punching a womanman in swimsuitjockhanged mandeath of boyfriendpawnshophiding under a bedfourth of julyseason in titlefemale bartenderreference to richard nixonstupid victimvillain not really dead clichetoothbrusharm slingred herringfalling through the floorpost traumatic stresshooded figurestrobe lightwriting in bloodhotel managerstabbed in the sidefilicidejumping on a bedsecond in trilogybahamassequel to cult filmspit takesparklerdark and stormy nightfear of flyingseasicknesswhite male pretending to be blackfalling down a hillhook for handtanning beddouble impalementstabbed through the chinstranded on an islandu.s. coast guardfalling through a rooftop windowreference to bob marleyreference to freddy kruegersleeping in classboatmanhook for a handreference to jason voorheesstabbed through the neck (See All) |
When Charles Lee Ray needs to get quick escape from cop Mike Norris, he takes his soul and buries it into playful, seemingly good guy doll Chucky. Little does he know a little boy by the name of Andy Barclay will be the new owner of him soon-to-come. Charles confides in Andy while he commits numerou β¦s murders. Once the adults accept Andy's story as truth, it's too late. (Read More)
Subgenre: | independent filmcult filmpsycho thrillerstop motion animationslasher flick |
Themes: | psychopathmurderrevengesupernatural power |
Mood: | slasher |
Locations: | carelevatorapartmentpolice stationchicago illinois |
Characters: | police detectiveserial killermother son relationshipboyhomeless manwitch doctor |
Period: | 1980swinter |
Story: | head spinevil dollscalpelsevered legreverse footagebroken leglifting someone into the airgothicdismembermentsevered armshot in the legchild in perilsevered headstabbed in the chestdecapitation β¦shot in the backblood splattercorpseshootoutpistolknifebloodcigarette smokingpunctuation in titleshot to deathurinationfalling from heightbirthdayapostrophe in titlecar crashsubjective camerafoot chasedeath of friendwidowsubwayfalse accusationperson on fireelectrocutionfirst of seriescharacter's point of view camera shotpossessiondollknocked outlightningattempted rapeshot in the shoulderfirst partfreeze framemaniactv newsburned aliveelectronic music scorebabysittertoyback from the deadtensionchild's point of viewdark humorfalling to deathmental hospitalstabbed in the legthrown through a windowbody landing on a carvoodooblack magicgunfireframed for murderplanthit with a baseball batpresentstabbed in the handhiding in a closethead blown offhuman monsterwhodunitdepartment storeelectric shockpolice interrogationbitten in the neckbumburnt bodysole black character dies clichehiding under a bedexploding househit with a hammerbreaking through a doorvillain not really dead clichefootprintjewelry storetauntingmuraltrail of bloodbandaged handtoy storebitten on the armremadevoodoo dollchantfalling through a windowbreakfast in bedskipping schoolevil laugharm blown offnude paintingmatcheskiller dollfloursoul transferencegingershot in the hearttwo killersdisbelieving adultleg blown offanimatronicattempted strangulationclaw hammerskid rowpeddlerelectroconvulsive therapylightning stormmurder disguised as accidenttalking dollcartoon on televisionfalling on a carstalking victimjammed guncar cigarette lighterchild psychiatristelectric batterydisbelieving authoritiesfalling down a chimneyloss of aunt (See All) |
Michael Myers is still at large and no less dangerous than ever. After a failed reunion to reach his baby sister at their old home, Laurie Strode is immediately taken to a hospital to be treated by the wounds that had been afflicted by her brother a few hours ago. However, Michael isn't too far off β¦and will continue his murdering 'Halloween' rampage until he gets his sister all to himself. (Read More)
Themes: | murder of a police officerbrutalitypsychopathdeathsuicideghostdrunkennessinsanityevilexploitationhomelessnessdeath of daughter |
Mood: | gorerainnightmareslasherdarkness |
Locations: | hospitalhelicopterstrip club |
Characters: | serial killermother son relationshipfather daughter relationshiptattoosingerpsychiatristsniper riflecoroner |
Story: | murder of a nude womanreturning character killed offbroken armstabbed in the headgash in the facesurgeryevil manlatex glovesstabbed in the chestthroat slittingdecapitationheld at gunpointvomitingslow motion sceneshotgun β¦shot in the chestcar accidentblood splattercorpsepistolfemale frontal nudityfemale nuditysequelflashbackbloodviolencenumber in titleinterviewfemale rear nuditysingingpartychasebeatingdreamurinationcameramaskbooksecond partcar crashcafehallucinationstripperf wordhalloweenflashlightbandstrangulationstabbingdeath of friendimpalementstabbed to deathexploding carhit by a carflash forwardstalkermicrophonestabbed in the backportraitclownattackhalloween costumescarstalkingglassesneck breakingmurdererprofanitypizzamaniackilling an animalwoman with glasseshidingcovered in bloodvictimsheepschizophreniamental institutiongirl with glassesduct tape over mouthrampagecorsetblood on facehippietaking a picturetime lapse photographybody countaxe murdercharacters killed one by onekilling spreeswearinghalloween partymusic bandhit with a baseball batinterrupted sexserial murderpsychopathic killerbad guybeheadinggroupg stringmedical masksurgical maskhuman monstersexual violencehomicidal maniacslashingdental maskhead bashed infilm starts with textassistantstrong languagebody baghanged manhead cut offcountry houseextreme violencegraphic violenceoverturning carstabbed in the facebloody violencefemale victimsadistic psychopathpentagramschizophrenicbreaking through a doormass murdererbreaking a mirrorpole dancingjack o'lanterncrime spreereturning character with different actorshackbook signingscreaming in fearmirror ballbrandymichael myersshaky camwhite horsethrown through a windshielddemonicsadisticpublic speakingboogeymangory violencesequel to remakesatanicaxe murderertape over mouthwoman wearing glassesjumpsuitstitchesknife in the headbad jokebleeding from eyespigletmultiple versionsserial teen killerclown maskaxe in the backgirl wearing glasseswhite maskthroat slitnitrile glovesstomped to deathdictionary definition in screen textpublic speakertraumatic shockultraviolenceremake of sequel (See All) |
Zombies rule the world, except for a small group of scientists and military personnel who reside in an underground bunker in Florida. The scientists are using the undead in gruesome experiments; much to the chagrin of the military. Finally the military finds that their men have been used in the scie β¦ntists' experiments, and banish the scientists to the caves that house the Living Dead. Unfortunately, the zombies from above ground have made their way into the bunker. (Read More)
Subgenre: | survival horrorindependent filmcult filmblack comedyb moviepost apocalypsedystopiacreature featurezombie apocalypseamerican horrorzombie outbreak |
Themes: | sadismbrutalitybetrayaldeathmurderrevengesuicidefearescapedeceptionmilitaryracismparanoiaredemptioninsanity β¦exploitationhopeapocalypsecannibalismself sacrificeclaustrophobiaghost town (See All) |
Mood: | goresatirenightmareblood and goresequel to cult horror |
Locations: | beachhelicopterboatelevatorcavelaboratory |
Characters: | african americanboyfriend girlfriend relationshipzombiesoldierreference to godbullylatinoalcoholicmilitary officerbabe scientistsexisthispanic americanzombie soldier |
Period: | 1980s |
