Please wait - finding best movies...
In 1985, after a successful research in Amazonas, Dr. Dennis Alan from Harvard is invited by the president of a Boston pharmaceutics industry, Andrew Cassedy, to travel to Haiti to investigate the case of a man named Christophe that died in 1978 and has apparently returned to life. Andrew wants samp β¦les of the voodoo drug that was used in Christophe to be tested with the intention of producing a powerful anesthetic. Dr. Alan travels to meet Dr. Marielle Duchamp that is treating Christophe and arrives in Haiti in a period of revolution. Soon Alan is threatened by the chief of the feared Tonton Macuse Dargent Peytraud, who is a torturer and powerful witch. Alan learns that death is not the end in the beginning of his journey to hell. (Read More)
Subgenre: | cult film |
Themes: | claustrophobiapolice brutalityrevolutioncouragefreedomgriefmagicfuneraltorturereligionsurrealism |
Mood: | nightmare |
Locations: | junglepolice stationvillageairportcemeteryhelicopterchurchbeachbar |
Characters: | anthropologistpolice arrestpsychiatristinterracial relationshipnative americanpolice officerzombiedoctor |
Period: | year 1978year 19851970s1980s |
Story: | amazon jungleport au prince haitiblack magicpuffer fishthorazinegas cylinderdeath certificategrave robberforces of eviltoxingrave robbingcockfightingpolice statezombificationjaguar β¦political repressionoil lamptarantulaairlinercomeuppancehaitisecret policedeterminationinterracial coupleritechainedseizurepotiondruggedshamanamazonburied aliveceremonyvoodoosoulsuperstitionboston massachusettsdrummergoattorchskullspidermacheteoccultapplausebare chested male bondageundeadcult directormanipulationknocked outscreampossessionpoisoncostumefive word titlevoice overgraveyardritualcoffinsnakecandleflashlightgood versus evildecapitationhallucinationanimal in titletearscamerawatching tvcomputerpunched in the faceface slapunderwearcorpsedreamwoman on topbased on bookbased on true storypistolexplosionphotographdancingfemale nuditymale nuditybare chested malebloodnuditysex (See All) |
Harry Angel has a new case, to find a man called Johnny Favourite. Except things aren't quite that simple and Johnny doesn't want to be found. Let's just say that amongst the period detail and beautiful scenery, it all gets really really nasty.
Subgenre: | cult filmindependent filmsupernaturalpsychologicalpsychological horrorsupernatural thriller |
Themes: | magicreligionmurderdeathdrugsinvestigationincestmemorycorruptionsupernatural powerblackmailgamblingcannibalismamnesiadevil β¦murder investigationdeath of daughterfather daughter incest (See All) |
Mood: | goreneo noir |
Locations: | churchbeachbarhospitalnew york cityrestauranttrainhotelsnowbathtubbuselevatorfarmtrain station |
Characters: | police arrestinterracial relationshipdoctorfather daughter relationshipsingerteenage girlsoldierserial killernursedetectivemusicianbabypriestlawyerlust β¦police detectivebiblemaidfrenchself discoveryfather daughter sex (See All) |
Period: | 1950s |
Story: | black magicriteceremonyvoodoosoulsuperstitionoccultapplausescreamgraveyardritualcandleflashlighthallucinationtears β¦corpsedreampistolphotographdancingbare chested malebloodcharacter name in titlebased on novelfemale frontal nudityflashbackmale rear nuditydogtwo word titlesex scenefemale rear nuditycigarette smokinginterracial sexnipplessingingsurprise endingpantiescryingshot to deathblood splatterfistfightmirrorcatwritten by directorvomitingrunninginterrogationpianodemonrevolverrivermanhattan new york cityfoot chasebraold manmansionbridgestabbed to deathdinertoiletstabbed in the chestsevered headnundream sequencesearchdrowningbartenderracial slurgunshotgravedrug addictmicrophonekeyuniformstatuemissing personringscene during end creditspianistpursuitcountrysideglassesratstagechickenjazzprivate detectiveidentityspiritkilling an animalhead buttbreaking and enteringcophypodermic needleeggtape recorderperformancecomamutilationpatientguitaristbuttocksmovie theatersevered handtimecovered in bloodnew year's eveaudiencebrooklyn new york cityparadeanimal attackpreachermental institutionwatching televisionfannew orleans louisianajunkiescene after end creditsdisembowelmentheartblood on shirtchoirrainstormcanecastrationlooking at self in mirrorpastorfortune tellermusic bandprivate investigatorposteratheistwoman in bathtubdrumsgarterbeing followedinvestigatorfountainbaptismlouisianaspiral staircasehorse racingperformerarcadeanimal crueltysatanismbroken mirrormaking outclinichearing voicesinterracial kissgramophoneshot in the eyelistening to radiowhistlingrazormarching bandafrican american womanstablecleaning ladyolder man younger woman sextimes square manhattan new york citycrabbettingcrowbarmorphinesymbolheart ripped outhorse and wagoniconpentagramaltarprivate eyecut handmurder of a nude womankicking in a doorpart of the body in titletrenchcoatharlem manhattan new york citydeal with the devillockworld war two veteranstraight razortap dancingevil childgenital mutilationfuneral processionluciferphonograph recordshackstreetcarbody part in titlesatanic ritualincestuous sexdevil worshipcajunconey island brooklyn new york citydog bitenylonswashroomsouthern gothicafroelectric fananimal sacrificeblood on the floorcockfightyear 1955ice pickpriestesssoul transferencemarqueeherbincantationtarot cardsbloodstainoccult ritualmedicine cabinetfreight elevatorlost soulconey islandpit bullharlemfaustianjubilationscaldingpalm readerpick up truckfoot bridgeslumscongafather murders daughteroccult detective17 year old girlbongosposing as a doctorid tagsearch for selfbreaking a lockhoodoopoughkeepsie new yorkfaustian bargaingumboself search17 year old daughterfather kills daughter (See All) |
It's the late 1960's. Just for a lark, graduate student Eddie Jessup, known for being unconventional, brilliant and slightly mad, conducts experiments with an isolation chamber, using himself as the subject. His experiences in the chamber cause him to hallucinate, much of the imagery being religious β¦-based despite he not being a religious man. Seven years later, he is a respected full professor in the Harvard Medical School. Believing he has lost his edge and has fallen into an unwanted state of respectability, Eddie decides to resume his work with sensory deprivation, this time using hallucinogens, specifically untested ones used in mystical Mexican rituals, to enhance the experience of being in the isolation tank. After initial tests, he claims he entered an alternate physical and mental state. Although unbelieving of Eddie's claims, his colleagues Arthur Rosenberg and Mason Parrish, as well as Eddie's wife, Emily, who is in her own right a respected academic, are concerned for Eddie's well being. However, if Eddie's claims are indeed true, he could do irreparable harm to himself and others around him, especially if his altered states are uncontrollable. (Read More)
Subgenre: | cult filmsuspenseallegory |
Themes: | religionsurrealismdrugspregnancydrunkennessdancememorynatureangercancerpanicevolution |
Mood: | nightmaregore |
Locations: | police stationvillageairportbarwheelchairafricaspacecavemexicocampfirestormsan francisco california |
Characters: | anthropologistpolice officerdoctorhusband wife relationshipfather daughter relationshipmother daughter relationshipstudentmusicianreference to godlittle girlbibleprofessorterrorwitch doctor |
Period: | 1970syear 1967 |
Story: | riteseizurepotionceremonysoulboston massachusettsgoatscreamvoice overritualsnakeflashlighthallucinationtearscorpse β¦dreamexplosionfemale nuditymale nuditynuditysexbloodbased on novelmasturbationmale rear nuditydogpartyknifeshowercryingmaskpaintingmarijuanademonreference to jesus christsciencescientistsurvivalnew yorkcaliforniamountainsubwaysearchtransformationmicrophonetankuniversitypursuitisolationbasementfireworkssacrificeexperimenttraditionfireplacehypodermic needlejeepdrugtape recorderfaintingrecordingcomadiseaseelephantjail cellpatientwalkie talkiebuttockstimesheepschizophreniarealityindianguardface paintresearchspanishzoodelusionlaughterevidencevolcanoalternate realitytigernotecasual sextripsymbolismseparationplaying cardsenergyhysteriatruthmysticismkillbandagemetaphorhikingfreaklizardgorillax raysecurityhuntchangelsdlavasweatstonedmetamorphosisuniverseleukemiadnamushroomaudio cassettemonitorshockanthropologyconsciousnessapegeneticsmonumentcavemandeformityicongogglessmoking potdrug tripcustommindcustomssexual intercourserhinocerosexaminationsubconsciousmusclevisionsweirdoperceptionhumanoidcribchemicalreconstructionawarenessboiler roomfemale star appears nudeobservationreptilescavengerbackpackingmentalfurnacemagic mushroomelectric fencedimensiontechniciansleeping nudebaboonmachinerycarcasstoxicinstinctvoidpathologyraw meatblack outexperienceholyoriginsdeprivationdrug culturechartprimitivesensory deprivationimageryregressionatomsacredfrenzyindian tribemescalineexistencequantumape manmoleculespasmgraphpsychedelicsexpansionquest for knowledgegenesmattermetabolismradiologyimpulsereference to timothy learysensesbeating a dogcontractionisolation tankmind alterationpsilocybinsimianprimordialscreenwriter credited under pseudonym (See All) |
Though safely entombed in a crypt deep beneath the unforgiving desert, an ancient princess, whose destiny was unjustly taken from her, is awakened in our current day bringing with her malevolence grown over millennia, and terrors that defy human comprehension.
