Please wait - finding best movies...
A new film is currently in production, and a killer is on the loose. The murders draw a reporter, ex-cop, and young woman to the set of the movie inspired by their life. They soon find out that they are dealing with a trilogy, and in a trilogy...anything can happen.
Subgenre: | horror spoofpost modernblack comedymartial artsindependent film |
Themes: | couragehome invasioncelebrityparanoiabrutalitytheftvoyeurismdeceptioninvestigationfilmmakingescapedrunkennessfearjealousybetrayal …kidnappingdeathmurderrevenge (See All) |
Mood: | slashernightmaresatiregore |
Locations: | police carpolice stationapartmentlos angeles californiahelicopterswimming poolbar |
Characters: | police detectivepregnant from rapedeath of girlfriendself referentialex boyfriend ex girlfriend relationshipfilm directorsecurity guardactresshostageactordetectivepolice officerserial killerfemale protagonistbrother sister relationship …boyfriend girlfriend relationshipfather daughter relationshippolice (See All) |
Period: | 2000s1990s |
Story: | copycat killerfax machinemovie scriptgas explosionthrown off a balconydirector cameobirthday partyfemale journalistkilled on birthdaynews reporterfemale reportersecret passagewaysecret doorsecret roomknife throwing …threatened with a knifefoot chasefaking own deathreference to hannibal lecterreference to lois lanedriving in the wrong directiontrailer narrated by don lafontainehall of recordssequel to cult filmfake bloodpicking locklock pickingvoice changerrekindled romancecounterparttelephone terrorthrown through a glass doorphone terrorthreatening telephone callmetafictioncopycatfalling down a hillhit with a golf clubmystery killerfaxcar phonethrown from heighthit with a frying panseclusionman punches a womanvhs tapecounsellorfilm reelcriminal mastermindhidden doorman fights a womanwoman punches a mancounselorfalse namehidden roomhit with a chairwomen's bathroombreaking a bottle over someone's headtalk show hosthidden gunvillain not really dead clichebullet proof vestred herringwrongful arrestman hits a womananti heroinesittingstupid victimhalf brotherfamous lineimprovised weaponfratricideguillotinepsychological torturereference to star warssole black character dies clicheexploding housescriptmetal detectorstabbed in the shoulderwoman kills a mancamcordermovie studiogashollywood signman kills a womanbody in a trunkhearing voicesstabbed in the armtrailer homewhodunitquick drawpopcorngolf clubreturning character killed offlighterlecturehiding in a closetpromiscuous womansequel to cult favoriteex coptaserhit with a baseball batmedia coveragenewspaper clippingblood on shirtlingerie slipmasked killercharacters killed one by onekilling spreeraised middle fingerfalling to deathbulletproof vestwedding ringfilm producerbalconyaerial shotbooby trappunched in the chestfilm setsibling rivalrystabbed in the legframe upmovie setstabbed in the throatmobile phonemercilessnesspartnerfaked deathbraveryduct tape over mouthmovie theatrecrime scenecameofemale warriorpresumed deadbarefootmasked manmexican standoffstrong female leadrape victimjumping from heightkicked in the stomachhollywood californiawristwatchstabbed in the stomachvideotapered dresssurvivorsociopathhead buttfalling down stairsanswering machinerevelationsabotageentertainmenteavesdroppingstrong female characterobscene finger gesturecult directoractingpremarital sexsuspicionexploding bodybasementisolationfilm within a filmstalkingshot in the shoulderbodyguardprankkicked in the facebaseball battough girlknocked outscreamrace against timecover upbeaten to deathcharacter repeating someone else's dialoguestabbed in the backscreamingcostumestalkershot in the foreheadracial slurmarriage proposalshot in the legnews reportthird partdouble crossdisarming someonecoffinno opening creditsfalse accusationtied to a chairstabbed in the cheststabbed to deathtoiletthroat slittingmansionambulancestrangulationambushbound and gaggedjournalistflashlightsurvivalshot in the backf wordreporterrevolvervoyeurhallucinationhandcuffscar crashbirthdaysunglassesheld at gunpointshowdownfalling from heightmasksecretbrawlwatching tvpunched in the facerescueshot in the headshot in the chestcar accidentblood splatterfistfightshot to deathdigit in titlecorpsebeatingcell phoneshowerpistolsurprise endingchaseknifepartyphotographcigarette smokingbare chested malenumber in titlef ratedbloodfightviolencesequeldog (See All) |
Two years after the events of Scream, Sidney Prescott and Randy are attending Windsor college. They are trying to get on with their lives...Until a new Ghostface killing spree begins. With the help of Dewey and Gale, Sidney must find out who's behind the murders. As the body count goes up, the list …of suspects goes down. (Read More)
Subgenre: | horror spoofpost modernblack comedy |
Themes: | paranoiavoyeurismdeceptioninvestigationescapedrunkennessfearbetrayalrevengemurderdeath |
Mood: | slashersatiregore |
Locations: | police carpolice station |
Characters: | police detectiveself referentialex boyfriend ex girlfriend relationshiphostagedetectivepolice officerserial killerfemale protagonistboyfriend girlfriend relationshippolice |
Period: | 1990s |
Story: | copycat killerthrown off a balconydirector cameofemale journalistnews reporterfemale reporterthreatened with a knifefoot chasevoice changertelephone terrorthrown through a glass doorphone terrorthreatening telephone callmetafictioncopycat …mystery killerthrown from heightvillain not really dead clichered herringsittingstupid victimfamous linereference to star warsstabbed in the shoulderwoman kills a manman kills a womanwhodunitpopcornreturning character killed offhiding in a closetsequel to cult favoriteex copmedia coveragecharacters killed one by onemasked killerkilling spreefalling to deathstabbed in the throatmercilessnessduct tape over mouthcrime scenecameofemale warriorpresumed deadmasked manstrong female leadstabbed in the stomachvideotapesurvivorfalling down stairseavesdroppingstrong female charactercult directorsuspicionisolationfilm within a filmstalkingbodyguardprankkicked in the faceknocked outscreamcover upcharacter repeating someone else's dialoguestabbed in the backscreamingcostumestalkershot in the foreheadracial slurshot in the legnews reportdouble crossdisarming someoneno opening creditsfalse accusationstabbed in the cheststabbed to deaththroat slittingambulanceambushjournalistflashlightsurvivalf wordreportervoyeurhallucinationcar crashsunglassesheld at gunpointshowdownmaskbrawlwatching tvpunched in the facerescueshot in the headshot in the chestcar accidentblood splattershot to deathdigit in titlecorpsebeatingcell phonepistolsurprise endingchaseknifepartycigarette smokingbare chested malenumber in titlef ratedbloodviolencesequel (See All) |
1 year after her mother's death, Sydney Prescott (Neve Campbell), and her friends started experiencing some strange phone calls. They later learned the calls were coming from a crazed serial killer, in a white faced mask and a large black robe, looking for revenge. His phone calls usually consist of … many questions, the main one being: Whats your favorite scary movie? Along with many scary movie trivia, ending with bloody pieces of innocent lives scattered around the small town of Woodsboro. (Read More)
Subgenre: | horror spoofpost modernblack comedy |
Themes: | home invasionparanoiabrutalityinvestigationescapedrunkennessfearbetrayalrevengedeathmurder |
Mood: | slashersatiregore |
Locations: | police station |
Characters: | self referentialserial killerfemale protagonistbrother sister relationshipboyfriend girlfriend relationshipfather daughter relationshippolice |
Period: | 1990s |
Story: | director cameonews reporterfemale reporterthreatened with a knifefoot chasetrailer narrated by don lafontainefake bloodvoice changertelephone terrorphone terrorthreatening telephone callmetafictionmystery killerbreaking a bottle over someone's headvillain not really dead cliche …red herringwrongful arrestsittingfamous linepsychological torturewhodunitpopcornhiding in a closetmedia coverageblood on shirtmasked killercharacters killed one by onestabbed in the legframe upfaked deathduct tape over mouthcrime scenecameopresumed deadmasked manstrong female leadkicked in the stomachvideotapefalling down stairsanswering machinerevelationeavesdroppingstrong female charactercult directorpremarital sexsuspicionstalkingshot in the shoulderprankscreamstabbed in the backstalkershot in the foreheadnews reportdisarming someoneno opening creditsfalse accusationtied to a chairstabbed in the cheststabbed to deaththroat slittingambulancebound and gaggedflashlightsurvivalf wordhandcuffscar crashheld at gunpointshowdownfalling from heightmaskwatching tvpunched in the facerescueshot in the headshot in the chestcar accidentblood splattershot to deathcorpsecell phonepistolsurprise endingchaseknifepartycigarette smokingbare chested malef ratedviolenceblood (See All) |
Sidney Prescott, now the author of a self-help book, returns home to Woodsboro on the last stop of her book tour. There she reconnects with Sheriff Dewey and Gale, who are now married, as well as her cousin Jill and her Aunt Kate. Unfortunately, Sidney's appearance also brings about the return of Gh …ostface, putting Sidney, Gale, and Dewey, along with Jill, her friends, and the whole town of Woodsboro in danger. (Read More)
Subgenre: | post modernblack comedy |
Themes: | home invasiondeceptioninvestigationescapedrunkennessjealousybetrayalrevengemurderdeath |
Mood: | slashersatiregore |
Locations: | police station |
Characters: | self referentialex boyfriend ex girlfriend relationshipserial killerfemale protagonistpolice |