Story: | split headsequel to cult favoritesevered legaccidental killingdisembowelmentreverse footagecaucasiansurgerydismembermentsevered armtrapevil manlatex glovesshot in the legthird part β¦severed headdecapitationshot in the backrevolverheld at gunpointshot in the headshot in the chestblood splattercorpsepistolsurprise endingviolencebloodsequelfightcigarette smokingchasecryingshot to deathfistfightmachine gunrescuebrawlshootingbookshowdownsunglassesrunninglow budget filmislandtelephonescientistf wordsurvivalgay slurmassacredeath of friendwomanimpalementman with glassesdream sequenceradiocigar smokingshot in the foreheadracial slurtrainingone against manypilotscreamingclownattackmoaningtough girlskeletonbankshot in the shoulderinjectionglassesisolationshot in the armcult directornewspaper headlinepowermachismoexperimentuzishavingcaptainsabotageelectronic music scorehypodermic needletape recordersociopathscene during opening creditsvirusmad scientistbeardfloridadesperationcovered in bloodgrindhouseirishtorchend of the worldburialaction heroinemexican standoffsocial commentaryeaten alivefemale warriorrampagetensionu.s. armyresearchcynicismfight to the deathitalian americancannibalironydeath threatm 16psychotronicdespaircigarette lighterdead childautopsyaerial shotblood on shirtracisteye gougingsiegegasolinetrailerethnic slurbrainpipe smokingtorso cut in halfintestinesyellingliving deadfemale fightercrocodilebunkertrailer homeshoutingbillboardflaskmercy killingbaseball capfemale herorazoramputationbitten in the neckeyeballcrushed headpalm treefriends who live togetherdeath of boyfrienddisembodied headfight the systemmoustacheshot through the mouthextreme violencemicroscopeflesh eating zombietwo way mirrorhit with a shovelrepeated linecurenervousnessdistrustsubterraneanbloody violencemorphinezombie violencepsychotronic filmcalendarfamous lineanti heroinefinger gungrindhouse filmarmoryevil clownwalkmanoutbreaktechno musictoothbrushx rayed skeletonzombie attackhead ripped offpower strugglebitten in the throatfedorabandanahelicopter pilotmoney falling through the airthroat rippingbanishmentdoomsdayface ripped offbrandyprivatezombie childbodily dismembermentjamaicangoonreference to frankensteinabandoned carbitten on the armchorusham radiosedativemultiple cameosdrive in classicsaluteanthropophagusirishmanwoman with a gunbullhornhorror movie remadezombificationeating human fleshco pilotballadeercuban americandune buggyhell on earthchild shot in the headsobbingheadless corpseabandoned citydeadly diseaseamateur radioabandoned theatersinger offscreenr&bloose cannonright hand mandereliction of dutystabbed through the mouthmissile siloscally capradio operatorgroaningwhiningscary clowncursingwhimperingzombie clowndesolate cityshovel through headnewsboy capcauterymilitary jacketmurmuringtalking zombiebald zombiemaniacal laughshovel through throat (See All) |
Groups of people - colonies - are forced underground due to another ice age. Colony 7 goes to check on Colony 5, which they lost contact with. When they get there they find that the colony has fallen and there is a whole new enemy that they have to face on their way back.
Subgenre: | survival horrorindependent filmmartial artssuspensepost apocalypsedystopiacreature feature |
Themes: | sadismbrutalitybetrayaldeathmurdersuicidefearescapedeceptionnaturesurveillanceexecutionpaniccannibalismcourage β¦self sacrificenear death experiencestarvation (See All) |
Mood: | gorenightmaredarknesssavage |
Locations: | helicoptersnowwaterfarmtunnel |
Characters: | husband wife relationshipboyfriend girlfriend relationshipteenage boyzombiehostagetough guywarrioraction herointerracial relationshiplittle boysecurity guardengineerex soldier |
Period: | futurewinternear future |
Story: | frozen bodystabbed in the headreverse footagedismembermentexploding bodyrace against timeshot in the legsevered headstabbed in the chestthroat slittingaxedecapitationshot in the backrevolverheld at gunpoint β¦slow motion sceneshot in the headshotgunshot in the chestblood splattercorpseshootoutpistolsurprise endingknifeflashbackviolencegunbloodfighttwo word titlekisstitle spoken by characterexplosionchasefirevoice over narrationbeatingdreamshot to deathfistfightfoodrescuepunched in the facewritten by directorbattlegunfightbrawlfalling from heightshootingshowdownriflehand to hand combatdead bodyhandcuffscombatf wordgood versus evilsurvivalfoot chaseorphanflashlightambushbridgeimpalementstabbed to deathmixed martial artsdream sequenceanti herodisarming someonecreaturesearchshot in the foreheadattempted murderbeaten to deathdangerstabbed in the backscreamingkeyfactorymissionrabbittough girlshot in the shoulderpursuitdeath of sonthreatlaptopthreatened with a knifechickenprofanityblood spatterchessiceundergroundhead buttspearmachetesurvivormutantdiseasevirussecurity camerabeardmagazineexploding buildingkicked in the stomachladderbald maneaten alivefemale warriorculturehaunted by the pasttensionexplosivebraveryfight to the deathstabbed in the throatcannibalmanhuntmercilessnesspower outagestabbed in the neckmutehungerbutcherenvironmentalcigarette lighterenvironmental issuestabbed in the legdynamiteinfectionknife fightdark pastlens flareaxe murderrescue missionglobal warmingweathermoral dilemmaclimate changeblood on camera lensporn magazinefinal showdownfemale fighterepidemicstrandedblood stainflaresicknesshead bashed incoughingman kills a womanoffscreen killingmeat cleaverleaderski maskmonitorstabbed in the shoulderbullet woundsole black character dies clichequarantinetragic pastintergenerational friendshippsychotronic filmbreaking through a doorcolonybutcherygogglestrenchcoatattempted robberygas explosionpower strugglehands tiedaxe fightcar wreckcloudscollapsing buildingclimatebonesdark futuredisobeying ordersboiler roombeehivewater bottlecold the temperatureenvironmental disasterice agespear throwingoutpostbridge collapsehuman preyhead cut in halfair ventcorpse with eyes openhandcuffed to a bedshot in the eardismembered bodyfleshsearch and rescueweather manipulationunderground bunkersignalaxe in the chestsurviveabandoned cityexploding bridgetransmissionclimbing a ladderdistress signalhit with a metal pipecanadian science fictionseedscannibal cultpower generatoraxe in the backcollapsing bridgefrozen corpsegas tankopening creditscontrol towerice planetbarricading doordestroyed bridgefemale security guardliving undergroundsharpened teethventweather controldowned helicoptergenetic research (See All) |
SPOILER: Jang Kyung-chul (Choi Min-sik) is a dangerous psychopath serial killer. He has committed infernal serial murders in diabolic ways that one cannot even imagine and his victims range from young women to even children. The police have chased him for a long time, but were unable to catch him. O β¦ne day, Joo-yeon, daughter of a retired police chief becomes his prey and is found dead in a horrific state. Her fiance Soo-hyun (Lee Byung-hun), a top secret agent, decides to track down the murderer himself. He promises himself that he will do everything in his power to take bloody vengeance against the killer, even if it means that he must become a monster himself to get this monstrous and inhumane killer. (Read More)
Subgenre: | dark comedy |
Themes: | sadismpsychopathtorturebetrayalkidnappingmurderrevengerapedrinkingfearmonstervoyeurismcorruptioninsanityhumiliation β¦cannibalismvengeancedevilmurder investigationdeath of daughterrape and revengethe devil (See All) |
Mood: | gorenight |
Locations: | hospitalforestsnowcemeterytaxi |
Characters: | police detectiveserial killerpolicechildrensoldierkillerlustdaughterserial murderer |