Subgenre: | martial artsblack comedysupernaturalparanormal phenomenadark fantasymonster movie |
Themes: | couragemagicsurrealismmurderdeathfriendshiprevengekidnappingbetrayalghostfearescapemonsterdeceptionmilitary β¦seductionangersupernatural powerparanoiaredemptionsurveillanceevilpanicself sacrificenear death experiencemurder of familyunlikely heroegyptian mythology (See All) |
Mood: | darknesshorror movie remake |
Locations: | cemeteryhelicopterchurchtrainforestairplanebusdesertlondon englandwoodspolice carrooftopmuseumlaboratorytunnel |
Characters: | police officerzombiedoctorpolicetattoosoldierpriesthostagethieftough guywarrioraction herosecurity guardprofessoramerican abroad β¦self mutilationbabe scientistamerican in the uk (See All) |
Period: | 2010s |
Story: | black magicchainedburied alivetorchskullspiderundeadmanipulationknocked outritualcoffinflashlightgood versus evilhallucinationpunched in the face β¦face slapcorpsedreampistolexplosionbare chested malebloodviolenceflashbackdogfemale rear nudityfightknifechasesurprise endingfireshootoutbeatingshot to deathblood splatterfistfightmachine gunhorsecar accidentshot in the chestremakeshotgunrescueslow motion scenebattlegunfightbrawlbare buttshowdownheld at gunpointbeerhand to hand combatsunglassescar crashcombatscientistshot in the backsubjective camerafoot chaseambushstrangulationaxemassacreambulancedeath of friendthroat slittingarmystabbed to deathmixed martial artsstabbed in the chestsubwayman with glassesno opening creditsanti herodisarming someoneone man armyassassinationdouble crossunderwater scenekingpolice officer killedfemme fatalenews reportshot in the legprincessdrowningtransformationflash forwardattempted murderpilotcursebinocularscharacter repeating someone else's dialoguebeaten to deathdangerprologuescreamingelectrocutionattackfantasy sequencecharacter's point of view camera shotproduct placementrace against timestatuecover uplightningopening action sceneskeletonscarinjectionlaptopratthreatened with a knifemercenarypubsubtitled scenebattlefieldpowerak 47pickup truckmissiledestinyhand grenadegrenadedestructionassassination attempthypodermic needlegothictape recordersecurity camerawalkie talkiemad scientisttreasuremorguesergeantkicked in the stomachvillainesspoolknightmind controlfateburialcolonelback from the deadiraqgun battleguardrampagecrime scenereverse footagemiddle eastvisiontarget practicebraveryu.s. armyconstruction sitefight to the deathpartnermercilessnesspower outageegyptstabbed in the neckresurrectionevacuationimmortalityescape attemptspecial forcesstabbed in the legpunched in the chestairplane crashaerial shotparachutewisecrack humorcapturebulletproof vestdemonic possessiontelekinesisdaggerstick fightmoral dilemmamedia coveragetelepathycrowclose up of eyestombsidekickliving deadalleyfinal showdowntasermummyconstruction workerpistol whiphuman monsterarmored carhuman sacrificeworld dominationdronecomic reliefsecret societymegalomaniacold flamesplit personalityfilm starts with textartifactpatricideman kills a womanoffscreen killingbitten in the neckmacguffinwoman kills a manaltered version of studio logoheirarcheologistopen endedalter egowoman fights a manimmortalmatricidesubterraneangodwoman slaps a manjewelcockney accentmind readingimprovised weaponcar rolloverancient egyptarmy basechosen onestupid victimrelicbilingualismdeal with the devilthronemad doctorsecret roomfratricidecryptinfanticideregenerationtragic villainwomen's bathroomarchaeologistdecomposing bodyenglishwoman abroadsecret organizationbig ben londonzero gravityman fights a womanair strikecorporalcollapsing buildingserumpharaohharpoonsandstormrebootfragments of glassmultiple personality disordertreasure hunterexcavationpharoahhit with a car doorburied treasuresecret laboratoryexplosive decompressionarcheological digevil godjekyll and hydelondon undergroundjackhammerrubyinsurgentflipping caryin and yanglondon eyeairplane pilotcargo planecatacombcrusaderlovecraftianreanimated corpsereboot of seriessoldier of fortunebookshelfgemstonesarcophagusmercurycontemporary settingrogue soldierfaustianhieroglyphicsegyptian godsecret lairlondon busheir to thronemilitary operationliterary charactersecret chamber1190sburial sitefemale archeologistdark universemonster hunter (See All) |
"Some people lose their faith because Heaven shows them too little," says Thomas Daggett. "But how many people lose their faith because Heaven showed them too much?" Daggett nearly became a priest; now he's a cop. He may want to put religion behind him, but one morning a weird, eyeless, hermaphrodit β¦ic corpse turns up. Suddenly he is on a path that will put him right in the middle of a war in Heaven. And once again, Heaven will show him too much: gore, blood, charred flesh, living corpses and much worse. Even more central to the heavenly war effort is a young girl. This American Indian child has something Gabriel wants. And Gabriel is willing to kill her and anyone in his path - or even reanimate a corpse or two - to get it. (Read More)
Subgenre: | cult filmindependent filmblack comedysuspensedark fantasychristian horrorreligious horror |
Themes: | funeralreligionsurrealismmurderdeathkidnappingbetrayaljealousyfearescapeinvestigationdeceptionpsychopathbrutalitysupernatural power β¦paranoiadepressioninsanitysadismevilhopepanicdyingapocalypsecannibalismhomelessnessdevilmurder of a police officernear death experienceghost townreligious conflict (See All) |
Mood: | neo noirarchive footagedarkness |
Locations: | police stationcemeterychurchhospitalschoolsmall townlos angeles californiadesertapartmentpolice carrooftopcatholic churchschool busschool teacher |
Characters: | native americanpolice officerzombiepoliceteachergirlsoldiernursedetectivepolicemanpriesthostagechristianlittle girlwaitress β¦christianitypolice detectiveteacher student relationshipbiblesheriffgrandmother granddaughter relationshipcatholic priesthomeless mancoronerdeath wish (See All) |
Period: | 1990s |
Story: | shamansoulskullundeadmanipulationknocked outpossessiongraveyardritualcoffinflashlightgood versus evilhallucinationpunched in the facecorpse β¦explosionphotographbloodviolenceflashbackgunkissfightcigarette smokingtitle spoken by characterknifesurprise endingfirevoice over narrationcryingbeatingshot to deathblood splatterfistfightcar accidentshot in the chestshot in the headrescuewritten by directorbrawlfalling from heightshowdownheld at gunpointsunglassesdead bodydemonhandcuffsprayerrevolvershot in the backsurvivalorphancaliforniaambulanceimpalementsuicide attemptdinerdisarming someonenarrationchild in perilhit by a carfictional wardouble crosspolice officer killedshot in the foreheadflash forwardattempted murdercharacter repeating someone else's dialoguedangerperson on fireliarfirst of seriesmissionangelrace against timestatuecover upevil manskeletonexploding bodyfirst partprofanitygrandmothernewspaper headlinekillinghenchmanpizzamaniacpickup truckburned aliveelectronic music scoregothicshot in the stomachsociopathscene during opening creditsmorguemind controlcolonelback from the deadcrime scenevisioncynicismcannibalmercilessnessresurrectionprophecyreference to satanbible quoteheavenhit on the headpunched in the chestjumping through a windowthrown through a windowautopsyaerial shotarizonachoirhealingeye gougingtribebody landing on a cardemonic possessionkilling spreeburned to deathexorcismnewspaper clippinglyingarrogancetelepathyclose up of eyesgothporn magazineliving deadlevitationfinal showdownhead woundsuper strengthworld dominationfilm projectormegalomaniactrailer homeburnt facedeputyburnt bodybadgemaggotsymbolheart ripped outmind readingmurder spreechosen onetheologyheart in handtrenchcoatlapdkorean warhide and seekwar criminalblasphemycrime spreegrave diggingchantingtauntingchild with a gungrand canyoncourt martialluciferinvulnerabilitysatanhermaphroditehealerabandoned carbloody mouthfilm reelabandoned minemisanthropethrown through a windshieldsevered facekiss on the foreheadhenchwomantire ironfallen angelmass deaththrown from heightcrisis of faithpyrokinesiskorean war veteranmale tearsindian reservationmisanthropysoul transferencegross outarchangelexploding trailerface burnhit with a tire ironancient bookshushingcopper minedriving through a wallholy warburning bodygas lampchristian godtirednessmintpersonification of satandark angelgifted childreligious riteburning corpseeating heartmortal woundvisions of heavenarchangel gabrielinitiation ceremony (See All) |
A young hospice worker helping care for an invalid who lives in a remote mansion in the Louisiana bayous finds herself caught in the middle of morbid happenings centered around a group of Hoodoo practitioners.