Story: | thrown off a balconythreatened with a knifefoot chasetelephone terrorthrown through a glass doorphone terrorthreatening telephone callmystery killervillain not really dead clichebullet proof vestred herringstupid victimsole black character dies clichestabbed in the shouldercamcorder …stabbed in the armwhodunithiding in a closetsequel to cult favoritemedia coveragemasked killercharacters killed one by onestabbed in the legstabbed in the throatduct tape over mouthcrime scenestrong female leadkicked in the stomachstabbed in the stomachred dresssociopathfalling down stairsanswering machinerevelationstrong female charactersuspicionfilm within a filmknocked outscreamcharacter repeating someone else's dialoguestabbed in the backshot in the foreheadnews reportno opening creditstied to a chairstabbed in the cheststabbed to deaththroat slittingambulancebound and gaggedflashlightf wordreporterheld at gunpointfalling from heightmaskpunched in the facerescueshot in the chestblood splattershot to deathdigit in titlecorpsecell phonepistolsurprise endingchaseknifepartynumber in titleviolencesequelblood (See All) |
The crown jewel of Her Majesty's Secret Intelligence Service, Agent Lorraine Broughton (Theron) is equal parts spycraft, sensuality and savagery, willing to deploy any of her skills to stay alive on her impossible mission. Sent alone into Berlin to deliver a priceless dossier out of the destabilized … city, she partners with embedded station chief David Percival (James McAvoy) to navigate her way through the deadliest game of spies. (Read More)
Subgenre: | black comedymartial arts |
Themes: | home invasionparanoiabrutalitydeceptioninvestigationescapedrunkennessfearbetrayalkidnappingrevengemurderdeath |
Mood: | gore |
Locations: | police carapartmentbar |
Characters: | hostagepolice officerfemale protagonistfather daughter relationshippolice |
Story: | knife throwingthreatened with a knifefoot chaseman punches a womanman fights a womanwoman punches a manbreaking a bottle over someone's headhidden gunanti heroineimprovised weaponmetal detectorwoman kills a manman kills a womanstabbed in the armblood on shirt …aerial shotpunched in the cheststabbed in the legstabbed in the throatmercilessnessfemale warriorstrong female leadjumping from heightkicked in the stomachwristwatchhead buttfalling down stairsrevelationpremarital sexsuspicionstalkingkicked in the facetough girlknocked outcover uprace against timebeaten to deathcharacter repeating someone else's dialoguestabbed in the backstalkershot in the foreheadshot in the legnews reportdouble crossdisarming someonestabbed in the cheststabbed to deaththroat slittingstrangulationambushsurvivalshot in the backf wordrevolvercar crashsunglassesheld at gunpointshowdownfalling from heightbrawlpunched in the facerescueshot in the headshot in the chestcar accidentblood splatterfistfightshot to deathcorpsebeatingpistolsurprise endingchaseknifepartyphotographcigarette smokingbare chested malef ratedfightbloodviolence (See All) |
The story centers on a corporate climber who gets stuck working late on Christmas Eve and finds herself the target of an unhinged security guard. With no help in sight, the woman must overcome physical and psychological challenges to survive.
Subgenre: | black comedyindependent film |
Themes: | paranoiadeceptioninvestigationescapedrunkennessfearbetrayalkidnappingmurderrevengedeath |
Mood: | slashergore |
Locations: | police car |
Characters: | police detectivesecurity guardhostagepolice officerfemale protagonistpolice |
Story: | foot chaseman punches a womanman fights a womanwoman punches a manman hits a womanstupid victimimprovised weaponpsychological torturestabbed in the shoulderwoman kills a manbody in a trunktaserblood on shirtcharacters killed one by oneaerial shot …faked deathduct tape over mouthbarefootkicked in the stomachvideotapesociopathanswering machineeavesdroppingobscene finger gestureexploding bodyisolationstalkingbodyguardkicked in the faceknocked outstabbed in the backscreamingstalkerdouble crossfalse accusationtied to a chairambulancestrangulationbound and gaggedflashlightsurvivalf wordvoyeurhandcuffscar crashbrawlpunched in the facecar accidentblood splatterfistfightdigit in titlecorpsebeatingcell phonesurprise endingchaseknifepartynumber in titleblooddogfightviolence (See All) |
Chucky hooks up with another murderous doll, the bridal gown-clad Tiffany, for a Route 66 murder spree with their unwitting hosts, two eloping high-school graduates.
Subgenre: | black comedy |
Themes: | paranoiabrutalitydeceptionescapefearbetrayalkidnappingrevengemurderdeath |
Mood: | slashergore |
Locations: | police carpolice station |
Characters: | police detectiveself referentialex boyfriend ex girlfriend relationshiphostagedetectivepolice officerserial killerboyfriend girlfriend relationshippolice |
Period: | 1990s |
Story: | knife throwingvillain not really dead clichestupid victimwoman kills a manbody in a trunktrailer homelightersequel to cult favoriteraised middle fingerbooby trapframe uppresumed deadmexican standoffsociopathhead butt …sabotageobscene finger gesturepremarital sexexploding bodysuspicionfilm within a filmstalkingbaseball batknocked outrace against timecharacter repeating someone else's dialoguestabbed in the backscreamingstalkermarriage proposalnews reportdouble crossdisarming someonecoffinfalse accusationtied to a chairstabbed in the chestthroat slittingmansionstrangulationambushflashlightf wordrevolverhandcuffscar crashheld at gunpointshowdownwatching tvrescueshot in the chestcar accidentblood splattershot to deathcorpsebeatingcell phonepistolsurprise endingchaseknifephotographcigarette smokingbare chested maleviolencebloodsequelfight (See All) |
It's been seventeen years since Leo Barnes (Frank Grillo) stopped himself from a regrettable act of revenge on Purge Night. Now serving as head of security for Senator Charlie Roan (Elizabeth Mitchell), his mission is to protect her in a run for president and survive the annual ritual that targets t …he poor and innocent. But when a betrayal forces them onto the streets of D.C. on the one night when no help is available, they must stay alive until dawn...or both be sacrificed for their sins against the state. (Read More)
Subgenre: | black comedymartial arts |
Themes: | couragehome invasionparanoiabrutalitydeceptionescapefearbetrayalkidnappingrevengemurderdeath |
Mood: | slashergore |
Locations: | helicopter |
Characters: | hostage |
Story: | threatened with a knifeguillotinestabbed in the armreturning character killed offtasermedia coverageblood on shirtraised middle fingerbulletproof vestaerial shotbooby trappunched in the cheststabbed in the throatmercilessnessbravery …masked manmexican standoffkicked in the stomachwristwatchsociopathobscene finger gestureexploding bodyshot in the shoulderbodyguardkicked in the facebaseball batknocked outrace against timecharacter repeating someone else's dialoguestabbed in the backcostumeshot in the foreheadracial slurshot in the legnews reportthird partdisarming someoneno opening creditstied to a chairstabbed in the cheststabbed to deathambulanceambushbound and gaggedflashlightsurvivalshot in the backf wordrevolvercar crashheld at gunpointshowdownbrawlpunched in the facerescueshot in the headshot in the chestblood splatterfistfightshot to deathcorpsebeatingcell phonepistolchaseknifephotographbare chested malefightsequelviolenceblood (See All) |
A small, seemingly innocuous plastic reel of film leads surveillance specialist Tom Welles down an increasingly dark and frightening path. With the help of the streetwise Max, Welles relentlessly follows a bizarre trail of evidence to determine the fate of a complete stranger. As his work turns into … obsession, he drifts farther and farther away from his wife, family and simple life as a small-town private eye. (Read More)
Themes: | home invasionparanoiabrutalitydeceptioninvestigationfilmmakingescapefearbetrayalkidnappingmurderdeathrevenge |
Locations: | los angeles californiaswimming poolbar |
Characters: | film directorhostagedetective |
Period: | 1990s |
Story: | threatened with a knifefoot chasehall of recordsfilm reelguillotinestabbed in the shoulderbody in a trunkmasked killerfilm producerpunched in the chestfaked deathduct tape over mouthmasked mankicked in the stomachhollywood california …stabbed in the stomachvideotapesociopathanswering machinerevelationeavesdroppingpremarital sexshot in the shoulderbodyguardkicked in the facecover upbeaten to deathstabbed in the backdouble crossdisarming someonestabbed in the cheststabbed to deaththroat slittingmansionambulancestrangulationbound and gaggedshot in the backf wordsunglassesheld at gunpointshowdownfalling from heightmaskbrawlpunched in the faceshot in the chestblood splatterfistfightshot to deathdigit in titlecorpsebeatingcell phonepistolsurprise endingchaseknifephotographcigarette smokingbare chested malenumber in titleviolencefightblood (See All) |
Picking up immediately after the events in Resident Evil: Retribution, Alice (Milla Jovovich) is the only survivor of what was meant to be humanity's final stand against the undead. Now, she must return to where the nightmare began - The Hive in Raccoon City, where the Umbrella Corporation is gather …ing its forces for a final strike against the only remaining survivors of the apocalypse. (Read More)
Subgenre: | martial arts |
Themes: | paranoiabrutalitydeceptionescapefearbetrayalkidnappingrevengedeathmurder |
Mood: | nightmaregore |
Characters: | security guardhostagefemale protagonistboyfriend girlfriend relationshipfather daughter relationship |
Story: | knife throwingthreatened with a knifeanti heroinesole black character dies clichewoman kills a manstabbed in the armreturning character killed offraised middle fingeraerial shotbooby trappunched in the cheststabbed in the legstabbed in the throatmercilessnessfemale warrior …mexican standoffstrong female leadjumping from heightkicked in the stomachwristwatchsurvivorsociopathhead buttrevelationsabotageobscene finger gestureexploding bodyshot in the shoulderkicked in the facetough girlknocked outcover uprace against timebeaten to deathstabbed in the backshot in the foreheadshot in the legdouble crossdisarming someoneno opening creditsstabbed in the cheststabbed to deaththroat slittingstrangulationambushflashlightsurvivalshot in the backcar crashsunglassesheld at gunpointshowdownfalling from heightbrawlpunched in the facerescueshot in the headshot in the chestcar accidentblood splatterfistfightshot to deathcorpsebeatingpistolsurprise endingchaseknifefightdogbloodsequelviolence (See All) |