Story: | murder of a nude womanscene of the crimesuffocationsevered legchainstabbed in the headgash in the facedismembermentsevered armsevered headstabbed in the chestthroat slittingdecapitationblood splatterknife β¦photographfemale frontal nudityflashbackfightviolencebloodnuditymasturbationmale rear nuditydogsex scenekissfemale rear nuditycigarette smokingcell phonebeatingfistfightpunched in the facesecretcar crashdead bodyfightingsubjective camerabound and gaggedstrangulationstabbingstabbed to deathhit by a carsmokingbeaten to deathcharacter's point of view camera shotknocked outkicked in the faceattempted rapetragic eventmurderercabinsecret agentpowerscene during opening creditsagentnosebleedcovered in bloodmasked manstabbed in the throathit in the crotchcannibalmercilessnessstabbed in the neckjumping through a windowdeath of sisterone daylens flaredeath of loved onemoral dilemmaengagement ringtorso cut in halftracking devicestolen carserial murderstabbed in the handbag over headforced to stripviolence against womenpolice chiefsexual perversionguitar playingstabbed in the armdouble barreled shotgunpharmacypolice captainhead bashed inbody in a trunkgreenhouseoffscreen killingsouth koreatop secretextreme violencegraphic violencemugshotstabbed in the facebutcher knifehit with a hammerpsychotronic filmcut handscytheguillotinecat and mousepower strugglecamera focus on female buttstabbed with scissorstrail of bloodgenital mutilationsevered earhit with a chairstabbed multiple timestortured to deathbandaged handman punches a womantire ironmurder of a pregnant womanblood on the floorhit on the head with a fire extinguisherice pickhit on the head with a rockenvelope full of moneyhit with a wrenchburned with a cigarettejaw ripped offachilles tendon cutconfession of crimehacked to deathdead body in a freezerhit with a metal pipestabbed with a screwdriverfinger suckingwatching a porno moviebroken wristdriving a car without a doordeath of fianceedumb bellressentimentyoung women (See All) |
Almost eleven years after the futile and disastrous expedition on the distant moon LV-223, the deep-space colonisation vessel Covenant equipped with more than 2,000 colonists in cryogenic hibernation, sets a course for the remote planet Origae-6 with the intention to build a new world. Instead, a ro β¦gue transmission will entice the crew to a nearby habitable small planet which resembles The Earth. The unsuspecting members of Covenant will have to cope with biological foes, beyond human comprehension. Ultimately, what was intended as a peaceful exploratory mission, will soon turn into a desperate rescue operation deep into the cold infinite space. (Read More)
Subgenre: | survival horrorsuspensetragedycreature featurefuturisticbody horror |
Themes: | sadismbrutalitybetrayaldeathmurderfearescapefuneralmonsterdeceptionangerparanoiainsanityfaithsurveillance β¦death of wifepanicnear death experienceartificial intelligencespace travelunlikely hero (See All) |
Mood: | gore |
Locations: | forestwoodsouter spacecavelaboratorysex in shower |
Characters: | doctorhusband wife relationshiphomosexualsoldieralienhostagegay kissinterracial relationshipsnipersniper rifleengineerbabe scientistship captainbiologist |
Period: | future |
Story: | acidreturning character killed offsequel to cult favoritesuffocationexploding headdisembowelmentloss of wifeexploding bodyrace against timelatex glovessevered headstabbed in the chestaxedecapitationshot in the back β¦held at gunpointslow motion sceneshot in the headshotgunshot in the chestblood splattercorpsepistolsurprise endingknifephotographbare chested malefemale nuditygunfightbloodflashbacksequelviolencemale nuditybare breastsmale rear nuditytwo word titlesex scenefemale rear nuditycigarette smokingexplosionchaseshowerfiretopless female nuditybeatingshot to deathfistfightmachine gunurinationrescuepunched in the facecamerabrawlbare buttfalling from heightpaintingshowdownsecond partrobotpianoriverscientistf wordsubjective camerasurvivalflashlightstrangulationmassacremountaindeath of friendimpalementwidowradiodisarming someonedouble crossspaceshipcreaturecigar smokingtraininggravepilotbeaten to deathdangerstabbed in the backprologuescreamingwidowerperson on firecharacter's point of view camera shotmissionactor playing multiple rolesstatuetough girllightningskeletonscartragic eventdeath of husbandlaptopneck breakingsuspicionmercenarywaterfallobscene finger gesturecult directorshavingcaptainbulletburned aliveheavy rainegglooking at oneself in a mirrorsociopathscene during opening creditshelmetviruscowboy hatloss of friendsecurity cameramad scientistloss of loved onebeardspacecraftsergeantplanetbarefoot malesevered handlasergenocidecrushed to deathandroideaten alivemexicanpresumed deadfemale warriormechanicrampagefight to the deathmercilessnessstabbed in the neckevacuationpunched in the chestassault rifleinfectionaerial shothologramrainstormraised middle fingerhomoeroticismfemale doctormale male kissloss of husbandcharacters killed one by onelasersightkilling spreedeath of loved onetank topburned to deathmoral dilemmaprequelgrenade launchertracking deviceclose up of eyesinterrupted sexfemale soldierextraterrestrialexpeditionfinal showdownfire extinguishervomithead blown offarmored carsuper strengthtwist endingburnt facehurricaneinterracial marriagepartial female nuditycrash landingreluctant herooffscreen killingaltered version of studio logoquarantineparasitewoman fights a mandistrustsubterraneansole survivormass graveflare gunbulldozerceocreationismstupid victimvillain not really dead clichearmoryalien creaturespacesuitsecret roomspace explorationcryogenicsscrollkilled during sexarchaeologisthuman alienbiological weaponbritish actor playing american characteralien technologytrapped in spacehumanoidsuper computervideo recordinggay subtexthomoeroticdisobeying ordersinfirmarycolonizationbiohazardsecret laboratoryblood vomitingexplosive decompressionspace westernembryospacewalkrobot as menacexenomorphalien space craftsuspended animationrobot as pathosreference to richard wagnerhole in chestsignallovecraftianalien parasitewheatcamera shot from inside human bodyterraformingface burnfemale mechanicprequel and sequelreference to lord byronshockwavewoman wearing a tank topecologistfemale mercenaryrecorderhelmet camerastasisreference to john miltoncutting own hairdereliction of dutyhomosexual couple2100spathogenspace colonizationsuffocated to deathreference to john denverneutrinoreference to michaelangeloreference to percy bysshe shelleychest ripped open (See All) |
Alexia travels with her friend Marie to spend a couple of days with her family in their farm in the country. They arrive late and they are welcomed by Alexia's father. Late in the night, a sadistic and sick killer breaks into the farmhouse, slaughters Alexia's family--including their dog--and kidnap β¦s Alexia. Marie hides from the criminal and tries to help the hysterical and frightened Alexia, chase the maniac, and disclose his identity in the end. (Read More)
Subgenre: | sadistic horrorindependent filmsuspenseb movieb horrorindependent horrorpsychological horrorfrench horrorhorror b movie |
Themes: | home invasionsadismbrutalitypsychopathtorturekidnappingdeathmurderfriendshipsurrealismrapefeardeath of fatherdeath of motherinsanity β¦evilunrequited loveexploitationdeath of wifemadnessmurder of fathermurder of husbandmurder of mothermurder of brothermurder of son (See All) |
Mood: | gorenightmarecar chasenightslasherdarknessblood and gore |
Locations: | hospitalforestbathtubwoodsrural settingroad tripfrancetruckgas stationsinging in a carbackwoodsback country |