Subgenre: | suspense |
Themes: | magicdeathkidnappingmarriageghostfearpanic |
Mood: | nightmarerain |
Locations: | cemeteryhospitalbathtubnightclubelevatorkitchenwheelchairrooftopgas station |
Characters: | police officernursemusicianbabylawyerlittle girllittle boymaidfrenchwitch doctor |
Period: | 1920s |
Story: | black magicritepotionvoodoosuperstitiontorchoccultritualcandleflashlightcameradreamphotographdancingblood β¦flashbackfightpartyknifesurprise endingpantiescell phonecar accidentmirrorblondeshotgunsecretfalling from heightriverbound and gaggedold manstrangulationmaproommategunshotattempted murderkeyumbrellalightningringhangingdomestic violencecountrysideisolationloss of fatherstagetied uprecord playerropefalling down stairshypodermic needlegothicpatientservanthaircutthunderjob interviewnew orleans louisianaheadphonesrowboatswampatticrainstormmusic banddrugged drinkspellwifegardeningparalysisgatelouisianaelderlycanoelizardlaundromatno title at beginningponytailparamedichusbandstrokefall from heightbusiness cardnursing homenoosehouse partydumpstersymbolpigtailslynchinglockhatchetphonographsecret roomamerican southvolkswagen beetledustbedriddenphonograph recordshackstreetcarbayouspiked drinkinvalidpeacocksouthern gothicchalkbraidscandlelight dinnerhospicesoul transferenceincantationbedsheetvictim invited to dinnerconjurerwant addouble barrel shotgunparalyzedskeleton keyhoodoogumbo (See All) |
In the millenium version of this classic Gothic horror we find Abraham Van Helsing (Plummer), who has tangled with Count Dracula (Butler) in the past, working as an English antiques dealer. Simon (Miller) is a vampire hunter in training under his apprenticeship. Van Helsing and Simon travel from Lon β¦don to New Orleans to rescue Van Helsing's daughter Mary (Waddell) from the family's life long nemesis - Dracula. (Read More)
Subgenre: | cult filmmartial artscoming of ageblack comedysuspensesupernaturalheist |
Themes: | surrealismmurderdeathfriendshiprevengesuicidekidnappingbetrayalfearescapedeceptionseductionrobberydeath of fathersupernatural power β¦paranoiasurveillanceevilhome invasionpanic (See All) |
Mood: | nightmaregore |
Locations: | police stationairportcemeterychurchschoolairplanelondon englandtaxishiprooftopcatholic church |
Characters: | interracial relationshipdoctorfather daughter relationshippriesthostagethiefvampirewarriorchristianitysecurity guardbibleprofessorsecretarycatholiccatholic priest |
Period: | 2000s |
Story: | skullundeadmanipulationknocked outcoffincandleflashlightgood versus evildecapitationhallucinationpunched in the facecorpsedreampistolexplosion β¦photographbare chested malesexbloodcharacter name in titlenumber in titleviolenceflashbackgunfightpartyknifelesbian kisschasesurprise endingshot to deathblood splatterfistfightmirrorshot in the chestshotgunrescueslow motion sceneswordarrestbrawlfalling from heightpaintingshowdownheld at gunpointhand to hand combatbedinterrogationhandcuffsreference to jesus christshot in the backf wordsurvivalfoot chasebedroomambushold manstrangulationmassacredisguisedeath of friendthroat slittingimpalementstabbed to deathmixed martial artssuicide attemptstabbed in the chestmapsevered headdouble crosspolice officer killedsearchfemme fatalenews reporttransformationracial slurflash forwardattempted murderlibrarypilotcursestabbed in the backkeyperson on fireproduct placementrace against timeevil mankicked in the facecollege studentlightninghangingsensualityinjectioncrossneck breakingpremarital sexthreatened with a knifedirectorial debutsevered armstylized violencewerewolfropetraitordestinywolfburned aliverevelationhypodermic needlegothicscene during opening creditssecurity cameracrucifixstealingkicked in the stomachjumping from heightmind controlparking garagecarnivalback from the deadrampageinterracial romancereverse footageexplosivecrossbowburglarystabbed in the throathatredmercilessnessnew orleans louisianaresurrectionimmortalityhypnosismentorswamppunched in the chestjumping through a windowairplane crashbooby trapwisecrack humorstabbed in the eyefemale reporterkilling spreeburned to deathtelepathybullet timebatenglishman abroadimpersonating a police officernews reportertombgothlevitationcrucifixiondraculasuper strengthcomputer crackertelevision newsconfessionalstabbed in the armfemale vampirecameramancomputer hackergreenhousepolice interrogationone lineroffscreen killingcrashing through a windowbitten in the necksunrisewoman kills a manbody bagfilmed killingtwo way mirroropen endedwoman fights a manvaultdeath of title charactercockney accentmind readingtelevision reporterfingerprintstupid victimglowing eyesregenerationrecord storevampire slayermistmushroom cloudinvulnerabilitycoming out of retirementman fights a womanstakeblood transfusionweaponryneon signsunlightleechmardi grassilverstabbed in the heartout of body experienceantique dealerneongarden shearsestranged daughtervoice recording1790ssilver bulletbloodlustmaster apprentice relationshipfangreference to judasblood suckingvan helsingjourney shown on mapreference to judas iscariotturbulenceindestructibilitysexy female vampireretina scanantique gundeath of mentornude female silhouetteantique storeretina scan fakedreference to bram stokerancient vampirestabbed through the backzero gravity sex (See All) |
The Creeds have just moved to a new house in the countryside. Their house is perfect, except for two things: the semi-trailers that roar past on the narrow road, and the mysterious cemetery in the woods behind the house. The Creed's neighbours are reluctant to talk about the cemetery, and for good r β¦eason too. (Read More)
Subgenre: | cult filmtragedy |
Themes: | griefmagicfuneralmurderdeathsuicideghostangersupernatural powerdeath of motherdeath of wife |
Mood: | nightmaregorenightdarkness |
Locations: | airportcemeterychurchhospitalschoolcarairplanebathtubwoodsrural settingtrucknew england |
Characters: | zombiedoctorhusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipbrother sister relationshippriestlittle girllittle boysuicide by hangingfather in law son in law relationshipdeath of boy |
Period: | 1980s |
Story: | grave robbingairlinercoffinflashlighttearswatching tvpunched in the facecorpsedreamexplosionphotographbloodbased on novelviolenceflashback β¦dogsurprise endingfiretitle directed by femalerescuecatsecretbedbathroomneighbortelephoneold mandeath of friendwomanweaponchildpantyhosepainconfessiongraveperson on firehangingdeath of brotherautomobiledeath of sonloss of fatherloss of motherarsonmoonfemale stockinged legsburned alivegothicinjurylifting someone into the airhatloss of friendtoyhidingloss of wifedead womanback from the deadhitchhikingcamera shot of feetpromiseloss of sonpet dogresurrectionshovelpsychotronicdead childdeath of sisterdead mandead boydead motherloss of brotherflat tirefemale stockinged feetpetdead animalsenior citizenfoot closeupscalpelhit by a truckhead injuryloss of childkitenooseloss of sisterkiller childmurder of wifeorchestral music scorehiding under a bedintentionally misspelled titledead catdead wifeanguishmainesuicide noteswinginghouse firepet catdeath of loverglowing eyesevil childscreenplay adapted by authorpick axepathclothes linedeath of parentloss of lovervisionsemaciationdeath of petlifting a female into the airconvulsionhanged womanauthor cameobased on the works of stephen kingdead sonkilling a catchild in dangerkite flyingdead ratlifting a male into the airson murders motherburial groundmusic score features pianoloss of petloss of parentatonal music scorecobwebtractor trailerwendigobumper stickerdeath of catsymphonic music scoredead loverevil cattree swingdeath of grandsondeath of womanmurder of lovercat attackdead parentdeath of patientpet cemeteryraking leaveschelsea smiledeath of relativetire swingelongated cry of nodeath of neighborindian burial groundlifting a boy into the aircat hissinglifting a child into the airdead petunholy resurrectionfeeding a catmurder of neighborcat scratchlifting a girl into the airloss of relativescratched by a catzombie cat (See All) |
The church has long known that vampires exist. However, it is discovered that a group of vampires are searching for a powerful doom for mankind. The Vatican then secretly enlists a team of vampire-hunters, led by Jack Crow, to hunt down and destroy the vampires before they find the crucifix.
Subgenre: | cult filmmartial artsblack comedychristian horror |
Themes: | torturemurderdeathrevengekidnappingbetrayalprisonfeardrunkennessdeceptionvoyeurismangersupernatural powerpanicvengeance β¦murder of a police officerghost town (See All) |
Mood: | gore |
Locations: | churchbartrainhotelsmall towndesertelevatormotelgas stationcampfirenew mexico |
Characters: | police officerprostitutepriesthostagetough guyvampireaction heroevil priest |
Period: | 1990s |
Story: | riteceremonyskullundeadcult directorknocked outscreamritualgood versus evildecapitationpunched in the faceface slapcorpsepistolexplosion β¦photographfemale nuditynuditybloodbased on novelviolenceone word titlebare breastsfemale frontal nudityfemale rear nuditycigarette smokingtitle spoken by characterpartyknifechasefiretopless female nuditybeatingshot to deathblood splattermachine guncar accidentshot in the chesturinationblondeshotgunrescueslow motion sceneshowdownheld at gunpointcar crashinterrogationprostitutionvoyeurprayerrevolvershot in the backsubjective cameracleavagegay slurbound and gaggedaxemassacreambulancethroat slittingimpalementstabbed to deathmixed martial artssuicide attemptstabbed in the chestmapsevered headanti heroscantily clad femalesearchnews reportcigar smokingshot in the legtransformationshot in the foreheadpaingunshotlegendbinocularscharacter repeating someone else's dialoguestabbed in the backperson on firemini skirtpay phonecharacter's point of view camera shotmissionlightningshot in the shoulderpursuitcrossexploding bodyneck breakingtied upmercenaryshot in the armpickup truckmachismowolfburned aliveno pantiesspearfarcemass murderjeepinjuryscene during opening creditsmutilationtied to a bedsecurity cameracrucifixhammerexploding buildingbuttocksphone boothsevered handeaten alivewatching televisionduct tape over mouthvisionthundercrossbowteamshot in the facehungershovelimmortalitycigarette lighterthrown through a windowslaughtergasolinelens flareburned to deathexorcismtelepathytorso cut in halfstolen carsunsetcrucifixiongatebandagespit in the faceold dark housesuper strengthnudedisposing of a dead bodyfemale vampiregunslingernude girlbellsawed off shotgunlatinbitten in the neckman punching a womansunrisewindmillcarjackingiconvampire huntermind readingreliccamera focus on female buttvampire slayerfalling through the floorthroat rippingblood drinkingsuper speedsliced in twocardinal the priestnestarmored truckbitten on the armhand through chestmusic score composed by directorcablesteakstabbed in the heartburnt handstabbed in the foreheadover the topvampire bitevampire human lovemurdered priestcorrupt priestwooden stakebitten on the legpetrolvampire human relationshipfrenzysexy female vampirecauterizationmaster vampirenude woman tied uppadrerear end (See All) |