Set against the backdrop of 1977 Los Angeles, The Nice Guys opens when single father and licensed PI Holland March (Gosling) is hired to investigate the apparent suicide of famous porn star Misty Mountains. As the trail leads him to track down a girl named Amelia (Qualley), he encounters less licens …ed and less hands-off private eye Jackson Healey (Russell Crowe) and his brass knuckles, both hired by the young hippie. However, the situation takes a turn for the worse when Amelia vanishes and it becomes apparent that March wasn't the only party interested. As both men are forced to team up, they'll have to take on a world filled with eccentric goons, strippers dressed as mermaids and even a possible government conspiracy. (Read More)
Subgenre: | black comedy |
Themes: | couragehome invasionparanoiabrutalitydeceptioninvestigationescapedrunkennessfearbetrayalmurderrevengedeath |
Locations: | police carapartmentlos angeles californiaswimming poolbar |
Characters: | hostagedetectivefather daughter relationshippolice |
Story: | birthday partythreatened with a knifefoot chasefalling down a hillfilm reelhit with a chairhidden gunman kills a womanhollywood signwhodunitquick drawhiding in a closetex copfalling to deathfilm producer …aerial shotbooby trappunched in the chestmercilessnessbraverycrime scenebarefootjumping from heightkicked in the stomachhollywood californiasociopathfalling down stairsrevelationstrong female characterexploding bodysuspicionshot in the shoulderbodyguardbaseball batkicked in the faceknocked outcover uprace against timebeaten to deathcharacter repeating someone else's dialogueshot in the foreheadracial slurshot in the legnews reportdouble crossdisarming someonetoiletmansionambulancestrangulationambushf wordrevolverhallucinationcar crashbirthdaysunglassesheld at gunpointshowdownfalling from heightbrawlwatching tvpunched in the facerescueshot in the headshot in the chestcar accidentblood splatterfistfightshot to deathcorpsebeatingpistolsurprise endingchaseknifepartycigarette smokingbare chested malefightblooddogviolence (See All) |
A group of thieves steal a rare gem, but in the process, two of the men double cross the leader of the thieving group, Patrick, and take off with the precious stone. Ten years later, prominent psychiatrist Nathan Conrad is invited to examine a disturbed young woman named Elisabeth. Patrick immediate …ly kidnaps Nathan's daughter, forcing Nathan to attempt to get Elisabeth to reveal a secret number which will ultimately lead Patrick to the whereabouts of the precious gem that has eluded him. (Read More)
Subgenre: | black comedy |
Themes: | home invasionparanoiatheftvoyeurismdeceptioninvestigationescapefearbetrayalkidnappingdeathmurderrevenge |
Locations: | police carpolice stationapartment |
Characters: | police detectivedeath of girlfriendsecurity guardhostagedetectivepolice officerfather daughter relationshippolice |
Period: | 2000s1990s |
Story: | threatened with a knifefoot chasered herringimprovised weaponsole black character dies clichewoman kills a manhearing voicesstabbed in the armhiding in a closetnewspaper clippingstabbed in the legcrime scenemasked mankicked in the stomachwristwatch …sociopathhead buttrevelationsuspicionstalkingshot in the shoulderknocked outscreamrace against timecharacter repeating someone else's dialogueracial slurdouble crosscoffinstabbed in the cheststabbed to deathambulanceambushflashlightshot in the backf wordrevolvervoyeurhandcuffsheld at gunpointshowdownsecretbrawlwatching tvpunched in the facerescueshot in the chestfistfightshot to deathcorpsebeatingcell phonepistolsurprise endingchaseknifephotographcigarette smokingviolencebloodfightdog (See All) |
Subgenre: | martial artsindependent film |
Themes: | paranoiabrutalitydeceptioninvestigationescapefearbetrayalkidnappingrevengemurderdeath |
Characters: | hostageboyfriend girlfriend relationship |
Story: | threatened with a knifefoot chaseimprovised weaponwoman kills a manstabbed in the armcharacters killed one by onekilling spreeaerial shotpunched in the chestpresumed deadkicked in the stomachhead buttfalling down stairsrevelationsabotage …suspicionisolationshot in the shoulderkicked in the faceknocked outcover upbeaten to deathcharacter repeating someone else's dialoguestabbed in the backshot in the foreheaddouble crossdisarming someonestabbed in the cheststabbed to deathstrangulationambushshot in the backf wordheld at gunpointshowdownbrawlpunched in the facerescueshot in the headshot in the chestcar accidentblood splatterfistfightcorpsebeatingcell phoneshowerpistolsurprise endingchaseknifebare chested malebloodfightviolence (See All) |
In Ruggsville, Texas, the police under the command of Sheriff John Quincy Wydell attack the house of the sadistic serial killers Firefly family (a.k.a. The Devil's Reject) and they arrest mother Firefly, but Otis B. Driftwood and Baby Firefly escape from the siege. Tiny is wandering nearby the house … and also escapes. Otis and Baby call their patriarch, the mad clown Captain Spaulding and they schedule to reunite at an isolated motel in the desert. When Otis and Baby arrive, they kidnap two families of singers, using sadism and violence against the harmless persons. Meanwhile, Sheriff Wydell promises to capture and kill the runaways, seeking revenge for the death of his brother, the Deputy George Wydell. (Read More)
Subgenre: | black comedyindependent film |
Themes: | paranoiabrutalitydeceptionescapefearbetrayalkidnappingdeathrevengemurder |
Mood: | nightmaregore |
Locations: | police stationbar |
Characters: | hostagepolice officerserial killerbrother sister relationshipboyfriend girlfriend relationshipfather daughter relationshippolice |
Story: | news reporterknife throwingthreatened with a knifefoot chaseman punches a womanpsychological torturereference to star warssole black character dies clicheexploding houseman kills a womantrailer homereturning character killed offmedia coveragenewspaper clippingblood on shirt …killing spreebulletproof vestpunched in the cheststabbed in the legstabbed in the throatmercilessnesscrime scenemasked mankicked in the stomachstabbed in the stomachhead buttobscene finger gesturecult directorbasementshot in the shoulderknocked outbeaten to deathstabbed in the backscreamingshot in the foreheadracial slurshot in the legnews reportdouble crosstied to a chairstabbed in the cheststabbed to deaththroat slittingstrangulationambushbound and gaggedsurvivalshot in the backf wordrevolverhandcuffsheld at gunpointshowdownpunched in the facerescueshot in the headshot in the chestblood splattershot to deathcorpsebeatingshowerpistolchaseknifephotographcigarette smokingbare chested maledogviolencesequelblood (See All) |
Subgenre: | black comedyindependent film |
Themes: | couragehome invasionparanoiabrutalityescapefearkidnappingdeathmurderrevenge |
Mood: | slashergore |
Locations: | police car |
Characters: | hostagepolice officerboyfriend girlfriend relationship |
Period: | 2000s |
Story: | threatened with a knifefoot chasevillain not really dead clichestupid victimpsychological tortureexploding housestabbed in the shoulderhit with a baseball batblood on shirtcharacters killed one by oneaerial shotbooby trapmercilessnessbraveryjumping from height …stalkingprankstabbed in the backscreamingstalkershot in the legdisarming someonestabbed in the cheststabbed to deathtoiletambushbound and gaggedflashlightsurvivalshot in the backcar crashshowdownfalling from heightrescueshot in the headcar accidentblood splattershot to deathcorpsebeatingcell phonepistolsurprise endingchaseknifecigarette smokingbloodviolence (See All) |
It's nearing the 10th Anniversary of the film 'A Nightmare on Elm Street' and one of the stars, Heather Langenkamp is being scared by a voice on a phone, sounding very similar to the film's villain, Freddy Krueger. When Heather's husband is killed in a car accident and is discovered with slash marks … on him, Heather starts to wonder something. Especially when she discovers that Wes Craven is writing another 'Nightmare' film. Soon, she realizes that Freddy has now entered the real world, and the only way to defeat him is to become Nancy Thompson once again. (Read More)
Subgenre: | post modernindependent film |
Themes: | courageparanoiabrutalitydeceptionfilmmakingescapefearkidnappingmurderdeath |
Mood: | slashernightmaregore |
Locations: | los angeles californiaswimming pool |
Characters: | self referentialfilm directorsecurity guardactresshostageactorpolice officerserial killerfather daughter relationship |
Period: | 1990s |
Story: | foot chasemetafictioncar phonetalk show hostsittingscripthearing voiceshiding in a closetmedia coveragefilm setstabbed in the legmovie setstabbed in the throatbraverycameo …jumping from heighthollywood californiaanswering machineexploding bodyfilm within a filmstalkingknocked outrace against timecharacter repeating someone else's dialoguescreamingstalkernews reportno opening creditsstabbed in the cheststabbed to deathmansionstrangulationambushhallucinationcar crashsunglassesshowdownfalling from heightrescuecar accidentblood splattercorpsecell phonesurprise endingchaseknifesequelbloodviolence (See All) |
A band straying into a secluded part of the Pacific Northwest stumbles onto a horrific act of violence. Because they are the only witnesses, they become the targets of a terrifying gang of skinheads who want to make sure all the evidence is eliminated.