Characters: | serial killerpolicefamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipfriendboybrother sister relationshipteenage girlfemale protagoniststudentbest friend β¦killervillainterrorfrenchslasher killerbest friendsmysterious villainserial murderermysterious killerdeath of boy (See All) |
Story: | female psychopathsuffocationgash in the facemutilationchainsawevil mansevered headstabbed in the chestthroat slittingaxedecapitationshot in the backslow motion sceneshot in the headshotgun β¦car accidentblood splattercorpsesurprise endingknifephotographfemale frontal nudityfemale nuditygunflashbackviolencebloodf ratedbare breastsmasturbationdogcigarette smokinglesbian kisschaseshowertelephone calldreammirrorurinationshootingriflesunglassesbedcar crashdead bodylow budget filmbathroomneighborvoyeurtelephonesubjective camerasurvivalflashlightbound and gaggedmassacrestabbingimpalementhousescantily clad femalevanon the rundolldeath of childdeath of brotherpursuitstalkingdeath of sondeath of husbandmurderersleepingeuropekillingblood spattersplatterchild murdermaniacfireplacekilling an animalmass murderlistening to musicsurvivorstabbed in the stomachpsychosevered handgrindhousestrangerrape victimfollowing someonerapistfemale killerrampagerednecktensionsurveillance cameramobile phonebroken glassmental hospitalplot twistbutcherperversionmurder of a childslaughterswingclassmatebody countaxe murdersexual assaultcharacters killed one by onekilling spreeparrotpsycho killerdead dogbeing followedpervertblood on camera lensserial murderpsychopathic killertaking a showerbarbed wirevideo surveillancebad guyearphonesmadmanclosetnecrophiliaminimal castkillkilling a doghuman monsterhomicidal maniacfarmhouseslashinglistening to a radiocornfieldpiercinggreenhouserazor bladeurinalexamfemale villainevil womanextreme violencemurder of wifefilling stationgraphic violencemurderessstabbed in the facecar radiohiding under a beddeath of familyfeetcut into pieceslesbian subtextbloody violencebutcher knifefemale victimsadistic psychopathmurder spreevineyardchainsdriving at nightdisturbed individualbutcherygrindhouse filmbludgeoningwalkmanexploitation filmcrime spreestraight razorcreepbloody body of a childdeeply disturbed personserial rapistsexual predatorgas station attendantfemale serial killerplastic bagweirdocircular sawpadlockbreaking a car windowdoor bellmultiple personality disordergiallo esquepolice vanpsychiatric wardgory violencesickoaxe murdererbad girlpreyambient musicunreliable narratorfemale murdererjumpsuitshower curtainnecrophiliacvision of the futureaxe in the cheststabhead in a toiletstabbed with glasskeychainsex with the deadfrench shock cinemapierced belly buttonsadistic killersouthern francefemale victimsfrench cinemalesbian lead charactergas pumpslashed to deathearplugsrear ending a carpsychotic killerserial rapesolarisationfrench manserial killing (See All) |
Two years after the events of Scream, Sidney Prescott and Randy are attending Windsor college. They are trying to get on with their lives...Until a new Ghostface killing spree begins. With the help of Dewey and Gale, Sidney must find out who's behind the murders. As the body count goes up, the list β¦of suspects goes down. (Read More)
Subgenre: | cult filmblack comedysuspenseconspiracypost modernslasher flickteen movieteen horrorhorror spoof |
Themes: | murder of a police officersadismpsychopathbetrayalrevengedeathmurderlovefeardrunkennessescapeinvestigationdeceptionvoyeurismparanoia β¦insanitytheatrenear death experience (See All) |
Mood: | goresatireslasher |
Locations: | hospitalbicyclepolice stationpolice carfire truck |
Characters: | police detectivedetectiveserial killerpoliceteenagerboyfriend girlfriend relationshipfemale protagonistpolice officerhostagekillerex boyfriend ex girlfriend relationshipself referential |
Period: | 1990s |
Story: | female psychopathshot in the throatreturning character killed offsequel to cult favoritestabbed in the headvideotapeshot in the legstabbed in the chestthroat slittingaxeheld at gunpointslow motion sceneshot in the headshot in the chestcar accident β¦blood splattercorpsepistolsurprise endingknifebare chested maleviolencesequelbloodf ratednumber in titleinterviewkisscigarette smokingsingingpartychasecell phonebeatingdigit in titleshot to deathurinationface slaprescuepunched in the facewatching tvcomputerbrawlmaskshowdownsunglassessecond partcar crashcollegehallucinationvoyeurtelevisiontelephonef wordreportergood versus evilsurvivalfoot chasegay slurbedroomflashlightjournalistambushvideo cameraambulancestabbingdeath of friendimpalementstabbed to deathinternetfalse accusationno opening creditsdisarming someonehit by a cardouble crosspolice officer killedvannews reportnecklaceshot in the foreheadracial slurattempted murderlibraryauthorstalkercharacter repeating someone else's dialoguemicrophonestabbed in the backcostumescreamingattackpay phoneproduct placementstatuecover upknocked outkicked in the facecollege studentlightningprankscarbodyguardstalkingfilm within a filmisolationsuspicionstagecharacter says i love youthreatened with a knifeshot in the armbare chested male bondagecult directorstrong female characterpizzatwenty somethingeavesdroppingtv newsfalling down stairsheroineshot in the stomachfamecatfightsurvivorgroup of friendsstabbed in the stomachcrucifixmovie theatervillainessblockbusterrehearsalpress conferencestrong female leadinterracial friendshipcrushed to deathsocial commentarymasked manpresumed deadfemale warriorduct tape over mouthcrime scenecameohaunted by the pastconstruction sitestabbed in the throatmercilessnessevacuationfalling to deathescape attempte maillens flarefemale reporterplaycharacters killed one by oneethnic slurkilling spreemasked killermedia coverageclose up of eyesenglishman abroadintimidationnews reporterdirector cameoex cophiding in a closetohiocafeteriafake identitypolice chiefpopcornwhodunitcameramanfraternitysororitybusiness cardman kills a womanoffscreen killingfemale villainwoman kills a mandeath of boyfriendstabbed in the shouldercollege campusstabbed in the facetragic pastreference to star warslimpwoman slaps a manfamous linestupid victimvillain not really dead clicheclimbing out a windowvcrthrown from a car555 phone numberred herringfemale journalistsittingfilm schoolwoman punching a manmystery killergeneration xcult figurecut armfilm studentmob of reportersbroken handaccomplicereference to charles mansonthrown from heightdeath by impalementauditoriumstab woundthreatening telephone callthrown through a glass doorinstant messagingprank callsorority housereference to quentin tarantinoreference to o.j. simpsonphone terrorstabbed in the earreference to jeffrey dahmerreference to ted bundytelephone terrortheater directorcopycatvalley girlmetafictionthrown off a balconytv cameramanvoice changerreference to kevin costnerreference to the godfatherfake knifemise en abymereference to jennifer anistonreference to kevin baconreference to the terminatorbreaking bottle over headcopycat killerreference to sandra bullocktalking during a moviewoman kills a womanfalling off a stagesorority partysorority sisterfilm geekreference to james cameronsoundproof roomimpaled by pipestage director (See All) |
200 years in the future a Martian police unit is dispatched to transport a dangerous prisoner from a mining outpost back to justice. But when the team arrives they find the town deserted and some of the inhabitants possessed by the former inhabitants of the planet.