A Christlike figure wanders through bizarre, grotesque scenarios filled with religious and sacrilegious imagery. He meets a mystical guide who introduces him to seven wealthy and powerful people, each representing a planet in the Solar system. These seven, along with the protagonist, the guide and t β¦he guide's assistant, divest themselves of their worldly goods and form a group of nine who will seek the Holy Mountain, in order to displace the gods who live there and become immortal. (Read More)
Subgenre: | cult filmexperimental filmabsurdismabsurd comedycult classic |
Themes: | revolutionreligionsurrealismdeathdrugsmoneylesbianismdrinkingfeardrunkennessdancetheftbrutalitydrug usepoetry β¦executiongreedblindness (See All) |
Mood: | goresatireavant gardebreaking the fourth wall |
Locations: | cemeteryhelicopterbarsnowboatbathtubbuswheelchairshipmexicotunnelsex in car |
Characters: | husband wife relationshiphomosexualfather son relationshippolicemother son relationshipchildrentattooprostitutesoldieraliendancerbabypriestthiefreference to god β¦christianityhomosexualityjewsecretarycatholicwriter directordeafnessactor director writerreligious iconreligious statueself delusionsex robot (See All) |
Story: | jaguartarantulariteceremonydrummergoatskullspideroccultgraveyardritualcoffinsnakecameracomputer β¦corpseexplosiondancingfemale nuditymale nuditybare chested malenuditysexbloodviolencebare breaststhreesomefemale frontal nuditymale frontal nuditymasturbationmale rear nuditydoggunkissfightfemale full frontal nuditymale full frontal nuditypartyknifethree word titlefirevoice over narrationlickingbeatingtesticlesfoodhorsemirrorurinationshotgundrinkswordundressingbare buttmaskshootingvomitingriflebombbedmarijuanabathroompianodemonislandreference to jesus christmale pubic hairguitaralcoholstripperold manaxemassacremountaincocainetoiletfemale pubic hairweaponnunbirdfictional wargarter beltjourneycigar smokingdrowningtransformationpublic nuditylimousinetreeclownspiritualitystripteasefactorywritten and directed by cast membermassagestatuedirected by starbodyguardpresidentcrossgovernmentrock 'n' rollhorse ridingpigchickensevered armflowerpoetwhippingdismembermentfull frontal nuditytransvestitecircusgoldgrenadenipples visible through clothingwarehouseballoonlooking at oneself in a mirrorcakequesttouristarchitecturecomic bookhelmetelephantmagicianmousecrucifixdemonstrationtoyplanetbarefoot malefrogproduced by directorfemale warriorgas maskguarddwarfabsurd humorpillshippieimmortalityrowboatscissorssculpturedead childbathingmeditationfascismtigercanecastrationbarefoot femaleexistentialismsevered legchaintripwritten by starsymbolismmannequinteleportationchauffeurcamelmale objectificationearphonescandycrucifixionjudaismapparitionmysticismmummyfountaindead animalmusclemantowercrutchesvery little dialoguefemale genitaliaamputeebroken mirrordrumseagullgoldfishlsdtaking a bathnihilismfactory workercellobayonetfinger cut offmushroommanuscriptperuchimpanzeefeatherrainbowsitting on a toiletpolygamydance scenedead birdknittingfiring squadsurrendertoy gundogfightenlightenmentmattresspsychotronic filmaltardicephobiagurumountain climbingbanquetbreaking a mirrorcasketmars the planetthronedovevulturepilgrimageblasphemybody paintbuddhaloinclothmodern arttoadinitiationexcrementgold cointarotlambtumorsolar systemsanta claus suitcrossing selfzenhermaphroditehand kissingcadaverprocessionray gunanimal sexmarchingalchemybiblical referencegreen hairmohawk haircutcarrying someoneeunuchfalconleg bracegas chamberhippopotamusstrong sexual contentburning moneymidnight movieman dancing with manglass eyepsychedeliapythongeeseproduced by actorlaxativehair dyeice sculptureroman soldierstarfishmale bare butthead shavingpelicanseven deadly sinschameleoninvented languagemarketplacestoningalchemistmayanoverweight manchrist figurechief of policeslideshowmagic actwashing someonejupiter the planetspiritual journeywashing feetlima perusex in limousinemenorahsaturn the planetprosthetic body partbook of the deadhall of mirrorsoxboa constrictorlederhosencracked mirrorpeg legtoy factoryperuviantoy horsechamber potvenus the planetgold nuggetmale star appears nudepluto the planetexplicit nuditymale secretarynothingnessfan dancerpantheonfrontal nudityexotic animalneptune the planetwashing someone's feetmultiple amputeeuranus the planetman in a bathtubmating animalsmouse costumebreathing tubeglyphlever action rifle (See All) |
In New York, the owner of a sophisticated antique shop Russell Edwin Nash is challenged to a sword fight in the parking lot of the Madison Square Garden by a man called Iman Fasil that is beheaded by Russell. He hides his sword and is arrested by the police while leaving the stadium. Russell recalls β¦ his life in the Sixteenth Century in Scotland, when he is Connor MacLeod and is deadly wounded in a battle against another Clan. However he surprisingly survives and his Clan believes he has a pact with the devil and expels him from their lands. Then he meets Juan Sanchez Villa-Lobos Ramirez that explains that he is immortal unless he is beheaded. Further, the immortals dispute a game killing each other and in the end only one survives receiving a price with the power of the other immortals. Russell is released by the police, but the snoopy forensic agent Brenda J. Wyatt is attracted by the case since she founds fragments of an ancient Katana and follows Russell. But the also immortal Kurgan is hunting down MacLeod and Brenda is in the middle of their battle. (Read More)
Subgenre: | cult filmmartial artsdark comedysword and sorcerydark fantasysword and fantasy |
Themes: | magictorturemurderdeathlovefriendshipkidnappingrapeheroinvestigationmemorysupernatural powerwrestling |
Mood: | gorerain |
Locations: | police stationvillagehelicopterchurchbeachbarhospitalnew york cityforesthotelsnowboatwoodspolice carlake β¦castleamerica (See All) |
Characters: | police arrestpolice officerpoliceboyfriend girlfriend relationshipprostitutedetectivephotographertough guywarrioraction herolittle girlpolice detectiveteacher student relationshipgerman β¦american (See All) |
Period: | 1980sworld war two1940s16th century1500s |
Story: | superstitionscreamcandleflashlightgood versus evildecapitationtearscamerawatching tvcomputerpunched in the facecorpsephotographsexnudity β¦bloodviolenceone word titleflashbackkisstitle spoken by charactersingingcryingbeatingfistfightmachine gunhorseblondebattleswordbrawlmaskshootingpaintingshowdownheld at gunpointrunningrock musicinterrogationhandcuffsrevolvermanhattan new york citycombatreportergay slursword fightstabbingbridgearmymixed martial artsweaponfishnunanimaldisarming someoneone man armypart of seriesfictional warbartendertrainingduelelectrocutionbuxomevil manlightningtankopening action scenefirst partkissing while having sexpubnewspaper headlinebattlefieldpoweruzientertainmentdestructionwoundgothictape recordercomic bookhelmetloss of loved onebuttockstimeaudienceknightparking garagehonorpromiseshieldthunderkatana swordold agescotlandzoopsychotronicimmortalityrowboatmentoraquariumdark herolionevidencetribesword dueltragic herobonfirereckless drivingdaggerwrestlershaved headrefereeparking lotshowpetenergyswordsmansunsethistorical fictionkatanaalleykendotelling someone to shut upfortressfencinglatinarenakindnesspressaudio cassettemonitorsword fightinghead cut offdocumentmicroscopefemale coprepeated lineboxing ringimmortaladopted daughterantiquehorse and wagoniconbagpipesvalleymortalitychrysler building manhattan new york citymentor protege relationshipex marinescottishflintlock pistolsexual intercoursebanishmentbattle axewrestling matchmetropolisspectatorforceannouncerkiltprocessionwrestling ringrudenessbannerpracticeclanover the topgeeseelknewsstandalley fighthorsebackreference to mozartrapierhorseshoesiren the alarmlong swordhighlandscitadeloxenhighlandercar collisionstone bridge1530scentury1540s (See All) |
A large spider from the jungles of South America is accidently transported in a crate with a dead body to America where it mates with a local spider. Soon after, the residents of a small California town disappear as the result of spider bites from the deadly spider offspring. It's up to a couple of β¦doctors with the help of an insect exterminator to annihilate these eight legged freaks before they take over the entire town. (Read More)
Subgenre: | cult filmindependent filmsuspensecreature feature |
Themes: | couragefuneraldeathfearinvestigationparanoiapanicnear death experienceunlikely hero |
Locations: | junglecemeteryhelicoptersmall townrural settingpolice carsan francisco californiarain forest |
Characters: | native americanpolice officerdoctorhusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboybrother sister relationshipphotographerlittle girllittle boyprofessorsheriff β¦coroner (See All) |
Story: | toxinspiderpoisoncoffincameraunderwearcorpseone word titledogpartysurprise endingshowerfirecatundressing β¦showdownneighborriverscientistsubjective camerasurvivalwineimpalementtoiletfalse accusationbirdtrainingdangerlocker roomrace against timetentgymdeath of husbandsuspiciondirectorial debutwaterfallheart attackrecord playercoachburned alivekilling an animalbarnmorgueamerican footballeccentricculture clashanimal attackearthquakewatching televisionbraveryboxer shortsmedical examinationautopsydead boycellarburned to deathsirensouthern accentenglishman abroadexpeditionhomagebugundertakerpopcornfish tankstretcherassistanthearsemotorboatsouth americamicroscopedead birdguidestupid victimmortuarypet cattreadmillvenezuelatoy carmorticianfalling through the flooranimal in cast creditsfootball coachcanteencricketphonograph recordnail gunnestexhumationwine cellarblowtorchexterminatorgarden partypesticideequipmentencampmentdumb policeinfestationcocoonsinkholespiderwebremote controlled toy cararachnophobiaspecimenspider bitehuman versus spiderspider featurejungle expeditionkilling a bug (See All) |
Michael, the son of a funeral director grows indifferent to his father and joins a Seminary. On his way to the course completion, he is overwhelmed by a strong lack of faith. His religious beliefs are further jolted when he sees a young girl haplessly dying in a road accident for whom he reluctantly β¦ performs the ritual to absolve her sins. His mentor still believes in him and urges him to go to Italy to take an exorcism course hoping that he it would strengthen his faith in Christianity. In Italy he attends a session from Father Xavier who soon becomes aware of his skepticism. As a result he sends him to an eminent Jesuit exorcist, Father Lucas, whose ways though questionable are quite effective. He witnesses the exorcism of a sixteen year old girl but still seems unconvinced. Father Lucas explains to him that it takes multiple sessions over a long stretch of time to completely free a victim from the demon. Despite witnessing some supernatural occurrences during the aforesaid exorcism, Michael is as skeptical as ever. After the second exorcism, the girls condition becomes quite critical as she is moved to a hospital. She soon dies and the demon finds a new victim. As the moment of reckoning draws near, Micheal may be the only hope left but first he must overcome his own doubts and apprehensions in order to fight and destroy the ominous forces. (Read More)
Themes: | grieffuneralreligiondeathsuicidepregnancyinvestigationincestdeath of fatherdeath of motherfaith |