Subgenre: | independent film |
Themes: | paranoiabrutalitytheftdeceptionescapefearbetrayalkidnappingdeathrevengemurder |
Mood: | gore |
Locations: | police carbar |
Characters: | hostageboyfriend girlfriend relationshippolice |
Story: | threatened with a knifeimprovised weaponwoman kills a manman kills a womanstabbed in the armtrailer homecharacters killed one by oneaerial shotframe upstabbed in the throatmercilessnesscrime scenefemale warriorstabbed in the stomachsociopath …revelationisolationbaseball battough girlrace against timecover upstabbed in the backshot in the foreheadracial slurshot in the legdisarming someoneno opening creditsstabbed in the cheststabbed to deaththroat slittingstrangulationambushflashlightsurvivalshot in the backf wordrevolverheld at gunpointshowdownbrawlshot in the headshot in the chestblood splattershot to deathcorpsecell phonepistolsurprise endingknifephotographcigarette smokingdogviolencebloodfight (See All) |
After accomplishing the assignment of dismantling a human trafficking organization, the former military and drifter Jack Reacher goes to Washington to invite his liaison, Major Susan Turner, to have dinner with him. However, he meets her substitute, Colonel Sam Morgan, who explains that Major Turner … has been arrested and accused of espionage. Jack seeks out her veteran lawyer, Colonel Bob Moorcroft, who explains that Major Turner has also been accused of the murders of two soldiers in Afghanistan. Further, he also tells Jack he is being sued, accused by a woman of being the father of her fifteen year-old daughter, Samantha. When Moorcroft is murdered, Jack is accused of being the killer and sent to a prison. He sees that Turner and he have been framed and also that Turner will be killed by two assassins. However, he rescues her and they flee. Soon, they realize that there is a conspiracy involving military people from the army and a government contractor that is a powerful arms dealer. Jack also learns that Samantha is in danger and Turner and he rescue her. They decide to protect her since a skilled assassin is hunting them down while they try to find the motive of the conspiracy. Who can be trusted? (Read More)
Subgenre: | black comedymartial arts |
Themes: | home invasionparanoiabrutalitydeceptioninvestigationescapefearbetrayalkidnappingrevengedeathmurder |
Locations: | police carapartment |
Characters: | security guardhostagepolice officerpolice |
Story: | threatened with a knifefoot chasethrown from heightman fights a womanwoman punches a manwrongful arrestanti heroineimprovised weaponwoman kills a mantaserraised middle fingerbulletproof vestaerial shotpunched in the chestframe up …mercilessnesscameofemale warriormexican standoffjumping from heightkicked in the stomachhead buttrevelationeavesdroppingobscene finger gestureexploding bodysuspicionstalkingkicked in the facetough girlknocked outcover uprace against timebeaten to deathcharacter repeating someone else's dialoguescreamingshot in the legdouble crossdisarming someonefalse accusationtied to a chairtoiletstrangulationambushflashlightsurvivalshot in the backhandcuffscar crashsunglassesheld at gunpointshowdownfalling from heightbrawlwatching tvpunched in the facerescueshot in the headshot in the chestcar accidentfistfightshot to deathcorpsebeatingcell phoneshowerpistolsurprise endingchaseknifephotographbare chested maleviolencefightsequelblood (See All) |
In the millenium version of this classic Gothic horror we find Abraham Van Helsing (Plummer), who has tangled with Count Dracula (Butler) in the past, working as an English antiques dealer. Simon (Miller) is a vampire hunter in training under his apprenticeship. Van Helsing and Simon travel from Lon …don to New Orleans to rescue Van Helsing's daughter Mary (Waddell) from the family's life long nemesis - Dracula. (Read More)
Subgenre: | black comedymartial arts |
Themes: | home invasionparanoiadeceptionescapefearbetrayalkidnappingrevengedeathmurder |
Mood: | nightmaregore |
Locations: | police station |
Characters: | security guardhostagefather daughter relationship |
Period: | 2000s |
Story: | news reporterfemale reporterthreatened with a knifefoot chaseman fights a womanstupid victimwoman kills a manstabbed in the armkilling spreebooby trappunched in the cheststabbed in the throatmercilessnessjumping from heightkicked in the stomach …revelationpremarital sexkicked in the faceknocked outrace against timestabbed in the backracial slurnews reportdouble crosscoffinstabbed in the cheststabbed to deaththroat slittingstrangulationambushflashlightsurvivalshot in the backf wordhandcuffshallucinationheld at gunpointshowdownfalling from heightbrawlpunched in the facerescueshot in the chestblood splatterfistfightshot to deathcorpsepistolsurprise endingchaseknifepartyphotographbare chested malenumber in titleviolencebloodfight (See All) |
After the earth-shattering revelations of INSURGENT, Tris must escape with Four and go beyond the wall enclosing Chicago. For the first time ever, they will leave the only city and family they have ever known. Once outside, old discoveries are quickly rendered meaningless with the revelation of shoc …king new truths. Tris and Four must quickly decide who they can trust as a ruthless battle ignites beyond the walls of Chicago which threatens all of humanity. In order to survive, Tris will be forced to make impossible choices about courage, allegiance, sacrifice and love. (Read More)
Subgenre: | martial arts |
Themes: | courageparanoiadeceptionescapefearbetrayalkidnappingmurderrevengedeath |
Characters: | security guardhostagefemale protagonistbrother sister relationshipboyfriend girlfriend relationship |
Story: | foot chaseanti heroinestabbed in the shoulderwoman kills a mangasman kills a womanreturning character killed offbulletproof vestaerial shotpunched in the cheststabbed in the throatbraveryfemale warriormexican standoffstrong female lead …kicked in the stomachhead buttfalling down stairsrevelationsabotageeavesdroppingstrong female charactersuspicionkicked in the facetough girlknocked outcover uprace against timebeaten to deathcharacter repeating someone else's dialogueshot in the foreheadthird partdouble crossdisarming someoneno opening creditsstabbed in the cheststabbed to deaththroat slittingambushsurvivalshot in the backrevolverhandcuffshallucinationheld at gunpointshowdownfalling from heightbrawlpunched in the facerescueshot in the headshot in the chestcar accidentfistfightshot to deathcorpsebeatingshowerpistolsurprise endingchaseknifebare chested malebloodviolencesequelfight (See All) |
The five highly trained Bennett sisters in Georgian England must try to protect themselves from the growing zombie threat, find suitable husbands for themselves, battle marriage proposals and unlikely suitors, and save the country before it's too late.
Subgenre: | black comedymartial artsindependent film |
Themes: | courageparanoiabrutalitydeceptionescapedrunkennessfearbetrayalkidnappingmurderdeathrevenge |
Mood: | gore |
Characters: | hostagefemale protagonistbrother sister relationshipfather daughter relationship |
Story: | secret passagewayknife throwingthreatened with a knifeman fights a womanwoman punches a mananti heroinestabbed in the shoulderwoman kills a manquick drawaerial shotpunched in the cheststabbed in the throatmercilessnessbraveryfemale warrior …strong female leadrevelationeavesdroppingstrong female characterexploding bodybodyguardtough girlknocked outrace against timestabbed in the backmarriage proposaldouble crossdisarming someonestabbed in the cheststabbed to deaththroat slittingmansionambushsurvivalhallucinationheld at gunpointshowdownfalling from heightbrawlpunched in the facerescueblood splatterfistfightcorpsebeatingpistolsurprise endingchaseknifepartybloodfightviolencedog (See All) |
When a strange signal pulsates through all cell phone networks worldwide, it starts a murderous epidemic of epic proportions when users become bloodthirsty creatures, and a group of people in New England are among the survivors to deal with the ensuing chaos after.