Subgenre: | martial arts |
Themes: | deathmurdersuicidedrugsghostdrunkennessdeceptionseductionrobberyinsanityghost town |
Mood: | gore |
Locations: | trainpolice stationouter space |
Characters: | self mutilationpolicebrother brother relationshipzombie |
Period: | future22nd century |
Story: | gash in the facedismembermentsevered armexploding bodysevered headstabbed in the chestthroat slittingdecapitationshot in the backheld at gunpointshot in the headshotgunshot in the chestblood splattercorpse β¦shootoutpistolknifeflashbackgunviolencebloodfightexplosionshot to deathfistfightmachine gunblondepunched in the facegunfightbrawlshowdownhand to hand combatjailhallucinationsurvivalgangmassacremountainstabbingdeath of friendwomanimpalementstabbed to deathmixed martial artsanti herokingpolice officer killedbeaten to deathperson on fireuniformpossessionknocked outdie hard scenariocult directorgrenadenipples visible through clothingelectronic music scoretold in flashbacksevered fingerfight to the deathslaughterloss of brotherminingblonde womanatomic bombfinger cut offnuclearminerarcheologisthot air balloonmarsbreaking through a doorflashback within a flashbackcavernmars the planetleg woundpolicewoman killinghung upside downcut armhuman versus alienmartianmusic score composed by directorsevered facehandcuffed womanoutnumberedbattering ramdumb criminalhit with a rifle buttnuclear reactorlocked in a closetspace westernalien possessionclimbing up a wallhead on a stakethrown from a trainterraformingpolice station attackfuturistic trainpunch into the camerabody possessionalien organismmatriarchal societyfemale dominated societyrock music score (See All) |
In "House of 1000 Corpses", two young couples take a misguided tour onto the back roads of America in search of a local legend known as Dr. Satan. Lost and stranded, they are set upon by a bizarre family of psychotics. Murder, cannibalism and satanic rituals are just a few of the 1000+ horrors that β¦await. (Read More)
Subgenre: | sadistic horrorindependent filmcult filmdark comedyslasher flickcreature feature |
Themes: | murder of a police officersadismtorturekidnappingdeathmurdersurrealismrapejealousyfearfuneralmonsterseductiontheftdeath of father β¦insanitymental illnesstheatrecannibalismmadness (See All) |
Mood: | gorerainnightmareslasher |
Locations: | cemeterypolice carroad tripcavegas stationmuseumtunnelshedcave in |
Characters: | serial killerfamily relationshipsfather son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoobrother sister relationshipthiefsheriffslasher killerpolice lieutenantevil doctor |
Period: | 1970syear 1977 |
Story: | shot in the neckshot in the facegash in the facelifting someone into the airevil mansevered headstabbed in the chestaxeshot in the backrevolverheld at gunpointslow motion sceneshot in the headshotguncar accident β¦blood splattercorpsepistolsurprise endingknifephotographbare chested maleviolenceflashbackbloodnumber in titledancingchasefirebeatingdreamdigit in titleshot to deathwatching tvthongmaskriflehallucinationsubjective camerahalloweenbound and gaggedstabbed to deathhousetied to a chairmapman with glassescoffinritualgraveyardshot in the foreheadgravecharacter repeating someone else's dialogueperson on firecharacter's point of view camera shotactor playing multiple rolesmissing personlightningskeletonhanginghalloween costumelong takedisappearancecheerleadercrosssplit screenpigtied upcharacter says i love youthreatened with a knifecult directormaniacpoemtv newsundergroundmass murdertape recordertied to a bedcaptivewalkie talkiegiantphone boothflatulencepsychosevered handskullhome movierapistcommercialhitchhikercrushed to deathmasked mangas maskduct tape over mouthnicknameface paintnewsreel footagemental hospitalbody landing on a carknife throwingraised middle fingerlanterndead woman with eyes openpsychoticmannequintorso cut in halfhit with a baseball batintestinesmadmanburied aliveneedleold dark houseurban legendhuman monsterfreakmental retardationnight visionbillboardpsychedelicbody in a trunkdeputyauto mechanicdeath of boyfriendsleeping in a carburnt bodytow truckneck bracereference to john waynebreaking through a doorburn victimghoulevil clownpitattempted robberyjack o'lanternspotlightradio djdepravitycandlelightliquor storeknife in the chesthidden gunserial rapistno survivorstv hostcult figurekiller clownhand cut offfemale serial killerreference to mickey mousetrick or treatsatanic ritualbreaking a car windowmusic score composed by directorscalpingsevered facemissing person posterbroken windshieldreference to charles mansonclown makeupdumb criminalhiding in a carclown facefried chickendrinking and drivingrabbit costumetourist attractionstocking capstraight edge razorfunhousevictim invited to dinnerreference to donald duckroadside attractionfetus in a jarmounted animal headreference to jayne mansfieldshooting out tirehead bracereference to nancy drewreference to ed geinreverse negativedunce cap (See All) |
Alice awakes at home with her daughter Becky and her husband. But soon she realizes that she is actually in an Umbrella Corporation's underground facility. Out of the blue, the computer security system shuts-down and Alice flees to the central control room of the facility. She meets Ada Wong, who wo β¦rks with Albert Wesker, and she learns that a five-man team has been sent by Wesker to rescue them. However, the Red Queen sends Jill Valentine and Rain to hunt them down. (Read More)
Subgenre: | survival horrormartial artspost apocalypsedystopiacyberpunkzombie apocalypsezombie survival |
Themes: | torturekidnappingdeathmurderrevengeescapemonstermilitarysupernatural powersurveillancecannibalismself sacrificeartificial intelligence |
Mood: | goreraincar chase |
Locations: | helicoptersnowmotorcycleairplanetaxielevatorshiprooftoplaboratorysubmarinecar explosioncar motorcycle chasemotorcycle accidentairshiphelicopter explosion β¦airplane explosiontruck explosion (See All) |
Characters: | female protagonistzombiesoldierhostagetough guywarrioraction herodeafnessex police officer |
Story: | exposed brainreturning character killed offtimebombchainshot in the facesyringechainsawexploding bodyrace against timeshot in the legchild in perilaxeshot in the backbombheld at gunpoint β¦slow motion sceneshot in the headshotgunshot in the chestcar accidentblood splattershootoutpistolsurprise endingknifefemale nudityfightflashbacksequelbloodviolenceexplosionchasethree word titleshot to deathfistfightmachine gunrescuepunched in the facecomputerbattlegunfightbrawlfalling from heightshowdownhand to hand combatcar crashinterrogationcombatsurvivalfoot chaseassassinstrangulationarmyimpalementcolon in titlemixed martial artssubwaymappart of serieshit by a carunderwater scenecreatureshot in the foreheadone against manysuburbumbrellamissionproduct placementkicked in the facetough girlbaseball batstreet shootoutshot in the shoulderinjectiondie hard scenariocharacter says i love youunderwaterthreatened with a knifemercenaryshot in the armbattlefieldwashington d.c.stylized violenceexperimenteyeglassesiceundergroundhand grenadeheroinehypodermic needlecatfightmutantred dressdiseasevirussecurity camerakicked in the stomachwristwatchgiantmind controllaserrocket launcherend of the worldaction heroinemexican standofftowelwhite housegun fucrushed to deatheaten alivefemale warriorgas masktokyo japanfloodexplosiveresistancedual wieldbased on video gamepower outagespecial forces3dpunched in the chestairplane crashinfectioncommandohologramone dayalternate realitybulletproof vestcorporationmutationrescue missionfifth partclonesign languagebullet timemoscow russiatracking devicehit with a baseball