Mood: | nightmare |
Locations: | cemeterychurchbarhospitalreligious school |
Characters: | police officerdoctorfather son relationshiptattooteenage girlstudentdetectivepriestwaitresslittle boyamerican abroadself discoveryreligious icon |
Story: | riteritualcoffincandlehallucinationtearswatching tvcorpsebased on bookphotographbloodflashbacktwo word titletitle spoken by characterurination β¦secretlettercafedemonprayerjournalistambulancenunhit by a carconfessiongravegymchildbirthshavingspiritrome italycrucifixpsychologyplaygrounddemonic possessionexorcismmiscarriageviolinistlaptop computervideo tapesubtitlesbicyclingtraffic jamhearing voicescatholicismstrokepunching bagfuneral homelimphorse and wagonvaticanholy waterchurch serviceworking outslide showtoadexorcistmorticianloss of faithwalking caneclergyroman catholicvowvatican cityseminaryabsolutionnewcomerhit by a vansacred objectcolosseum rome (See All) |
Folklore collectors and con artists, Jake and Will Grimm, travel from village to village pretending to protect townsfolk from enchanted creatures and performing exorcisms. They are put to the test, however, when they encounter a real magical curse in a haunted forest with real magical beings, requir β¦ing genuine courage. (Read More)
Subgenre: | cult filmblack comedysupernaturalfairy taleslapstick comedydark fantasy |
Themes: | couragemagictorturesurrealismmurderdeathrevengekidnappingmoneybetrayalghostprisondrinkingfeardrunkenness β¦escapemonsterdeceptionmilitarynaturedeath of fathersupernatural powerparanoiayouthsadismdyingself sacrificemythologymissing childunlikely hero (See All) |
Mood: | nightmarerain |
Locations: | villagecemeterychurchforestsnowsmall townwoodscastlecavegermany |
Characters: | mother son relationshipfather daughter relationshipfriendbrother brother relationshipboyprostitutegirlsoldierdanceractorpriesthostagesister sister relationshiplove trianglewarrior β¦witchmayorfrench soldier (See All) |
Period: | 19th century1810s |
Story: | goattorchpossessionritualsnakecandledecapitationhallucinationunderwearcorpsepistolexplosiondancingbloodcharacter name in title β¦violenceflashbackdoggunkissfighttitle spoken by characterknifethree word titlefirefoodhorsemirrorshot in the chestshot in the headrescuecatdrinkbattleswordarrestfalling from heightbookriflerunningbedinterrogationshot in the backbound and gaggedwineold manaxestabbingwomaneatingarmystabbed to deathprisonerstabbed in the chestweaponmapsevered headman with glassestrialanti heroanimaldrawingchild in perildouble crosskingcreaturefemme fataletransformationgunshotflash forwardattempted murdergravetreecursestabbed in the backprologuestorytellingrace against timerabbittough girlwigcrosswitnesspighauntingrattied upsevered armgeneralfireworksqueencowtrustwerewolfitalianropewolfbow and arrowmedicineflyingwoundgothiccagelifting someone into the airhatbarnfraudstreet lifeback from the deadapplecannonfemale warriorfull moonguardreverse footagecrossbowresurrectioninsectstairscon artistdungeonshadowarmorsnowinglanternhorse and carriagelaughingsevered legdaggerexorcismpalacecrowhorseback ridingspelltombshowflagmagic trickharbortablefolklorehairtowerbeggarhuman sacrificeplagueselfishnessanimal crueltycrownwelltheatre productiontavernfantasy worldstablevanityhamburg germanymaggotraveninnpitchforkfrenchmansorceressbegginghorse and wagonsnailguidepentagramgrim reaperbanquetliquidpitthronehatchetholy waterwoman in dangervillain turns goodgoosesittingtoadeclipsedecomposing bodytorture chamberinquisitionhand kissingcrutchfrench armycandelabratrackercatapultbook burningroyal weddingdobermanburned at the stakereference to cinderellaone legged manevil queenaccentblobcanonwolfmanrocking horse1790seternal youthrotting corpsela marseillaisereference to little red riding hoodturretbird attackfrankfurt germanyhayloftcobwebgingerbread mananimate treeenchantmenttrapperchild eatendeath of kinglong underwearreference to sleeping beautybrought back to lifereference to hansel and gretelhaunted forestwater wheelgrimm's fairy talesgingerbreadwater millman wearing woman's clothingchalicedragged by horsefemale stuck in sticky substancegingerbread housescrubbing floorspinning axeforeign occupationreference to jack and the beanstalkbody torn in halfhanging from heightreference to rapunzel (See All) |
When a younger girl called Emily Rose dies, everyone puts blame on the exorcism which was performed on her by Father Moore prior to her death. The priest is arrested on suspicion of murder. The trail begins with lawyer Erin Bruner representing Moore, but it is not going to be easy, as no one wants t β¦o believe what Father Moore says is true. (Read More)
Subgenre: | christian horror |
Themes: | religionmurderdeathdrinkingdrunkennessinvestigationsupernatural powerillnessmental illnessfaitheviltraumastarvationthe devil |
Mood: | nightmarerain |
Locations: | churchbarhospitalrestaurantsnowrural settingfarmcourtroom |
Characters: | anthropologistdoctorfamily relationshipsfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipteenage girlfemale protagonistpolicemandancerpriestlawyer β¦christianchristianitybiblecatholicreligious statue (See All) |
Story: | riteseizureoccultpossessiongraveyardritualsnakegood versus evilhallucinationwatching tvbased on true storyphotographdancingcharacter name in titleflashback β¦title spoken by characterknifesurprise endingtelephone callhorsecar accidentcatdrinklettercafecollegepianodemonreference to jesus christprayersciencehalloweenstabbingjudgetrialhit by a cargravescreamingpay phoneumbrelladolllightningcourtpianistcrosswitnesssubtitled scenetv newsspiritinjurytape recordertied to a bedjail cellcrucifixpsychologypsychologistschizophreniaclockdebatethunderministerstabbed in the neckbroken glassreference to satanvoice over letterdemonic possessionpsychoticexorcismreflectiondormitorytestimonytombstonefarmhousejurytape recordinghearing voicesinsane asylumcatholicismcornfieldtavernpsychiatrycoincidencestableprosecutorscholarshipanthropologychapelanorexiaspoondetentionreference to the virgin maryschizophrenicmolestationepilepsylocketpsychosisholy watermartinispiritualismburningwomen's bathroomlaw firmforkmoral ambiguitytv cameradorm roomelectroshock therapyverdictsnorricammysticserpenttrick or treatreligion versus sciencefalling out a windowthrown through a windshieldexpertomenmedical examinercrisis of consciencemalnutritiontranquilizerneurologycatatoniafly the insectstigmataneurologistagnosticbarbed wire fencespeaking in tonguesmethodistepitaphreference to neroeating an insectabnormal psychologyhypersensitivityvocal cordsaramaicinitialsreference to belialarchdioceseunseen forcewitching hour (See All) |
In "House of 1000 Corpses", two young couples take a misguided tour onto the back roads of America in search of a local legend known as Dr. Satan. Lost and stranded, they are set upon by a bizarre family of psychotics. Murder, cannibalism and satanic rituals are just a few of the 1000+ horrors that β¦await. (Read More)
Subgenre: | cult filmindependent filmdark comedyslasher flickcreature featuresadistic horror |
Themes: | funeraltorturesurrealismmurderdeathkidnappingrapejealousyfearmonsterseductiontheftdeath of fatherinsanitymental illness β¦sadismtheatrecannibalismmadnessmurder of a police officer (See All) |
Mood: | nightmaregorerainslasher |
Locations: | cemeterypolice carroad tripcavegas stationmuseumtunnelshedcave in |
Characters: | family relationshipsfather son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoobrother sister relationshipserial killerthiefsheriffslasher killerpolice lieutenantevil doctor |
Period: | 1970syear 1977 |
Story: | buried aliveskullcult directorgraveyardritualcoffinhallucinationwatching tvcorpsedreampistolphotographdancingbare chested maleblood β¦number in titleviolenceflashbackknifechasesurprise endingfirebeatingdigit in titleshot to deathblood splattercar accidentshot in the headshotgunslow motion scenethongmaskrifleheld at gunpointrevolvershot in the backsubjective camerahalloweenbound and gaggedaxestabbed to deathstabbed in the chesthousetied to a chairmapsevered headman with glassesshot in the foreheadgravecharacter repeating someone else's dialogueperson on firecharacter's point of view camera shotactor playing multiple rolesmissing personevil manlightningskeletonhanginghalloween costumelong takedisappearancecheerleadercrosssplit screenpigtied upcharacter says i love youthreatened with a knifemaniacpoemtv newsundergroundmass murdertape recorderlifting someone into the airtied to a bedcaptivewalkie talkiegiantphone boothflatulencepsychosevered handhome movierapistcommercialhitchhikercrushed to deathmasked mangas maskduct tape over mouthnicknameface paintgash in the faceshot in the facenewsreel footagemental hospitalbody landing on a carknife throwingraised middle fingerlanterndead woman with eyes openpsychoticmannequintorso cut in halfhit with a baseball batintestinesmadmanneedleshot in the neckold dark houseurban legendhuman monsterfreakmental retardationnight visionbillboardpsychedelicbody in a trunkdeputyauto mechanicdeath of boyfriendsleeping in a carburnt bodytow truckneck bracereference to john waynebreaking through a doorburn victimghoulevil clownpitattempted robberyjack o'lanternspotlightradio djdepravitycandlelightliquor storeknife in the chesthidden gunserial rapistno survivorstv hostcult figurekiller clownhand cut offfemale serial killerreference to mickey mousetrick or treatsatanic ritualbreaking a car windowmusic score composed by directorscalpingsevered facemissing person posterbroken windshieldreference to charles mansonclown makeupdumb criminalhiding in a carclown facefried chickendrinking and drivingrabbit costumetourist attractionstocking capstraight edge razorfunhousevictim invited to dinnerreference to donald duckroadside attractionfetus in a jarmounted animal headreference to jayne mansfieldshooting out tirehead bracereference to nancy drewreference to ed geinreverse negativedunce cap (See All) |
Truck driver Jack Burton arrives in Chinatown, San Francisco, and goes to the airport with his Chinese friend Wang Chi to welcome his green-eyed fiancee Miao Yin who is arriving from China. However she is kidnapped on the arrival by a Chinese street gang and Jack and Wang chase the group. Soon they β¦learn that the powerful evil sorcerer called David Lo Pan, who has been cursed more than two thousand years ago to exist without physical body, needs to marry a woman with green eyes to retrieve his physical body and Miao is the chosen one. Jack and Wang team-up with the lawyer Gracie Law, the bus driver and sorcerer apprentice Egg Shen and their friends and embark in a great adventure in the underground of Chinatown, where they face a world of magicians and magic, monsters and martial arts fighters. (Read More)
Subgenre: | cult filmmartial artssupernaturalslapstick comedy |
Themes: | magiclovefriendshipkidnappingescapeweddingmonsterinvestigationsupernatural powergamblingsurveillanceevilmythology |
Mood: | spoof |
Locations: | airportmotorcyclebuselevatorwheelchairpolice cartruckbrothelsan francisco californiatunnelsewer |
Characters: | prostitutesecurity guardasian americanchineseuncle nephew relationshiptruck driverchinese americanself awareness |
Period: | 1980s |