Subgenre: | independent film |
Themes: | home invasionparanoiabrutalitydeceptionescapedrunkennessfeardeathmurderrevenge |
Mood: | nightmaregore |
Locations: | apartmentbar |
Characters: | security guardpolice officerbrother sister relationshipboyfriend girlfriend relationship |
Story: | foot chasethrown from heightman hits a womanimprovised weaponmetal detectorwoman kills a manman kills a womanhiding in a closethit with a baseball batblood on shirtaerial shotstabbed in the legmobile phonebarefootsurvivor …revelationexploding bodybaseball batbeaten to deathscreamingshot in the foreheaddouble crossdisarming someonestabbed in the cheststabbed to deathtoiletambushflashlightsurvivalshot in the backheld at gunpointshowdownfalling from heightbrawlrescueshot in the headshot in the chestblood splattershot to deathcorpsebeatingcell phonepistolsurprise endingchaseknifepartycigarette smokingbloodviolencedogfight (See All) |
When an eccentric millionaire offer a group of opposites $1,000,000 to spend the night in a so called "Haunted House" with a murderous past, they figure it is a quick way to get quick money and leave. All of them are sure it is some made up story just to mess with their heads a little and test their … courage. But, once they stay in the house they start to think about the mistake they made in coming there when mysterious things start to happen. (Read More)
Subgenre: | black comedy |
Themes: | courageparanoiadeceptionescapedrunkennessfearbetrayalrevengemurderdeath |
Mood: | gore |
Locations: | los angeles californiabar |
Characters: | security guard |
Period: | 1990s |
Story: | birthday partyfemale reporterbullet proof veststupid victimcamcorderblood on shirtbulletproof vestbooby trapframe upfaked deathbraverycameopresumed deadsuspicionbasement …knocked outscreamingracial slurdouble crossfalse accusationstabbed in the cheststabbed to deathambushjournalistflashlightsurvivalf wordhallucinationbirthdaysunglassesheld at gunpointbrawlwatching tvpunched in the facerescueshot in the chestblood splatterfistfightshot to deathcorpsecell phonepistolsurprise endingchaseknifepartyphotographbloodfight (See All) |
The film starts in the early 1980s. Young Martin Asher took a bus for Canada. He meets another teen on the bus Matt Soulsby. When the bus broke they decided to rent a car and drive to Seattle. On the road the car gets a flat tire, and Matt starts changing the tire Martin comments on how he and Matt …are about the same height and he quickly pushes Matt in the way of an oncoming truck causing a huge accident where Matt and the driver both die. He took Matt's guitar and left singing like Matt did. Twenty years later, an FBI profiler, Illeana Scott comes to Canada to help hunting down a serial killer Martin Asher who killed multiple men and lived by their identities. Martin's mother claims that she saw Martin in Quebec city and she tells the police that Martin is evil. The police also has an eyewitness James Costa who saw Asher kill his last victim... (Read More)
Themes: | home invasiondeceptioninvestigationescapefearjealousybetrayalkidnappingmurderrevengedeath |
Mood: | gore |
Locations: | police carpolice stationapartmentbar |
Characters: | police detectivesecurity guardhostagedetectivepolice officerserial killerpolice |
Period: | 2000s |
Story: | secret roomthreatened with a knifefoot chaselock pickinghidden doorred herringwoman kills a manwhodunitblood on shirtkilling spreecrime scenepresumed deadstrong female leadanswering machinestrong female character …premarital sexstalkingbodyguardtough girlcover uprace against timecharacter repeating someone else's dialoguestalkernews reportdouble crossdisarming someonestabbed in the cheststabbed to deaththroat slittingmansionstrangulationambushflashlightsurvivalf wordrevolverhandcuffscar crashsunglassesheld at gunpointshowdownshot in the chestcar accidentblood splattershot to deathcorpsebeatingcell phoneshowerpistolsurprise endingchaseknifephotographcigarette smokingbare chested maleblood (See All) |
An advertising executive is kidnapped and held hostage for 20 years in solitary confinement. When he is inexplicably released, he embarks on an obsessive mission to discover who orchestrated his punishment, only to find he is still trapped in a web of conspiracy and torment.
Themes: | home invasiondeceptioninvestigationescapedrunkennesskidnappingmurderrevengedeath |
Mood: | gore |
Locations: | swimming poolbar |
Characters: | security guardactresshostagefather daughter relationship |
Story: | foot chasepsychological torturegashit with a baseball batpunched in the cheststabbed in the legstabbed in the throatpresumed deadvideotaperevelationeavesdroppingshot in the shoulderkicked in the faceknocked outrace against time …beaten to deathcharacter repeating someone else's dialoguestabbed in the backracial slurnews reporttied to a chairstabbed in the cheststabbed to deaththroat slittingmansionstrangulationf wordvoyeurhallucinationheld at gunpointbrawlwatching tvpunched in the facerescueshot in the chestblood splatterfistfightshot to deathcorpsebeatingcell phoneshowerpistolsurprise endingknifecigarette smokingbare chested malebloodviolence (See All) |
Bill Pope (Ryan Reynolds) is a CIA agent on a mission in London tracking down a shadowy hacker nicknamed "The Dutchman." When he gets mysteriously ambushed and killed, an experimental procedure is used to transfer his memories into dangerous convict Jericho Stewart (Kevin Costner). When he wakes up …with the CIA agent's memories, his mission is to find The Dutchman and make the deal with him before the hacker launches ICBM's and starts World War III. But complications soon arise and the mission turns personal. (Read More)
Subgenre: | black comedyindependent film |
Themes: | home invasionparanoiabrutalitydeceptioninvestigationescapefearbetrayalkidnappingdeathmurderrevenge |
Locations: | police carhelicopter |
Characters: | security guardhostagefather daughter relationshippolice |
Story: | foot chaseimprovised weaponwoman kills a manman kills a womantaserraised middle fingeraerial shotpunched in the cheststabbed in the throatmercilessnessduct tape over mouthcameokicked in the stomachwristwatchsociopath …sabotageeavesdroppingobscene finger gestureshot in the shoulderbodyguardknocked outrace against timebeaten to deathshot in the foreheadshot in the legnews reportdouble crossdisarming someoneno opening creditstied to a chairstabbed in the cheststabbed to deathambulancestrangulationbound and gaggedshot in the backf wordhandcuffscar crashsunglassesheld at gunpointshowdownbrawlpunched in the facerescueshot in the headshot in the chestcar accidentblood splatterfistfightshot to deathcorpsebeatingcell phoneshowerpistolsurprise endingchaseknifephotographcigarette smokingbare chested malebloodviolencefight (See All) |
Ellie has been taking care of her younger brother Jimmy since their parents death. One night after picking him up from a party they are involved in a car accident on Mullholland Drive. While trying to rescue a woman from the other car a creature attacks and kills her, also injuring both Ellie and Ji …mmy. After some research Jimmy realizes the creature could only have been a werewolf. (Read More)
Subgenre: | black comedyindependent film |
Themes: | home invasionparanoiaescapedrunkennessfearjealousydeathmurderrevenge |
Mood: | nightmaresatire |
Locations: | police carlos angeles californiabar |
Characters: | security guardpolice officerbrother sister relationshipboyfriend girlfriend relationshippolice |
Period: | 2000s |
Story: | foot chasewomen's bathroomtalk show hostwoman kills a manhollywood signhearing voicespunched in the cheststabbed in the throatcameokicked in the stomachhollywood californiaobscene finger gesturecult directorbasementshot in the shoulder …kicked in the faceknocked outshot in the foreheadnews reportstabbed in the cheststabbed to deathambulanceambushcar crashshowdownfalling from heightbrawlpunched in the facerescueshot in the headshot in the chestcar accidentfistfightshot to deathcorpsebeatingcell phonepistolsurprise endingchaseknifepartyphotographbare chested maleblooddogfightviolence (See All) |
Small-town fry cook Odd Thomas ('Anton Yelchin' (qv)) is an ordinary guy with a paranormal secret: he sees dead people, everywhere. When a creepy stranger shows-up with an entourage of ghostly bodachs - predators who feed on pain and portend mass destruction - Odd knows that his town is in serious t …rouble. Teaming up with his sweetheart Stormy ('Addison Timlin' (qv)) and the local sheriff ('Willem Dafoe' (qv)), Odd plunges into an epic battle of good vs evil to try to stop a disaster of apocalyptic proportions. Based on the best-selling thriller by Dean Koontz. (Read More)
Subgenre: | black comedyindependent film |
Themes: | home invasionparanoiadeceptioninvestigationescapefearkidnappingmurderdeathrevenge |
Mood: | nightmare |
Locations: | police carapartmentswimming pool |
Characters: | death of girlfriendsecurity guardhostagepolice officerboyfriend girlfriend relationshippolice |
Story: | gas explosionfoot chasevillain not really dead clicheexploding houseman kills a womanbody in a trunkhearing voicestrailer homehit with a baseball batnewspaper clippingblood on shirtkilling spreebulletproof vestframe upcrime scene …masked mansociopathrevelationeavesdroppingexploding bodyshot in the shoulderbaseball batknocked outcover uprace against timescreamingdouble crossdisarming someoneno opening creditsfalse accusationbound and gaggedshot in the backrevolverhandcuffscar crashheld at gunpointshowdownsecretbrawlpunched in the facerescueshot in the headshot in the chestcar accidentblood splatterfistfightshot to deathcorpsebeatingcell phonepistolsurprise endingchaseknifepartyphotographcigarette smokingviolenceblooddogfight (See All) |
Julie's back in college with her new friend, and they win a weekend trip to an island. On the way there, someone dies, and then the girls are tormented on the island.