batclose up of eyesfemale assassindesert eaglefemale soldierblood on camera lenshiding in a closetfemale fighterarmored carsuper strengthgiant monsterplaguecommando unithelicopter crashhit by a truckcommando missiongenetic engineeringfemale herobitten in the necksubmachine guntimes square manhattan new york cityfilmed killingflesh eating zombieopen endedparasitewalking deadwoman fights a mansubterraneanone woman armyfemale gunfightervillain not really dead clichescience runs amokevil corporationx rayed skeletonknife held to throatfemale antagonistnew york city new yorkstarts with narrationtime bombmegacorporationcorporate crimesuper speedbiological weaponcrushed by a carinvulnerabilityrunning for your lifegiant creaturepandemicsuper computerassembly linewashington monumentfalling through icegrappling hookwoman with a gunbad actingbuilding explosioncar flipdeaf childresident evilfighting the systemlaser cutterhouse explosionunderwater explosionbio weaponbrainwashdeaf girlcar hit by a truckfalling to one's deathmutant creaturereverse motionflesh eaterunderground laboratoryformer agentvehicular accidentcomputer controlverticle take off and landing aircraftraccoon cityflying creaturekamchatka (See All) |
Something has gone wrong at a remote scientific research station on Mars. All research has ceased. Communication has failed. And the messages that do get through are less than comforting. It's a level 5 quarantine and the only souls allowed in or out are the Rapid Response Tactical Squad - hardened β¦Marines armed to the teeth with enough firepower to neutralize the enemy...or so they think. (Read More)
Subgenre: | martial artssuspense |
Themes: | brutalitymurdersuicidemonsterheromilitarywrestlingfuture war |
Mood: | gorebreaking the fourth wall |
Locations: | wheelchairbaseballouter spacelaboratorysewer |
Characters: | self mutilationtattoobrother sister relationshipzombiesoldieralientough guyaction herobabe scientisthuman versus monster |
Period: | 21st century2020s |
Story: | shot in the throatsevered legexploding headchainsawsevered armexploding bodylocker roomsevered headdecapitationshot in the backvomitingslow motion sceneshot in the headshot in the chestblood splatter β¦corpseshootoutpistolsurprise endingknifegunfightviolencebloodone word titlechaseshot to deathfistfightmachine gunblondegunfightbrawlfalling from heighthand to hand combatcombatscientistsubjective cameragood versus evilsurvivalfoot chaseambushmassacreimpalementmixed martial artsaccidentanti herodisarming someonefictional warcreatureshot in the foreheadduelelectrocutionmissiontough girlopening action scenedie hard scenariomercenarybare chested male bondagemonkeymachismogrenadekilling an animalmousesergeantsevered handmexican standoffback from the deadgun battlealien invasionbased on video gameescape attemptspecial forcesdark heroautopsywisecrack humorcommandoslaughtergatling gunteleportationlaser gunmain character diestorso cut in halfclose up of eyesvillain played by lead actorstabbed in the handfirst person shooterbullet balletcommando unitcommando missionelectric shockbehind enemy linesgun duelbitten in the neckaltered version of studio logotop secretshot through the mouthquarantineparaplegiccommando raidcut into pieceselevator shaftimmolationmars the planethatchetstarts with narrationcaged animalcorporate crimesevered earaxe in the headstudio logo segues into filmarsenalsuperhumanhero kills a womanmartiansuper soldierdefibrillationfirst person perspectivespace marine2040smultiple monstersshot in the buttsign of the crossminigungenetic mutationportal to hellhigh tech weaponshumanoid monsterattack helicoptersearch and destroy (See All) |
While celebrating their 50th wedding anniversary, a couple are caravanning through the desert with their 3 children, son in law and their baby granddaughter. While the rest of the family agrees there are plenty of better and more appropriate things to do to celebrate an anniversary, they make do wit β¦h what they have, but things take a turn after a sketchy gas station attendant informs them about a "short cut" that will take them in between a series of hills in the desert. It doesn't take too long before they realise they're not alone and the hills indeed do have eyes. (Read More)
Subgenre: | tragedypsycho thriller |
Themes: | sadismbrutalitypsychopathtorturekidnappingdeathmurderrevengesuiciderapedeath of fatherdeath of motherevildeath of wifecannibalism β¦self sacrificemadnessmurder of familyghost town (See All) |
Mood: | goreslasherhorror movie remake |
Locations: | desertcavegas stationsuv |
Characters: | serial killerfamily relationshipsbrother sister relationshipteenage girlteenage boybabykillervillainterror |
Period: | year 2006 |
Story: | stabbed in the footsevered legstabbed in the headmutilationdismembermentsevered armevil mansevered headstabbed in the chestaxerevolvershot in the headshotgunshot in the chestcar accident β¦blood splatterpistolsurprise endingbloodviolencedogfalling from heightcar crashfoot chaseimpalementexploding carcontroversyshot in the foreheadstabbed in the backperson on firevacationbaseball batamerican flagglassesmurdererfirst partkillingsplattermaniacclaim in titleburned alivekilling an animalmutantragewalkie talkievictimrapisthomiciderampagesevered fingerstabbed in the throatcannibalgunshot woundstabbed in the legdeath of sistertrailerminebody countaxe murdermutationkilling spreedeath of loved onemannequinserial murderpsychopathic killerbad guyhysteriamadmancrucifixionex copkilldead animalkilling a doghead blown offhuman monstergerman shepherdstrandedsexual violencehomicidal maniacexploding truckbitten in the neckburnt bodyextreme violenceminersiblinggraphic violencestabbed in the facecut into piecesbloody violencedeformitystupid victimvillain not really dead clicheheart in handwedding anniversaryloss of parentsbrother in lawinfantsevered eargas station attendantaxe in the headpick axefamily in dangerouthouseanthropophaguskidnapped childinbreedingdrug referencebirth defectgraphic rapenuclear testinggovernment secretwalking through a wallsevered spineradioactive fallout (See All) |
LAPD lieutenant Mike Harrigan ('Danny Glover' (qv)) and his cocky detective partner Jerry Lambert ('Bill Paxton' (qv)) soon realize that what seemed a bloody feud between voodoo high priest King Willie's ('Calvin Lockhart' (qv)) Jamaican gangs and Ramon Vega's ('Corey Rand' (qv)) Colombian drug gang β¦ is actually the work of a scary third party. Peter Keyes's ('Gary Busey' (qv)) federal team shields the crime scene even for the LAPD, but after forensics proves it must be an alien, who keeps making victims, the chase brings them all together. (Read More)
Subgenre: | survival horrormartial artscult filmblack comedysuspensecreature feature |
Themes: | murder of a police officermurderdeathpregnancymonstergangster |
Mood: | goreneo noir |
Locations: | bartrainhelicoptercemeterylos angeles californiaurban settingpolice stationcityrooftoprooftop gunfight |
Characters: | police detectivepolice shootoutdetectiveafrican americanpolicealienpregnant womanpolice lieutenant |
Period: | 1990sfuture20th centuryyear 1997 |