Story: | black magicairlinerritepotionceremonyknocked outscreamfive word titleritualcoffincameraexplosionbloodknifechase β¦surprise endingpantiesshootoutmachine gunshotgunrescuebattleswordgunfightbrawlshowdownhand to hand combatplace name in titleprayerrevolvercombatkung fureporterswimmingbound and gaggedsword fightdisguisemixed martial artsanti herodisarming someonegarter beltcreaturepantyhosegunshotduellegendcurseumbrellarace against timelightningskeletonexploding bodytrapratunderwatermercenarylove interestsacrificeundergrounddestinyspiritcountry name in titlewarehouseelectronic music scorelifting someone into the airtied to a bedmagiciancaptiveculture clashbridecamera shot of feetwoman in jeopardyreverse footagecrossbowrainstormknife throwingfemale reportermahjongstick fighthogtiedfemale stockinged feetfianceevideo surveillancelevitationalleynotebookstreet gangblindfoldedbottletelevision newswellfemale lawyerfoot closeupsorcererinfatuationtoastunsubtitled foreign languageman punching a womanmeat cleaverimmortalsubterraneansorcerygolden gate bridgechinatownwhite dresstour bustrancebuddhafemale journalistlifting female in aircustomsbigamyturbanbalisongwhorehousefire enginemagical potionmusic score composed by directorbordellosex slaverygang warfarenylonsstabbed in the foreheadmulletsleeping womansiren the alarmcb radiotractor trailersword throwingnegative asian stereotypeentrancereference to dirty harrygreen eyeshaving picture takenkukri daggerfuneral marchmartial arts gymnasticssleeping gastong (See All) |
A new girl moves to a new city with her family to start a new life. She meets up with the girls who are very interested in the occult and together, the four of them have a seemingly unstopable power. They can do anything, from getting thier dream guys to like them to... the possibilities are limitle β¦ss. (Read More)
Subgenre: | cult filmcoming of ageblack comedyteen movie |
Themes: | magicsurrealismmurderfriendshiprevengesuicidedeceptionracismsupernatural powerinsanitybook of magic |
Mood: | nightmarehigh school |
Locations: | airportchurchbeachswimming poolairplanelos angeles californiabustaxiwoodslaboratory |
Characters: | father daughter relationshipteenagerfemale protagonistlawyerbest friendbullywitchself mutilationsingle fatherhomeless manstepmother stepdaughter relationshipevil witch |
Period: | 1990s |
Story: | black magicoccultsnakecandlehallucinationdreamexplosionphotographflashbackpartyknifeshowerfiremirror β¦mansionhit by a carnews reportracial slurspiritualitylightningattempted rapehigh school studentdeath of husbandheart attackfemale stockinged legsteen angstheavy rainoverallswitchcraftmental institutionvisionfemale leadbutterflytelekinesisfemale stockinged feetspellgothlevitationoutcastfemale bondingjukeboxbully comeuppancesatanismwrist slittingcrashing through a windowjockkarmamaggotgoth girlpower strugglewish fulfillmentcliquesockscovenlife insurancehair lossslandervirtualitymirror does not reflect realityreference to pubic hairteenage witchhereditary gift of witchcraftfrench languageprep schoolmirror as portalwhite socksdriven madluxury apartmentlove spellfemale feet in socksinjection in buttwhite magic (See All) |
A sinister secret has been kept in the basement of an abandoned Los Angeles church for many years. With the death of a priest belonging to a mysterious sect, another priest opens the door to the basement and discovers a vat containing a green liquid. The priest contacts a group of physics graduate s β¦tudents to investigate it. Unfortunately, they discover that the liquid contains the essence of Satan himself, and they also discover that he will release HIS father - an all-powerful Anti-God! The liquid later comes to life itself, turning some of the students into zombies as the Devil comes forward to release his father. Will these students be able to stop him? (Read More)
Subgenre: | cult filmblack comedysuspensesupernaturalsupernatural horrorchristian horror |
Themes: | religionsurrealismmurderdeathsuicidepregnancyfearescapedeceptionsupernatural powerparanoiafaithunrequited loveapocalypsephilosophy β¦self sacrificedevilnear death experiencescience versus supernatural (See All) |
Mood: | nightmareambiguous ending |
Locations: | churchlos angeles californiapolice carcatholic church |
Characters: | zombiedoctorfather son relationshipafrican americanboyfriend girlfriend relationshipstudentpriestbibleprofessorcatholicasian americanself mutilationcatholic priestengineerhomeless man β¦babe scientistreligious icon (See All) |
Period: | 1980s1990s |
Story: | occultundeadcult directorpossessioncandleflashlightgood versus evildecapitationcomputerpunched in the facecorpsedreambare chested malebloodfight β¦cigarette smokingsingingknifechasethree word titlesurprise endingbeatingblood splatterfistfightmirrorrescuebrawlsecretfalling from heightcollegedemonclassroomsciencescientistsurvivalaxeambulancethroat slittingimpalementstabbed to deathstabbed in the chestsevered headnundream sequencenews reporttransformationracial slurlimousinestabbed in the backkeypay phonerace against timecover upcollege studentlightningdiarydisappearancedeath of sonbasementneck breakingpremarital sexsevered armtypewriterdismembermentpizzacard gameelectronic music scorelooking at oneself in a mirrorcrucifixkicked in the stomachsevered handmind controlend of the worldfull moonwatching televisioncrime scenevisionblood on facestabbed in the throatpower outagegash in the faceinsecttitle appears in writingescape attemptreference to satanthrown through a windowdisfigurementsiegestabbed in the eyelooking at self in mirrordemonic possessionsevered legbruiseethnic slurtelekinesisplaying cardstranslatorliving deadcartoon on tvhiding in a closethit in the facedefecationcomputer crackerportalbugcomic reliefsecret societybroken mirrorinsomniainterracial kisslatinwormantphysicsstabbed in the shouldertitle in titlemaggotparasitehomeless persondead birdsymbolarm cut offhoboimprovised weaponbreaking through a dooralternate dimensionsectliquidantichristclimbing out a windowsocial decayregenerationstabbed with scissorsbeetlecard trickphysicisttranslationinvulnerabilitygraduate studenthomeless womantelling a jokequantum physicsmusic score composed by directorentrapmentsubliminal messagebroadcastevil godstabbed through the chestvagrantrecurring dreamabandoned churchdream within a dreampessimismtrapped in a buildingcontainerastral projectionshared dreamlovecraftianclaustrophobicreanimated corpsesupernovabreaking through a wallunicyclehit with a brickchinese takeoutuniversity campustheoretical physicsmarkresearch scientistcylinderyawntachyonradiologistscience vs religiondefying gravity (See All) |
It hasn't even been a year since a plantation owner named Louis lost his wife in childbirth. Both his wife and the infant died, and now he has lost his will to live. A vampire named Lestat takes a liking to Louis and offers him the chance to become a creature of the night: a vampire. Louis accepts, β¦and Lestat drains Louis' mortal blood and then replaces it with his own, turning Louis into a vampire. Louis must learn from Lestat the ways of the vampire. (Read More)
Subgenre: | cult filmblack comedylgbt horror |
Themes: | murderdeathrevengebetrayalfearescapeangersupernatural powerguilttheatremurder of family |
Mood: | gorerainnightdarkness |
Locations: | cemeteryhelicoptercarparis francewaterpolice carfrancesan francisco californiaamerica |
Characters: | father daughter relationshipboyprostituteactorartistvampirelittle girlamericanamerican abroadvampire girlsame sex parents |
Period: | 19th century20th century18th century1870s |
Story: | ritevoodootorchundeadcostumeritualcoffincandlegood versus evildecapitationcorpsepistoldancingbloodnudity β¦based on novelviolenceinterviewsingingsurprise endingfirevoice over narrationcryinghorsemirrorrescuemaskrunningbeddead bodypianoorphanweaponanimaltreelibrarydangerscreamingcharacter's point of view camera shotdollpianistautomobileneck breakingratcinemachild murderdestinydressgothicslow motiontape recorderlifting someone into the airhatslaverywatching a moviebuttocksblockbusteraudienceslavenew orleans louisianaimmortalitytheatre audiencestairsswampdark herosundead childshadowhomoeroticismhorse and carriagelaughingplaying cardsreflectionvictorian erastage showyellingtablelouisianaglovesplaguefemale vampirechandelieraudio cassetteteethgolden gate bridgemind readinghouse firescytheliquidplantationsailing shipcurtaincustomsittinglifting female in airwoman's neck brokensexual innuendopoodlesliced in twocmnfbisexual mantwilightcandelabralifting male in aircarrying someonelifting an adult into the airclothed male naked femaleeroticismcmnf scenepleadingvampire human lovemarquee1790sbisexual malesiren the alarmdangerous friendmississippi rivergrand guignolgeorgian erachild vampireburial at seamonster as victimgirl in dangercostume horrorvampire driving a carreference to river phoenixtheater audiencetheater curtaindancing with dead body (See All) |
A priest from the Vatican is sent to Sao Paulo, Brazil to investigate the appearance of the face of the Virgin Mary on the side of a building. While there he hears of a statue of the Virgin Mary bleeding tears in a small town outside of the city. Meanwhile, a young woman in the U.S. begins to show s β¦igns of stigmata, the wounds of Christ. The priest from the Vatican links up with her and cares for her as she is increasingly afflicted by the stigmata. Her ranting and raving finally begins to make sense to the priest who starts to question what his religion has stood for for the last 1900 years. (Read More)
Subgenre: | cult filmblack comedyconspiracypunkparanormal phenomenasupernatural horrorchristian horror |
Themes: | funeralreligionsurrealismfriendshipfearinvestigationsupernatural powerparanoiainsanitypanic |
Mood: | gore |
Locations: | villagechurchhospitalnew york citybathtubnightclubwaterwheelchairapartmentusabrazilcatholic churchtrain accident |
Characters: | doctortattooprostitutepriestchristianitysecurity guardbiblecatholicself mutilationcatholic priesttattoo artistreligious symbolism |
Period: | 1990s |
Story: | occultpossessioncoffincandlehallucinationtearscameracomputercorpsephotographfemale nuditybare chested malenuditybloodviolence β¦one word titlecigarette smokingtitle spoken by characterknifechasesurprise endingshowerfirecar accidentrescueslow motion scenecar crashdemonreference to jesus christf wordstrangulationambulancemansiondinersubwayfalse accusationnununderwater scenelatex glovesattempted murderlibrarydangerprologuerace against timestatuecover uplightningscarpremarital sexthreatened with a knifeflowerwhippingsubtitled scenetwenty somethingrevelationwoundgothicheavy raintape recorderscene during opening creditsrome italycaucasianirishinterracial friendshipvisionblood on facethrown through a windowdrunkaerial shote mailrainstormfemale doctordemonic possessionexorcismnewspaper clippingatheistfast motion scenehairdressertranslatorprayingyellinglevitationalleycrucifixionbandagecatholicismcrashing through a windowfeathervaticandovesurveillance footageextreme close uppittsburgh pennsylvaniagospelrosaryscrolltranslationcardinal the priestmessengerfax machinegoateeblood samplebeauticiansuppressioncrisis of faithvirgin mary statuevatican citybrain scanstigmatacorrupt priestwriting on wallancient manuscriptanti clericalismapocryphaanti catholicfilm ends with text (See All) |