Subgenre: | black comedy |
Themes: | paranoiadeceptionescapefearbetrayaldeathrevengemurder |
Mood: | slashernightmaregore |
Locations: | helicopterswimming poolbar |
Characters: | serial killerboyfriend girlfriend relationship |
Period: | 1990s |
Story: | threatened with a knifesequel to cult filmfalling down a hillvillain not really dead clichered herringstupid victimsequel to cult favoritecharacters killed one by onestabbed in the legstabbed in the throatpresumed deadkicked in the stomachrace against timecharacter repeating someone else's dialoguestabbed in the back …screamingno opening creditsfalse accusationstabbed in the cheststabbed to deathambushsurvivalrevolverhallucinationshowdownbrawlpunched in the facerescueshot in the chestcar accidentblood splatterfistfightshot to deathcorpseshowerpistolsurprise endingchaseknifebare chested malesequelbloodviolencefight (See All) |
Thirty years after the events of the first film, a new blade runner, LAPD Officer K (Ryan Gosling), unearths a long-buried secret that has the potential to plunge what's left of society into chaos. K's discovery leads him on a quest to find Rick Deckard (Harrison Ford), a former LAPD blade runner wh …o has been missing for 30 years. (Read More)
Subgenre: | martial arts |
Themes: | brutalitydeceptioninvestigationescapefearbetrayalkidnappingmurderdeath |
Locations: | police carpolice stationapartmentlos angeles californiabar |
Characters: | police detectivehostagedetectivepolice officerfather daughter relationshippolice |
Story: | birthday partythreatened with a knifefoot chasehall of recordsman punches a womanman fights a womanwoman punches a manwoman kills a manman kills a womanstabbed in the armsequel to cult favoriteex copaerial shotpunched in the cheststabbed in the leg …mercilessnessfaked deathkicked in the stomachrevelationpremarital sexexploding bodykicked in the facecover upbeaten to deathcharacter repeating someone else's dialoguestabbed in the backshot in the foreheaddisarming someoneno opening creditsstabbed in the cheststabbed to deaththroat slittingstrangulationshot in the backf wordhandcuffscar crashheld at gunpointfalling from heightsecretbrawlpunched in the facerescueshot in the headshot in the chestcar accidentblood splatterfistfightshot to deathdigit in titlecorpsebeatingshowerpistolsurprise endingchaseknifephotographcigarette smokingnumber in titlesequelbloodfightviolencedog (See All) |
Groups of people - colonies - are forced underground due to another ice age. Colony 7 goes to check on Colony 5, which they lost contact with. When they get there they find that the colony has fallen and there is a whole new enemy that they have to face on their way back.
Subgenre: | martial artsindependent film |
Themes: | couragebrutalitydeceptionescapefearbetrayaldeathmurder |
Mood: | nightmaregore |
Locations: | helicopter |
Characters: | security guardhostageboyfriend girlfriend relationship |
Story: | gas explosionthreatened with a knifefoot chasesole black character dies clichestabbed in the shoulderman kills a womanstabbed in the legstabbed in the throatmercilessnessbraveryfemale warriorkicked in the stomachsurvivorhead buttexploding body …shot in the shouldertough girlrace against timebeaten to deathstabbed in the backscreamingshot in the foreheadshot in the legdisarming someonestabbed in the cheststabbed to deaththroat slittingambushflashlightsurvivalshot in the backf wordrevolverhandcuffsheld at gunpointshowdownfalling from heightbrawlpunched in the facerescueshot in the headshot in the chestblood splatterfistfightshot to deathcorpsebeatingpistolsurprise endingchaseknifeviolencebloodfight (See All) |
Mankind discover the existence of the Vampire and Lycan species and they begin a war to annihilate the races. When Selene meets with Michael in the harbor, they are hit by a grenade and Selene passes out. Twelve years later, Selene awakes from a cryogenic sleep in the Antigen laboratory and meets th …e Vampire David. She learns that she had been the subject of the scientist Dr. Jacob Lane and the Vampire and Lycan species have been practically eradicated from Earth. But Selene is still connected to Michael and has visions that she believes that belongs to Michael's sight. However she has a surprise and finds that she has a powerful daughter named Eve that has been raised in the laboratory. Now Selene and David have to protect Eve against the Lycans that intend to use her to inoculate their species against silver. (Read More)
Subgenre: | martial arts |
Themes: | home invasioninvestigationescapekidnappingrevengedeathmurder |
Mood: | gore |
Locations: | police stationhelicopter |
Characters: | police detectivesecurity guardhostagedetectivefemale protagonistpolice |
Story: | knife throwinganti heroinestabbed in the shoulderman kills a womanstabbed in the armpunched in the cheststabbed in the legstabbed in the throatpartnerfemale warriorjumping from heightkicked in the stomachexploding bodyshot in the shoulderkicked in the face …tough girlcover upbeaten to deathcharacter repeating someone else's dialoguestabbed in the backshot in the foreheadshot in the legnews reportno opening creditsstabbed in the cheststabbed to deaththroat slittingstrangulationflashlightsurvivalshot in the backrevolverhandcuffscar crashheld at gunpointshowdownfalling from heightbrawlpunched in the facerescueshot in the headshot in the chestcar accidentblood splatterfistfightshot to deathcorpsebeatingpistolsurprise endingchaseknifephotographbare chested maleviolencebloodsequel (See All) |
Quadripeligic ex-cop Lincoln Rhyme was looking forward to his assisted suicide when he got the news: some sicko was abducting people in a taxi and leaving them to die in particularly sadistic ways. With time counting down between each abduction and possible death, Rhyme recruits rather-unwilling Ame …lia Donaghy, haunted by her cop father's suicide and thinking she's next, into working the crime scenes to track down the killer. (Read More)
Subgenre: | black comedy |
Themes: | home invasionparanoiadeceptioninvestigationescapefearbetrayalkidnappingrevengedeathmurder |
Mood: | gore |
Locations: | police carpolice stationapartmenthelicopterbar |
Characters: | police detectivehostagedetectivepolice officerserial killerboyfriend girlfriend relationshippolice |
Period: | 1990s |
Story: | copycat killerdirector cameocopycatred herringwhodunitex copnewspaper clippingbulletproof vestaerial shotduct tape over mouthcrime scenesociopathrevelationknocked outrace against time …screamingracial slurdouble crossambulanceambushbound and gaggedflashlightshot in the backf wordrevolverhandcuffsheld at gunpointbrawlrescueshot in the chestblood splattershot to deathcorpsepistolsurprise endingchaseknifephotographbare chested malebloodviolence (See All) |
Batman, the costumed crime-fighter who prowls the night skies in Gotham City, soon finds there's another vigilante in town knocking off prominent mob figures. Despite the scythe-like blade for a hand, a mechanical voice and the cloud of smoke that follows the figure wherever it goes, the police and …outraged officials mistake the homicidal crusader for Batman himself and demand that the city's longtime hero be brought to justice. Meanwhile, Andrea Beaumont returns to town. She is the lost love of Bruce Wayne, the billionaire playboy who is Batman's alter ego, and was an integral part of Wayne's decision ten years earlier to don the cape and cowl. Now, she is back in his life and is no less a disruption than the return of his old archenemy, The Joker, who has a stake in seeing the annihilation of this new vigilante, whoever it proves to be. (Read More)
Subgenre: | black comedymartial arts |
Themes: | home invasionparanoiabrutalitydeceptioninvestigationescapefearbetrayalrevengemurderdeath |
Locations: | police stationapartmenthelicopter |
Characters: | police detectiveex boyfriend ex girlfriend relationshipsecurity guardhostagedetectivepolice officerserial killerfather daughter relationshippolice |
Period: | 1990s |
Story: | foot chaseman punches a womanman fights a womanman hits a womanexploding househit with a baseball batkilling spreewedding ringaerial shotbooby trappunched in the chestmercilessnessmasked manjumping from heightkicked in the stomach …head buttrevelationeavesdroppingbodyguardkicked in the facebaseball battough girlcover uprace against timecharacter repeating someone else's dialoguemarriage proposaldouble crossdisarming someonefalse accusationmansionambushbound and gaggedsurvivalrevolvercar crashheld at gunpointshowdownfalling from heightmaskbrawlpunched in the facerescuecar accidentfistfightcorpsebeatingpistolsurprise endingchaseknifepartyphotographcigarette smokingbare chested maleviolencefightblood (See All) |
The college friends Paul, Karen, Bert, Marcy and Jeff rent an isolated cabin in the woods to spend a week together. When they arrive, a man contaminated with a weird disease asks for help to them, but they get in panic and burn the man, who falls in the water reservoir and dies. The whole group, exc …ept Karen, makes a pact of drinking only beer along the week without knowing where the dead body is. When Karen drinks tap water and gets the disease, the group begins their journey to hell. (Read More)
Subgenre: | black comedyindependent film |
Themes: | home invasionparanoiabrutalityescapedrunkennessfearmurderrevengedeath |
Mood: | gore |
Characters: | police officerboyfriend girlfriend relationshippolice |
Period: | 2000s |
Story: | director cameothreatened with a knifefoot chasestupid victimimprovised weaponpromiscuous womanhit with a baseball batcharacters killed one by onepunched in the cheststabbed in the legstabbed in the throateavesdroppingobscene finger gesturecult directorpremarital sex …isolationbaseball batknocked outbeaten to deathstabbed in the backscreamingshot in the foreheadracial slurshot in the legfalse accusationtied to a chairstabbed in the cheststabbed to deathambulanceambushsurvivalshot in the backf wordrevolverhallucinationheld at gunpointbrawlpunched in the faceshot in the headshot in the chestcar accidentblood splattershot to deathcorpsebeatingcell phoneshowerpistolsurprise endingchaseknifepartyphotographcigarette smokingbare chested maledogbloodviolence (See All) |