Story: | slaughterhousereverse footageswat teamgothicsevered armshot in the legsevered headstabbed in the chestheld at gunpointslow motion sceneshot in the headshot in the chestblood splattercorpseshootout β¦pistolknifefemale full frontal nuditybare chested maleviolencesequelbloodcharacter name in titlenumber in titlemale frontal nuditymale rear nuditytwo word titlechasewoman on topdigit in titleshot to deathmachine gunswordgunfightfalling from heightshowdownhand to hand combatsecond partcar crashnumbered sequelreportersubjective cameragood versus evilfoot chaseflashlightjournalistgangcaliforniawomanimpalementweaponsubwayexploding carno opening creditsfictional warspaceshipritualnews reportcigar smokingnecklacetreeorganized crimecharacter repeating someone else's dialoguestabbed in the backpay phonelightningopening action scenehangingstreet shootoutpolicewomanak 47machismohead buttcophunterblockbusterphone boothskullgun battleseriesdual wieldchaosthrown through a windowtough copraised middle fingerlasersightvoodoogovernment agentdrug lordgrenade launchertorso cut in halfinterrupted sexdesert eaglemarijuana jointinvisibilitygang warsecond in seriesgang violenceunited states of americapredatorsawed off shotguncrashing through a windowtoy gunarm cut offreference to john waynefemale gunfighterdreadlocksshoulder holsterautomatic weaponfalling off a roofsubway trainhung upside downrookie coppayphonefranchisehuman versus alienlifted by the throatbody armorbonesgreen bloodhuman preyheat wavehumanoid alieninfra redpreyalley fightxenomorphlos angeles police departmentliquid nitrogenhanged bodynude man murderedd box motion codeultraviolet lighttrailer narrated by don lafontainefalling through a rooftop windowsword caneinvisibility cloakfalling down an elevator shaftpunch into the cameracolombian drug cartelcauterizationinvisible monsterdriving a car without a doorantique gunhunting peoplepheromonesextraterrestrial alienalien spacecraftswitching characterstitle character not the main characterjamaican possepregnant policewomanspine rippinghuman hunted down for sportobject made of body partpredator chases prey (See All) |
Serial Killer Michael Myers is not finished with Laurie Strode, and their rivalry finally comes to an end. But is this the last we see of Myers? Freddie Harris and Nora Winston are reality programmers at DangerTainment, and are planning to send a group of 6 thrill-seeking teenagers into the childhoo β¦d home of Myers. Cameras are placed all over the house and no one can get out of the house... and then Michael arrives home! (Read More)
Subgenre: | independent filmcult filmslasher flickteen horroramerican horror |
Themes: | murder of a police officerpsychopathmurderdeathrevengefeardeceptionsurveillanceevil |
Mood: | goresatireslasher |
Locations: | forestwoodskitchenwheelchairrooftopfire truck |
Characters: | nurseserial killerteenage girlteenage boykillersecurity guardvillainpsychiatristslasher killercoroner |
Period: | 2000s |
Story: | returning character killed offsequel to cult favoritestabbed in the headbroken leglifting someone into the airchainsawsevered armevil mansevered headstabbed in the chestthroat slittingaxedecapitationblood splattercorpse β¦surprise endingknifefemale nudityfightviolencesequelbloodflashbacktwo word titlechasefirecell phonefistfightmirrorwatching tvcomputercameraundressingbrawlfalling from heightmaskshowdownf wordsubjective cameragood versus evilhalloweenfoot chaseflashlightstrangulationambulancemontageimpalementstabbed to deathinternetpolice officer killednews reportstabbed in the backelectrocutioncharacter's point of view camera shotproduct placementkicked in the facecollege studentlightningskeletondisappearanceneck breakingmurdererthreatened with a knifeobscene finger gesturekillingmaniacheavy rainsecurity cameraloss of loved onemorgueskullfatemasked manmental institutionrampagestabbed in the throatblack brae mailrainstormraised middle fingergasolinebody countaxe murdercasual sexcharacters killed one by onekilling spreemasked killernewspaper clippinghalloween partytext messaginginterrupted sexserial murderpsychopathic killervideo surveillancebad guyhiding in a closetold dark househuman monsterabandoned housewebcamhomicidal maniacclimbing through a windowwhodunithanging upside downlocked doorbreaking a windowjockbody baghanged manhead cut offfilmed killingmurder attemptbutcher knifeman on firesadistic psychopathlocked in a roombreaking through a doorpeep holestupid victimbreaking a mirrorx rayed skeletonsecret roomcrime spreeleg woundcamera focus on female buttimpersonatoreighth partmichael myersdead teenagerlifting a female into the airboogeymandeath by electrocutionskull crushingjumpsuitsee you in hellcult film referencedecomposed bodybutt grabserial teen killerclown maskpolice officer throat slitovernight in a haunted housereality tv productioneyes wide openwhite maskair hornreal movie shown in fictional situationcord (See All) |
28 Weeks Later picks up six months after the Rage Virus has decimated the city of London. The US Army has restored order and is repopulating the quarantined city, when a carrier of the Rage Virus enters London and unknowingly re-ignites the spread of the deadly infection and the nightmare begins... β¦again. (Read More)
Subgenre: | survival horrorpost apocalypsezombie apocalypsezombie survivalbritish horrorzombie outbreakspanish horror |
Themes: | sadismbrutalitydeathfearself sacrificemadness |
Mood: | goredarknesszombie film |
Locations: | helicopterparis francelondon englandcityengland |
Characters: | boyzombiesniperterror |
Story: | no endingexploding headloss of wifedismembermentexploding bodylatex glovesshot in the legchild in perildecapitationshot in the backbombshot in the headshot in the chestblood splattercorpse β¦surprise endingfemale nuditybloodsequelviolencesexnuditynumber in titledreamshot to deathriflesecond partsubwaybeaten to deathperson on fireloss of mothereuropeundergroundburned aliveragegenocideend of the worldtensionu.s. armybutcherinfectionmurder of a childeye gougingslaughtertied feetstadiumflamethrowertorso cut in halfnight visionbitten in the neckmotorboatburnt bodytrampolinetied up while barefootcut into pieceszombie violenceoutbreakzombie attackcandlelightcowardicedoomsdayjet fightersharpshootersnorricamhazmat suitstarving childarm blown offblood vomitingzombificationfirebombhell on earthfood shortagekilled by a propellermale soldierabandoned citydeadly diseaseheredityventilation shaftharbinger of deathoutboard motorhetero chromiashot on digital (See All) |
It's been eight years since the events in the second film, we now see that Andy is a teenager who has been enrolled in a military school. Play Pals Toy Company decides to re-release its Good Guys line, feeling that after all this time, the bad publicity has died down. As they re-used old materials, β¦the spirit of Charles Lee Ray once again comes to life. In his search for Andy, Chucky falls into the hands of a younger boy, and he realizes that it may be easier to transfer his soul into this unsuspecting child. Andy is the only one who knows what Chucky is up to, and it's now up to him to put a stop to it. (Read More)
Subgenre: | black comedy |
Themes: | deathsupernatural powerself sacrifice |
Mood: | goreslasher |
Locations: | campfiremilitary school |
Characters: | serial killerhostagebullysecurity guard |
Period: | 1990s |
Story: | evil dollreturning character killed offsevered legaccidental killinggash in the facelifting someone into the airgothicdismembermentsevered armexploding bodyshot in the legthird partthroat slittingrevolverheld at gunpoint β¦slow motion sceneshot in the chestblood splattercorpsepistolknifephotographsequelbloodcigarette smokingchaseshot to deathmachine gunpunched in the facefalling from heightriflesubjective cameraflashlightbound and gaggedstrangulationambulancemapfalse accusationradiocigar smokingshot in the foreheadcharacter's point of view camera shotpossessionstorytellingdolltentamerican flagthreatened with a knifeshot in the armhaunted houselove interestheart attackhand grenadeelectronic music scoretoysergeantsevered handblack humorcarnivalcolonelcrushed to deathhaircuttarget practicepunched in the stomachresurrectiondark humorlipstickraised middle fingerlieutenantvoodoonewspaper clippingframed for murderhiding in a closettv commercialbarberpush upsbunk bedstabbed in the shoulderhiding under a bedgarbage truckcarouselcut into piecesscythevillain not really dead clichepackagehide and seekpaintballvietnam war veteranstraight razorreturning character with different actorcanteenfunfairhand cut offdartsevered faceyo yomarblearm blown offlocked in a closetkiller dollhit with a golf clubcampfire storypaintball gungarbagemanmilitary exercisetoy factorypolishing shoestoy companytoy helicoptermilitary cadetplaypen magazinefog machine (See All) |