Subgenre: | martial artscoming of ageblack comedysupernaturalsword and sorcerydark fantasysword and fantasychrist allegoryrevisionist history |
Themes: | couragemagicfuneralsurrealismmurderdeathfriendshiprevengekidnappingmoneybetrayaljealousyprisonfearescape β¦monsterdeceptionrobberyangerdeath of fatherbrutalitysupernatural powerdeath of motherparanoiaredemptionexecutionhopedeath of wifepanicself sacrificemythology (See All) |
Mood: | nightmareraindarkness |
Locations: | villageforestboatlondon englandwaterwoodsenglandlakeshipcastlecavebrothelsewer |
Characters: | husband wife relationshipfather son relationshipmother son relationshipfather daughter relationshiptattoobrother brother relationshipbrother sister relationshipprostitutesoldierhostagethieftough guywarrioraction herolittle boy β¦maidwitchuncle nephew relationshipmermaidself doubt (See All) |
Story: | black magictorchmanipulationknocked outpoisonritualsnakecandlegood versus evildecapitationpunched in the facecorpsebased on bookexplosionbare chested male β¦bloodcharacter name in titleviolenceflashbackdogfighttitle spoken by characterknifechasesurprise endingfirebeatingshot to deathblood splatterfistfighthorseshot in the chestshot in the headrescueslow motion scenewritten by directorbattleswordbrawlfalling from heightshowdownhand to hand combatinterrogationdemonprostitutionbritishislandriverfightingcombatshot in the backsubjective cameraspyfoot chaseorphangangambushstrangulationaxemassacredisguisemontagethroat slittingbridgearmyimpalementstabbed to deathmixed martial artsprisonerstabbed in the chestmapnonlinear timelinesevered headanti herodisarming someoneone man armychild in perilfictional warunderwater scenekingcreaturefemme fataleshot in the legtransformationon the runtrainingone against manylegendcharacter repeating someone else's dialoguebeaten to deathdangerstabbed in the backscreamingattackfugitivecharacter's point of view camera shotevil manopening action sceneshot in the shoulderscarexploding bodyloss of fatherratthreatened with a knifewaterfallsevered armloss of motherprofanityshot in the armgeneralqueenarsonbattlefieldpowerfreeze framestylized violencehenchmanriottraitorfalling down stairscaptainsabotagewolfdestructionbow and arrowburned alivehead buttspearassassination attemptfaintingscene during opening creditshelmetslaveryroyaltyelephantjail cellmagicianbeardsergeantkicked in the stomachloss of wifenosebleedblockbustergiantpoolrebeljumping from heightrebellionknightmind controlcgifollowing someoneanimal attackinterracial friendshipcrushed to deathscammasked manslaveeaten aliveguarddwarfreverse footageshieldcameohaunted by the pastnicknamevisiontarget practiceexplosivebraveryblood on faceresistancedual wieldhatredimpostormercilessnesschaosshot in the facedeath threatprophecyrowboatstabbed in the headmentorstabbed in the legpunched in the chestcon artistdark heromedieval timesoutlawaerial shotdungeonwisecrack humordisfigurementknife throwingraiddark pastdemonic possessionkingdomtragic heroburned to deathcoinpatriotismfast motion scenepalacebullet timebatdoppelgangeroppressionswordsmandirector cameoface maskhistorical fictionfighterfinal showdownfolklorebag over headmusclemanstrongmanscene before opening creditssuper strengthtowerfireballhuman sacrificevikingshot with an arrowyoung version of characterarcherycrownidealismfemale spycommanderfortresshanging upside downsorcerertavernbellfilm starts with textreluctant heroman kills a womantyrantaltered version of studio logofight the systemheirburnt bodyshot in the throatpart computer animationarcherrighteous ragetragic pastmiddle agessubterraneanjailbreaksorceresscoup d'etatcockney accentbo staffflashback within a flashbackresistance fighteralternate dimensionscytheanimal killingchosen onekicking in a doorassassination plotgiant animalglowing eyeshawkthronefratricideburning buildingtotalitarianismslow motion action scenechild swearingjumping from a rooftophands tiedsevered earsuper speedorigin of heroflaming arrowbaronstabbed in the sidetyrannybrandysnorricamsquidcollapsing buildingwarlockdefectorfuneral pyrecoronationcatapultturned to stonebare knuckle fightinggunpowdergiant snakeking arthurbattering ramslave laborspear throwingmartial arts schoolpublic executionevil sorcerervenompyrokinesisstabbed through the chestcamelotcovered in mudevil kingexcaliburwrecking ballarthurian legendmagehanged bodygiant squidashman with a ponytailtunicround tableflaming swordburning villagegiant ratsnake venomchild slaverylancelotcollapsing bridgeknights of the round tablegiant batgrafittiheir to thronemartial arts instructormagic sword (See All) |
The curse of the headless horseman is the legacy of the small town of Sleepy Hollow. Spearheaded by the eager Constable Ichabod Crane and his new world ways into the quagmire of secrets and murder, secrets once laid to rest, best forgotten and now reawakened, and he too, holding a dark secret of a p β¦ast once gone. (Read More)
Subgenre: | cult filmblack comedyfish out of watersteampunkdark fantasyamerican horrorsupernatural horrorgothic horroradult fantasy |
Themes: | torturemurderrevengemarriageghostjealousyprisonpregnancyheroinvestigationsupernatural powergreedmurder of familyamerican revolutionamerican mythology β¦beyond death (See All) |
Mood: | nightmaregore |
Locations: | cemeterychurchnew york cityfarmtowntown bully |
Characters: | doctorhusband wife relationshippoliceserial killerdetectivebullywitchsniper rifle |
Period: | 18th century1700s |
Story: | black magicpotionskullspideroccultcult directorcoffindecapitationdreambloodflashbacktitle spoken by characterfireblood splatterhorse β¦swordsword fightaxestabbingimpalementsevered headchild in periltreelegendbased on short storycourtwighauntingloss of fatherblindfoldloss of motherdismembermentsplatterchild murdergothicfaintinglifting someone into the airwitchcraftfaked deathcommunityveteranfight to the deathstabbed in the leghit on the headautopsypumpkincrowtorso cut in halfhorseback ridingspellbeheadingscene before opening creditslast will and testamentevil spiritoutsidernaivetystepmothercornfieldscarecrowfeverstabbed in the shoulderwindmillorchestral music scorerepeated linescytheman with no namejack o'lanterncontrolexpressionismbeetleflintlock pistolstagecoachsliced in twocardinal the priesttorture chamberheadextreme closeuphuman skullhorsemanjealous boyfriendmysterious eventsbased on legendconstablemagistratefainting manhorseback1790sdedicationnotarysororicidethrowing a knifegerman expressionismiron maidenjealous manjealous ragegeorgian eraheadlessarachnophobiaheadless horsemanportal to helldown blousedragged by a horseoptical illusionhorseback chasecovered bridgeknife in the thighkiss of deathamerican literatureflock of sheepflying batcostume horrorjumping from a moving vehicleautopsy roomman faintingquill pensleepy hollow new yorkmarriage certificatereference to washington irvingsharpened teethamerican folkloregathering woodgeorgian fashionlegendary characterlevitatingreference to ichabod cranereference to the legend of sleepy hollowwashington irvingchases on horsebackrecapitationshakingankhdesaturated colorsplaying a violinspinning camera shotwax sealdoor in the floorhessianjealous suitorparent killed in front of childtricome (See All) |
A visiting actress in Washington, D.C., notices dramatic and dangerous changes in the behavior and physical make-up of her 12-year-old daughter. Meanwhile, a young priest at nearby Georgetown University begins to doubt his faith while dealing with his mother's terminal sickness. And, book-ending the β¦ story, a frail, elderly priest recognizes the necessity for a show-down with an old demonic enemy. (Read More)
Subgenre: | cult filmtragedyparanormalparanormal phenomenaamerican horrorsupernatural horrorparanormal activity |
Themes: | claustrophobiagriefreligionmurderdeathsuicidefeardrunkennessfilmmakingangercorruptionbrutalitysupernatural powerdeath of motherparanoia β¦sadismfaithevilcrueltypanicself sacrificedevilmurder investigationmysterious deathsupernatural being (See All) |
Mood: | goredarkness |
Locations: | churchbarhospitalcarbathtubdesertkitchencatholic churchslum |
Characters: | psychiatristdoctormother son relationshipmother daughter relationshipteenage girlgirlpriestchristianactresssingle motherpolice detectivecatholicself mutilationcatholic priestself destruction β¦out of controlself injuryevil girl (See All) |
Story: | thorazineforces of evilriteseizureoccultscreampossessionritualpunched in the faceunderwearbased on true storybloodbased on novelviolencepanties β¦blood splatterurinationvomitingbedbathroompianodemonhalloweenbedroomdeath of friendhouseaccidentman with glassesdream sequencetransformationpainargumentvirgindangerstatuethreatbasementfirst partloss of motherprofanityheart attackwashington d.c.falling down stairssyringedestructionelectronic music scorehypodermic needleinjurytape recorderwoman with glassesjoggingragetied to a bedloss of friendcrucifixwitchcraftdesperationhomemovie directoriraqrampagewhiskeymiddle eastvisioninnocencesufferingblood on facediscussionmovie setpsychotronicdespairhypnosismedical examinationmedicationstairsabsent fatherfilm setastronautatticperversioninsultdemonic possessionliving roomroombruiseswearingexorcismunclelevitationgreekhit in the facecar drivingsubway stationautographstaircaseadvicevulgarityx raysatanisminsomniahearing voicescatholicismconversationautumnteenage daughterpsychiatrypunching bagfamous scorefrightouija boardsuperhuman strengthmenacetormentrisksleeplessnessanguishreference to the virgin marymedical doctornoiseholy waterblasphemyloss of controlmovie fanexorcistvoicescreenplay adapted by authorexaminationscreaming in fearskepticismsatanmovie makingemaciationbloody mouthheart conditionmousetrapcocktail partyconvulsionloss of innocenceouijaperildemonicpaganismadolescent girldiagnosisscreaming in horrorboxing gymstabbed in the crotchsubliminal messagetrailer narrated by percy rodriguezcrisis of consciencevulgar languagecrisis of faithvirgin mary statueevil forceheresyarcheological diganimate objectfurypsychological tormentskepticsign of the crossbrain scandistorted voicescotchoccupation in titlejeopardymysterious noiseneurologistpossessed girlagnosticmedical testdesecrationex boxerinsomniaclast ritesoccultismevil beingjesuitgreek americanfalling from a windowspeaking in tonguessacrilegeritalinslurhead spinmysterious voicevirgin girldiabolicaltroubled teenage girlvirgin blooddirector actor relationshipdemonic voicespinal tapforce of evilgirl in perilnitroglycerineneurological disordersleeplessquestioning beliefsradiographytalking backwardstwisting one's head completely aroundbaffled doctordiabolical possessionpassing through a wallphysical tormentfollow shotgeorgetown washington d.c.sexual insultgeorgetown universityiv linejesuit priestrough neighborhoodrunning trackspinning headagnosticismcrab walkdemonic force (See All) |
A new film is currently in production, and a killer is on the loose. The murders draw a reporter, ex-cop, and young woman to the set of the movie inspired by their life. They soon find out that they are dealing with a trilogy, and in a trilogy...anything can happen.