A couple are driving home when their car breaks down just as the Purge commences. Meanwhile, a police sergeant goes out into the streets to get revenge on the man who killed his son, and a mother and daughter run from their home after assailants destroy it. The five people meet up as they attempt to … survive the night in Los Angeles. (Read More)
Themes: | home invasionbrutalitydeceptionkidnappingdeathrevengemurder |
Mood: | slashergore |
Locations: | apartmentlos angeles california |
Characters: | hostageboyfriend girlfriend relationshipfather daughter relationshippolice |
Story: | foot chasehiding in a closethit with a baseball batmedia coveragebulletproof vestbooby trapmasked mansabotageshot in the shoulderrace against timecharacter repeating someone else's dialogueshot in the foreheadshot in the legnews reportno opening credits …tied to a chairstabbed in the cheststabbed to deathmansionambulanceambushsurvivalshot in the backf wordrevolvercar crashheld at gunpointrescueshot in the headshot in the chestblood splattershot to deathcorpsecell phonepistolsurprise endingknifephotographbare chested malesequelviolenceblood (See All) |
Set way in the future, Earth is no longer inhabitable, so humans have colonized in outer space. One colony receives two cryogenically frozen bodies, and when they defrost them, one of the bodies turns out to be.....who else? Jason Voorhees. No longer in the forest or Camp Crystal Lake, Jason stalks …the colonists in a whole new environment. (Read More)
Subgenre: | black comedymartial artsindependent film |
Themes: | paranoiabrutalityescapefearmurderdeath |
Mood: | slashergore |
Characters: | boyfriend girlfriend relationship |
Period: | 2000s |
Story: | knife throwingthreatened with a knifesequel to cult filmvillain not really dead clichestupid victimstabbed in the shoulderblood on shirtmasked killercharacters killed one by onepresumed deadmasked mankicked in the stomachstabbed in the stomachsabotageexploding body …stalkingkicked in the facetough girlrace against timebeaten to deathstabbed in the backstalkershot in the legdisarming someonestabbed in the cheststabbed to deaththroat slittingstrangulationambushflashlightsurvivalshot in the backheld at gunpointshowdownfalling from heightmaskpunched in the facerescueshot in the headshot in the chestblood splatterfistfightshot to deathcorpsebeatingpistolsurprise endingchaseknifebare chested malenumber in titlefightviolencesequelblood (See All) |
JJ 'Jake' Gittes is a private detective who seems to specialize in matrimonial cases. He is hired by Evelyn Mulwray when she suspects her husband Hollis, builder of the city's water supply system, of having an affair. Gittes does what he does best and photographs him with a young girl but in the ens …uing scandal, it seems he was hired by an impersonator and not the real Mrs. Mulwray. When Mr. Mulwray is found dead, Jake is plunged into a complex web of deceit involving murder, incest, and municipal corruption all related to the city's water supply. (Read More)
Subgenre: | black comedy |
Themes: | home invasionparanoiabrutalitydeceptioninvestigationdrunkennessfearbetrayalmurderdeath |
Locations: | police stationapartmentlos angeles california |
Characters: | police detectivesecurity guardhostagedetectivepolice officerfather daughter relationshippolice |
Story: | director cameothreatened with a knifehall of recordsfamous lineman kills a womanex coppunched in the chestcrime scenerape victimkicked in the stomachsabotageeavesdroppingpremarital sexsuspicionknocked out …cover upcharacter repeating someone else's dialogueracial slurdouble crossfalse accusationmansionambushshot in the backrevolverhandcuffscar crashheld at gunpointshowdownsecretbrawlpunched in the facerescueshot in the headshot in the chestcar accidentfistfightshot to deathcorpsebeatingshowerpistolsurprise endingknifephotographcigarette smokingbare chested maleviolencefight (See All) |
In the near future, Major Motoko Kusanagi (Scarlett Johansson) is the first of her kind: A human saved from a terrible terrorist attack, who is cyber-enhanced to be a perfect soldier devoted to stopping the world's most dangerous criminals. When terrorism reaches a new level that includes the abilit …y to hack into people's minds and control them, Major Kusanagi is uniquely qualified to stop it. As she prepares to face a new enemy, Major Kusanagi discovers that she has been lied to: her life was not saved, it was stolen. She will stop at nothing to recover her past, find out who did this to her and stop them before they do it to others. (Read More)
Subgenre: | martial arts |
Themes: | paranoiadeceptioninvestigationescapefearbetrayalkidnappingmurderdeathrevenge |
Locations: | apartmenthelicopterbar |
Characters: | security guardhostagefemale protagonist |
Story: | foot chasewoman punches a mananti heroinemetal detectorwoman kills a manman kills a womantaserraised middle fingerbulletproof vestaerial shotpunched in the chestfemale warriorpresumed deadstrong female leadjumping from height …kicked in the stomacheavesdroppingobscene finger gestureexploding bodybodyguardkicked in the facetough girlknocked outrace against timecover upbeaten to deathcharacter repeating someone else's dialogueshot in the foreheadshot in the legdisarming someonefalse accusationtied to a chairambushflashlightrevolverhandcuffshallucinationcar crashheld at gunpointshowdownbrawlpunched in the facerescueshot in the headshot in the chestcar accidentfistfightshot to deathcorpsebeatingpistolchaseknifecigarette smokingbare chested malefightdogviolence (See All) |
Bound by a shared destiny, a bright, optimistic teen bursting with scientific curiosity and a former boy-genius inventor jaded by disillusionment embark on a danger-filled mission to unearth the secrets of an enigmatic place somewhere in time and space that exists in their collective memory as "Tomo …rrowland." (Read More)
Subgenre: | martial arts |
Themes: | home invasiondeceptioninvestigationescapefearbetrayalmurderdeath |
Locations: | police stationswimming pool |
Characters: | self referentialsecurity guardbrother sister relationshipfather daughter relationship |
Story: | secret passagewayfoot chaselock pickinghidden doorhidden roomexploding housetaserhit with a baseball bataerial shotbooby trappunched in the chestfemale warriorstrong female leadjumping from heightkicked in the stomach …wristwatchfalling down stairssabotagestrong female characterexploding bodybodyguardkicked in the faceknocked outrace against timebeaten to deathcharacter repeating someone else's dialoguenews reportdouble crossno opening creditsambulanceambushflashlightsurvivalcar crashsunglassesshowdownfalling from heightbrawlpunched in the facerescueshot in the chestcar accidentfistfightcorpsebeatingcell phonesurprise endingchasephotographfightviolencedog (See All) |
Det. John Hobbes is convinced that when killer Edgar Reese is executed, all of his troubles are over. But when people he knows and people on the street start to sing the same tune that Reese sang in the gas chamber, and those same people taunt him, he is told that maybe the cursed fallen angel Azaze …l is behind it all. Azazel is cursed to roam the Earth without a form, and he can switch bodies by any contact, making him hard to track. When Hobbes is forced to kill a man possessed by Azazel, he must clear his name while protecting his family and others from the evil, vengeful Azazel. (Read More)
Subgenre: | black comedyindependent film |
Themes: | paranoiadeceptioninvestigationescapefearbetrayalkidnappingrevengedeathmurder |
Locations: | police stationapartmentbar |
Characters: | police detectivesecurity guardhostagedetectivepolice officerserial killerpolice |
Period: | 1990s |
Story: | copycat killernews reporterfoot chasecopycatgasframe uppartnercrime scenevideotapeanswering machineeavesdroppingobscene finger gesturesuspicionbasementstalking …shot in the shouldercover upstalkershot in the foreheadnews reportdouble crossfalse accusationstabbed in the chestthroat slittingstrangulationambushjournalistflashlightshot in the backf wordrevolverhandcuffsheld at gunpointshowdownpunched in the faceshot in the headshot in the chestblood splattershot to deathcorpsepistolsurprise endingchaseknifephotographcigarette smokingviolencedogblood (See All) |
A mid-western farm boy reluctantly becomes a member of the undead when a girl he meets turns out to be part of a band of southern vampires who roam the highways in stolen cars. Part of his initiation includes a bloody assault on a hick bar.
Subgenre: | black comedyindependent film |
Themes: | deceptioninvestigationescapedrunkennessfearbetrayalkidnappingdeathmurderrevenge |
Mood: | gore |
Locations: | police carpolice stationbar |
Characters: | hostagepolice officerbrother sister relationshipfather daughter relationshippolice |
Story: | knife throwingthreatened with a knifefoot chasetrailer homequick drawblood on shirtpunched in the cheststabbed in the throatmercilessnesssociopathexploding bodyrace against timescreamingshot in the foreheadshot in the leg …double crossdisarming someonestabbed in the cheststabbed to deaththroat slittingstrangulationflashlightshot in the backf wordrevolversunglassesheld at gunpointshowdownbrawlwatching tvpunched in the facerescueshot in the headshot in the chestcar accidentblood splatterfistfightshot to deathcorpsebeatingpistolsurprise endingchaseknifecigarette smokingbare chested malef rateddogviolencebloodfight (See All) |
An extremely wealthy man, dying from cancer, undergoes a radical medical procedure that transfers his consciousness into the body of a healthy young man. But all is not as it seems when he starts to uncover the mystery of the body's origin and the organization that will kill to protect its cause.