Darryl Revok is the most powerful of all the scanners, and is the head of the underground scanner movement for world domination. Scanners have great psychic power, strong enough to control minds; they can inflict enormous pain/damage on their victims. Doctor Paul Ruth finds a scanner that Revok hasn β¦'t, and converts him to their cause - to destroy the underground movement. (Read More)
Subgenre: | independent filmcult filmsuspenseconspiracytragedyparanormal phenomenabody horror |
Themes: | home invasionbrutalitypsychopathtorturemurderdeathsurrealismsuicidepregnancyescapeinvestigationdeceptionsupernatural powerterrorismsurveillance β¦exploitationregret (See All) |
Mood: | gorecar chasenight |
Locations: | trainhotelhelicoptertaxigas stationschool busart museumabandoned factorycar on fire |
Characters: | self mutilationdoctorbrother brother relationshipartisthitmansecurity guardprofessorhomeless mansuicide by gunshotself inflicted gunshot wounddeath of killer |
Period: | 1980s |
Story: | drill in the headexploding headgash in the facereverse footageexploding bodyevil manshot in the legshot in the backrevolverheld at gunpointshot in the headshotgunshot in the chestcar accidentblood splatter β¦corpsepistolsurprise endingphotographbare chested maleviolencebloodflashbackone word titlecigarette smokingtitle spoken by characterexplosionchasetelephone callfireshot to deathmachine gunface slapcomputerwritten by directorfalling from heightshowdowncar crashinterrogationhallucinationtelephonescientistsubjective camerafoot chaseassassinterroristsubwayexploding carbrunetteapologyman with glassescigar smokingshot in the foreheadon the runduelscreamingperson on firefactorypay phonecharacter's point of view camera shotmissionproduct placementstatuecover upshot in the shoulderinjectionautomobileshot in the armcult directorpsychictraitorfalling down stairssabotagedestructionburned aliverevelationassassination attemptelectronic music scorehypodermic needledrugtied to a bedsecurity cameramagazinenosebleedphone boothpress conferencevisitgrindhousedriving a carladdermind controlart gallerycrushed to deathsurveillance camerablood on faceshopping mallsculptureblack and white scenelaughterthrown through a windowopening a doormeetingburned to deathtelekinesisholding handspipe smokingtelepathyshot through a windowvillain played by lead actoryellingneedlehit in the facesubway stationarmored cartelephone boothescalatorworld dominationfilm projectormegalomaniachot dogdenialhearing voicesautumncabin in the woodsman kills a womancrashing through a windowlying on bedwoman kills a manshot in the handseizurebullet woundsuper powerburnt bodypsychic powershot in the footlighting a cigarettemurder by gunshotman on firehuman experimenttwo brothersmind readingschizophrenicwoman with gunfade to blackdriving at nightfast food restaurantkicking in a doorscience runs amokpackagefratricideman slaps a womanrevolving doormusic storepublic phonethreatened with a gunmegacorporationthreat to killwaiting roomlooking at pictureshaking handsextrasensory perceptiontranquilizer dartburned bodyforced suicideclimbing stairscanuxploitationpsionic powerpublic telephonethrown through a wallmelting facesprinkler systemcomputer programpharmaceuticalsbus crashdart gunscannerknocking on a windowside effectcanadian science fictioncar crashing through a windowreference to sleeping beautyburnt corpsehypodermicexploding eyecrashing through glasswhite eyesclimbing ladderraising one's handcain and abelbrother killing brotherdriveby shootingexploding gas stationcomputer roomcomputer operatorcar crashes into buildinglighting pipe (See All) |
When a Yakuza boss named Anjo disappears with 300 million yen, his chief henchman, a sadomasochistic man named Kakihara, and the rest of his mob goons go looking for him. After capturing and torturing a rival Yakuza member looking for answers, they soon realize they have the wrong man and begin look β¦ing for the man named Jijii who tipped them off in the first place. Soon enough Kakihara and his men encounter Ichi, a psychotic, sexually-repressed young man with amazing martial arts abilities and blades that come out of his shoes. One by one Ichi takes out members of the Yakuza and all the while Kakihara intensifies his pursuit of Ichi and Ichi's controller Jijii. What will happen as the final showdown happens between the tortured and ultra-violent Ichi and the pain-craving Kakihara? (Read More)
Subgenre: | independent filmmartial artscult filmblack comedyart horror |
Themes: | sadismbrutalitytorturemurderdeathrevengesurrealismsuicidedrugsrapegangsterangercorruptiondeath of fathermafia β¦humiliationexploitationcruelty (See All) |
Mood: | gorenightdarkness |
Locations: | bicyclecityrooftopbrothelrooftop fight |
Characters: | self mutilationfather son relationshipbrother brother relationshipprostitutebullyhitmanpimpsuicide by hangingblonde asianjapanese mafia |
Story: | entrailsstabbed in the footbroken necksevered foothookchaindisembowelmentstabbed in the headmutilationsyringedismembermentsevered armevil manshot in the legsevered head β¦throat slittingdecapitationvomitingblood splatterknifefemale nuditybloodflashbackviolenceguncharacter name in titlenumber in titlemale nuditymasturbationbondagetwo word titlenipplestelephone callcryingcell phonebeatingdigit in titleunderwearfoodfalling from heightmaskshootinginterrogationvoyeurcriminalkung fubisexualbedroomassassinbased on comic bookgangmassacrestabbingtied to a chairanti herohit by a cartonguecontroversycigar smokingpainorganized crimebeaten to deathcostumebased on mangakicked in the facebaseball batscreamhanginglong takemanipulationtragic eventglassesmurderertwincult directorcorrupt copchild murdercrime bossstreetmass murderdrugsexual abuseragemobstermobclubsadomasochismmind controlblack humordead womans&mapartment buildingkickingdark humorkicked in the crotchhypnosisaquariumgang rapefallperversiondead manmurder of a childslaughteryakuzadead boypunchcrowmob bosstorso cut in halfpervertintestinesbisexualitymysterious manneedleex copbandagemusclemanrepressionsexual perversionmasochismdegradationpiercingsoupman punching a womankickbloody body of childrazor bladehanged manextreme violencemafia bossbladesexual repressionstabbed in the facecleaningjumpingcut into piecesfemale victimchainsviolent deathsexual humiliationhorror artsolidaritybitedepravityburningjumpshock humorarm ripped offcutbitingdutch anglesliced in twoburnsuspensionbitten handsexual sadismcriminal syndicatebodily dismembermentbroken fingerbanned filmsevered tonguedead prostitutesevered facegangster bossfalse memoryfiendshrimpmouthboy killeddenturesmisanthropytransgressionstabbed through the chinnumber 1 in titletransgressive filmtongue cut outextreme filmtasting bloodtongue piercingdecapitated childcinema extremewoman hatercredits rolling downpredator turns victimneedlesasian mobsexual victimshinjukupredator becomes preychelsea smilepushing the envelopehung by a hookboiling oilface cut offart censorship (See All) |