Subgenre: | black comedymartial artsindependent film |
Themes: | home invasionparanoiadeceptioninvestigationescapefearbetrayalkidnappingrevengedeathmurder |
Locations: | apartmentswimming poolbar |
Characters: | security guardhostagefather daughter relationship |
Story: | taseraerial shotpunched in the chestfaked deathpresumed deadkicked in the stomachwristwatchrevelationpremarital sexkicked in the faceknocked outcover upcharacter repeating someone else's dialogueshot in the legdouble cross …disarming someoneno opening creditstoiletmansionambulanceambushflashlightsurvivalrevolverhallucinationcar crashheld at gunpointshowdownbrawlpunched in the facerescueshot in the headshot in the chestcar accidentblood splatterfistfightshot to deathcorpsebeatingcell phonepistolsurprise endingchasephotographbare chested malefightviolence (See All) |
Southland Tales is an ensemble piece set in the futuristic landscape of Los Angeles on July 4, 2008, as it stands on the brink of social, economic and environmental disaster. Boxer Santaros is an action star who's stricken with amnesia. His life intertwines with Krysta Now, an adult film star develo …ping her own reality television project, and Ronald Taverner, a Hermosa Beach police officer who holds the key to a vast conspiracy. (Read More)
Subgenre: | black comedyindependent film |
Themes: | paranoiabrutalitydeceptionescapefearbetrayalkidnappingmurderdeath |
Mood: | satiregore |
Locations: | police carlos angeles californiahelicopterbar |
Characters: | film directorhostageactorpolice officerfather daughter relationshippolice |
Period: | 2000s |
Story: | news reporterfoot chasewoman punches a mantalk show hostsole black character dies clichecamcorderman kills a womantasermedia coverageblood on shirtraised middle fingerbulletproof vestaerial shotpunched in the chestmexican standoff …jumping from heightkicked in the stomachfilm within a filmshot in the shoulderbodyguardknocked outcover upcharacter repeating someone else's dialogueracial slurshot in the legnews reportdouble crossdisarming someonecoffinno opening creditstied to a chairtoiletmansionambulanceambushshot in the backf wordrevolvercar crashsunglassesheld at gunpointfalling from heightbrawlwatching tvpunched in the faceshot in the headshot in the chestcar accidentblood splatterfistfightshot to deathcorpsebeatingcell phonepistolsurprise endingchaseknifepartycigarette smokingbare chested malefightbloodviolencesequeldog (See All) |
Famous symbologist on a trail of clues tied to the great Dante himself. When Langdon wakes up in an Italian hospital with amnesia, he teams up with Sienna Brooks, a doctor he hopes will help him recover his memories. Together, they race across Europe and against the clock to stop a madman from unlea …shing a global virus that would wipe out half of the world's population. (Read More)
Themes: | paranoiadeceptionescapefearbetrayalkidnappingdeathmurder |
Mood: | nightmare |
Locations: | police carapartmenthelicopter |
Characters: | security guardactresshostageactorpolice |
Story: | secret passagewaythreatened with a knifefoot chasehidden doorman fights a womanimprovised weaponsole black character dies clichewoman kills a mangolf clubfalling to deathaerial shotfaked deathjumping from heightwristwatchsociopath …revelationknocked outcover uprace against timethird partdouble crossfalse accusationstabbed in the cheststabbed to deathambulancehallucinationcar crashheld at gunpointshowdownfalling from heightbrawlpunched in the faceshot in the chestcar accidentfistfightshot to deathcorpsecell phonepistolsurprise endingchaseknifephotographbare chested malebloodsequeldogfight (See All) |
Subgenre: | black comedyindependent film |
Themes: | deceptionbetrayaldeathrevengemurder |
Locations: | bar |
Characters: | brother sister relationshipboyfriend girlfriend relationshipfather daughter relationship |
Story: | breaking a bottle over someone's headvillain not really dead clichekilling spreestabbed in the legfaked deathpremarital sexsuspicionshot in the shouldercharacter repeating someone else's dialoguestabbed in the backshot in the foreheadshot in the legdouble crossno opening creditsstabbed in the chest …stabbed to deaththroat slittingambulancestrangulationflashlightshot in the backf wordrevolvercar crashbrawlwatching tvpunched in the faceshot in the headshot in the chestblood splatterfistfightshot to deathcorpsebeatingpistolsurprise endingknifepartyphotographcigarette smokingbare chested maleviolenceblood (See All) |
A psychic doctor, John Clancy (Sir Anthony Hopkins), works with an F.B.I. Special Agent (Jeffrey Dean Morgan) in search of serial killer Charles Ambrose (Colin Farrell). After having lived in isolation for two years, since the death of his daughter, Clancy is asked by his friend Joe, an F.B.I. Speci …al Agent to help him solve several murders committed by a serial killer. The problem is that Ambrose is also psychic, and far ahead of Clancy. (Read More)
Subgenre: | independent film |
Themes: | home invasionparanoiabrutalitydeceptioninvestigationfearmurderdeath |
Mood: | gore |
Locations: | apartmentbar |
Characters: | police officerserial killerfather daughter relationshippolice |
Story: | fax machinefoot chasered herringwhodunitbulletproof vestcrime scenemexican standoffsociopathisolationshot in the shouldertough girlrace against timecharacter repeating someone else's dialogueshot in the foreheadshot in the leg …no opening creditsambushshot in the backf wordrevolverhandcuffscar crashheld at gunpointshowdownrescueshot in the headshot in the chestcar accidentblood splattershot to deathcorpsecell phonepistolsurprise endingchaseknifedogviolenceblood (See All) |
When drug violence worsens on the USA Mexico border, the FBI sends an idealistic agent, Kate Macer (Emily Blunt) on a mission to eradicate a drug cartel responsible for a bomb that had killed members of her team.
Subgenre: | independent film |
Themes: | home invasionparanoiabrutalitydeceptioninvestigationescapebetrayalkidnappingmurderdeathrevenge |
Locations: | helicopterbar |
Characters: | hostagepolice officer |
Story: | woman punches a manbulletproof vestaerial shotbooby trappartnersuspicionshot in the shoulderbodyguardtough girlcover upcharacter repeating someone else's dialogueshot in the foreheadshot in the legnews reportdouble cross …disarming someoneno opening creditstied to a chairstabbed to deaththroat slittingmansionstrangulationambushshot in the backf wordhandcuffsheld at gunpointshowdownpunched in the facerescueshot in the headshot in the chestblood splattershot to deathcorpsebeatingcell phonepistolsurprise endingknifephotographcigarette smokingbare chested maleviolencefightdog (See All) |
"Some people lose their faith because Heaven shows them too little," says Thomas Daggett. "But how many people lose their faith because Heaven showed them too much?" Daggett nearly became a priest; now he's a cop. He may want to put religion behind him, but one morning a weird, eyeless, hermaphrodit …ic corpse turns up. Suddenly he is on a path that will put him right in the middle of a war in Heaven. And once again, Heaven will show him too much: gore, blood, charred flesh, living corpses and much worse. Even more central to the heavenly war effort is a young girl. This American Indian child has something Gabriel wants. And Gabriel is willing to kill her and anyone in his path - or even reanimate a corpse or two - to get it. (Read More)
Subgenre: | black comedyindependent film |
Themes: | paranoiabrutalitydeceptioninvestigationescapefearjealousybetrayalkidnappingdeathmurder |
Mood: | gore |
Locations: | police carpolice stationapartmentlos angeles california |
Characters: | police detectivehostagedetectivepolice officerpolice |
Period: | 1990s |
Story: | thrown from heightfilm reeltrailer homenewspaper clippingkilling spreeaerial shotpunched in the chestmercilessnesscrime scenesociopathexploding bodyknocked outrace against timecover upcharacter repeating someone else's dialogue …shot in the foreheaddouble crossdisarming someonecoffinambulanceflashlightsurvivalshot in the backrevolverhandcuffshallucinationsunglassesheld at gunpointshowdownfalling from heightbrawlpunched in the facerescueshot in the headshot in the chestcar accidentblood splatterfistfightshot to deathcorpsebeatingsurprise endingknifephotographcigarette smokingbloodfightviolence (See All) |
When three girls are kidnapped by a man with 23 different personalities, they have to work out which of those personalities will help them escape and which of those personalities will try to stop them.
Subgenre: | black comedy |
Themes: | paranoiabrutalityvoyeurismdeceptionescapefearbetrayalkidnappingdeathmurder |
Mood: | slashergore |
Locations: | police carapartment |
Characters: | security guardhostagepolice officerserial killerfather daughter relationship |
Story: | director cameobirthday partyhit with a chairsole black character dies clichehit with a baseball batcharacters killed one by onekilling spreemercilessnesscameosociopathrevelationsuspicionbasementstalkingbaseball bat …knocked outstalkernews reportdouble crossdisarming someoneambulanceflashlightsurvivalvoyeurbirthdayheld at gunpointwatching tvrescueshot in the chestshot to deathcorpsecell phonesurprise endingchaseknifepartybare chested malesequelbloodviolencedog (See All) |