Subgenre: | independent filmmartial artsblack comedypost modernhorror spoof |
Themes: | couragemurderdeathrevengekidnappingbetrayaljealousyfeardrunkennessescapefilmmakinginvestigationdeceptionvoyeurismtheft β¦brutalityparanoiacelebrityhome invasion (See All) |
Mood: | nightmaregoresatireslasher |
Locations: | police stationhelicopterbarswimming poollos angeles californiaapartmentpolice car |
Characters: | police officerpolicefather daughter relationshipboyfriend girlfriend relationshipbrother sister relationshipfemale protagonistserial killerdetectiveactorhostageactresssecurity guardpolice detectivefilm directorex boyfriend ex girlfriend relationship β¦death of girlfriendself referentialpregnant from rape (See All) |
Period: | 1990s2000s |
Story: | cult directorknocked outscreamcostumecoffinflashlighthallucinationwatching tvpunched in the facecorpsepistolphotographbare chested malebloodf rated β¦number in titleviolencesequeldogfightcigarette smokingpartyknifechasesurprise endingshowercell phonebeatingdigit in titleshot to deathblood splatterfistfightcar accidentshot in the chestshot in the headrescuebrawlsecretfalling from heightmaskshowdownheld at gunpointsunglassesbirthdaycar crashhandcuffsvoyeurrevolvershot in the backf wordreportersurvivalfoot chasejournalistbound and gaggedambushstrangulationambulancemansionthroat slittingstabbed to deathtoiletstabbed in the chesttied to a chairfalse accusationno opening creditsdisarming someonedouble crossbirthday partythird partnews reportshot in the legmarriage proposalshot in the foreheadracial slurstalkercharacter repeating someone else's dialoguebeaten to deathstabbed in the backscreamingrace against timecover upkicked in the facetough girlbaseball batprankshot in the shoulderbodyguardstalkingfilm within a filmexploding bodyisolationbasementpremarital sexsuspicionthreatened with a knifeactingobscene finger gesturestrong female charactereavesdroppinganswering machinefalling down stairsentertainmentsabotagerevelationhead buttsociopathsurvivorred dressstabbed in the stomachhollywood californiakicked in the stomachvideotapewristwatchjumping from heightrape victimfaked deathstrong female leadmexican standoffmasked manpresumed deadfemale warriorduct tape over mouthmovie theatrebarefootcrime scenecameobraverymobile phonestabbed in the throatpartnermercilessnessmovie setfalling to deathframe upstabbed in the legsibling rivalrypunched in the chestfilm setbooby trapaerial shotblood on shirtfilm producerwedding ringbulletproof vestbalconyknife throwingraised middle fingerfemale reportercharacters killed one by onesequel to cult favoritekilling spreemasked killernewspaper clippinglingerie slipmedia coveragehit with a baseball batnews reporterdirector cameoreturning character killed offex coppromiscuous womantaserhiding in a closetlecturegolf clublighterquick drawtrailer homepopcornstabbed in the armwhodunithearing voicesbody in a trunkman kills a womanhollywood signmovie studiowoman kills a manstabbed in the shouldergassole black character dies clichemetal detectorcamcorderexploding housereference to star warsscriptpsychological tortureimprovised weaponfamous linehalf brotherman hits a womanstupid victimvillain not really dead clichewrongful arrestanti heroinebreaking a bottle over someone's headgas explosionguillotinesecret roomfratricidebullet proof vestred herringfemale journalistsittinghidden gunwomen's bathroomtalk show hostmystery killerhit with a chairsecret doorwoman punches a manhidden roomcriminal mastermindfalse nameman fights a womansecret passagewayfax machinehidden doorcounselorman punches a womanfilm reelvhs tapesequel to cult filmcounsellorfake bloodhit with a frying panthrown from heightcar phoneseclusionhit with a golf clubfalling down a hillthreatening telephone callfaking own deaththrown through a glass doorfaxphone terrortelephone terrorcopycattrailer narrated by don lafontainemovie scriptrekindled romancemetafictionthrown off a balconyvoice changerdriving in the wrong directionkilled on birthdaylock pickingcopycat killerpicking lockhall of recordscounterpartreference to lois lanereference to hannibal lecter (See All) |
When young Victor's pet dog Sparky (who stars in Victor's home-made monster movies) is hit by a car, Victor decides to bring him back to life the only way he knows how. But when the bolt-necked "monster" wreaks havoc and terror in the hearts of Victor's neighbors, he has to convince them (and his pa β¦rents) that despite his appearance, Sparky's still the good loyal friend he's always been. (Read More)
Subgenre: | stop motion animationpuppet animation |
Themes: | griefdeathfearmonster |
Mood: | rain |
Locations: | cemeteryswimming poolsmall townbicyclepolice carbaseballsewer |
Characters: | husband wife relationshipfather son relationshipmother son relationshipteacherstudentbabylittle girllittle boymayor |
Story: | grave robbingtorchspiderapplausescreamcoffincandleflashlighttearswatching tvcorpseexplosionphotographone word titledog β¦singingfirecryingrescuecatsecretrunningneighborclassroomscienceambulancedrawinghit by a carcreaturesearchgravemicrophonesuburbumbrelladollbaseball batlightningspeechratstagenewspaper headlinerecord playerexperimentballoonwatching a movielifelossphone boothfrogaudiencehome moviecarnivalfull moonpromisethunderpet dog3 dimensionalshovelaquariumturtlechainuncleposterbatfiremantombenergyelectricitynotebookgategiant monsterfencepopcornelementary schoolgoldfishbellblackboardbaseball gamekitebased on short filmfrankensteinbackyardwindmillroller skatesgravestoneanguishpigtailsmovie cameradog moviebaseball fieldfairpet catslimearm slinghorror for childrenhunchbackangry mobphonograph recordreanimationfairground3 dmovie projectorexhumationniececadaverloftbanneromenscience experimentspeakerclotheslineumpirescreenauditoriumbaseball gloveremake by original directorscience teacherschoolhousebaby strollerscience fairbaseball pitcherscience projectnerd boydeath of a petsurgical stitchesvacuum cleaningmanhole coverpet cemeteryfrench poodleback to lifefrankenstein spoofboltelectric kiss (See All) |
Subgenre: | cult filmsuspense |
Themes: | murderdeathrapepregnancyfearescapedeceptionevildevilmurder of family |
Mood: | goreslow burn |
Locations: | cemeteryhospitalkitchen knifeblood in carrunning water |
Characters: | husband wife relationshipfemale protagonistnurseterrorpregnanttalking to oneself in a mirrorself inflicted gunshot woundself cutting |
Period: | 1980syear 1982 |
Story: | riteceremonyoccultknocked outgraveyardritualwatching tvcorpsepistolphotographdancingbare chested malebloodflashbackcigarette smoking β¦knifechasesurprise endingpantiesblood splatterblondeshot in the headsecretdead bodycollegepianodemoncleavagefoot chasebound and gaggeddeath of friendthroat slittingstabbed to deathsuicide attempthousefishwhite pantiesscantily clad femaleroommatevanstabbed in the backprologuepay phoneproduct placementcollege studentshot in the shoulderwigdeath of sonbasementpremarital sexhaunted housepizzagirl in pantieseavesdroppinghypodermic needlebabysitterpatientstabbed in the stomachwitchcraftcovered in bloodattempted suicidepower outagepool tableshot in the faceanxietyheadphonesbilliardsmurder of a childeye gougingcanetrophywilhelm screamlyinghairshot in the neckplaying poollightervery little dialoguecamera shot of bare feetloud sexgoldfishfilm starts with textlandladyshot point blankaudio cassettenewscastpizza deliverysome scenes in black and whitegravestonetenantsymbolwoman smokerpentagramzippo lighterthroat cutmuraleclipsebegins with texthooded figurescreaming in feardrinking bloodrunning for your lifehundred dollar billdorm roombarefoot womanhead bandagesatanic cultsatanic ritualstained glass windowstartledstabbed in the bellysingle location911 calllock of hairintravenousbleeding from eyesdreadbroken vasedancing alonetwenty dollar billlunar eclipsestrange noisegermophobeanimal skullrotary phonedeformed facetrip and fallscratching facepoked in the eyegoldfish bowlbulletin boarddevil worshiperbreaking a vaseignoring advicesecluded houseslit wristluncheonettebait and switchcircumscribed pentagrampizza shoppepperoni pizza (See All) |
Subgenre: | martial artsblack comedysuspensesupernaturalfairy talesword and sorcerydark fantasysword and fantasybased on fairy tale |
Themes: | couragegriefmagicsurrealismmurderdeathloverevengekidnappingmarriagebetrayalfearescapemonsterhero β¦deceptionangerobsessionsupernatural powerredemptionguiltinsanityevilunrequited loveexecutionhopegreedpanicnear death experienceregretmurder of family (See All) |
Locations: | villagechurchforestsnowwoodscastlecampfire |
Characters: | soldierbabyhostagesister sister relationshipthieftough guywarrioraction herolittle girllittle boy |
Story: | black magictorchmanipulationsnakecandlegood versus evilhallucinationpunched in the faceface slapcorpseexplosionbare chested malebloodcharacter name in titleviolence β¦sequelflashbackkissfightknifechasesurprise endingvoice over narrationbeatingfistfighthorsemirrorshot in the chestshot in the headrescueslow motion scenebattleswordbrawlshowdownhand to hand combatsecond partrivercombatsubjective cameraorphansword fightambushaxemassacremountainmontagebridgearmyimpalementmixed martial artsstabbed in the chestfalse accusationno opening creditsanti herobirddisarming someoneone man armychild in perilfictional wardouble crosskingcreaturefemme fatalenecklacetransformationon the runtrainingflash forwardskinny dippingone against manycharacter repeating someone else's dialoguebeaten to deathdangerstabbed in the backprologuescreamingattackfantasy sequencefugitivemissionkicked in the facedeath of childtough girlscene during end creditsthreatened with a knifedirectorial debutwaterfallflowerprofanitylove interestqueenmonkeybattlefieldpowerstylized violencechessiceeavesdroppingtraitorgoldwolffireplacebow and arrowburned aliverevelationhead buttspearassassination attemptheavy rainlooking at oneself in a mirrorquestcatfighthelmetspin offkicked in the stomachvillainessjumping from heightfrogirishfaked deathmind controlforbidden loveaction heroineanimal attackback from the deadbar fightpresumed deadfemale warriorguarddwarfreverse footageshielddiamondvisiontarget practicebraverycrossbowfight to the deathfairydual wieldmercilessnessresurrectiondark humorsuper villainimmortalityrowboattime lapse photographypunched in the chestengagementbooby trapaerial shotknife fightdeerpassionate kisskingdomburned to deathowltelekinesisstick fightprequelpalacetelepathyimprisonmentheroismhappy endingfemale soldierfinal showdownworld dominationcomic reliefshot with an arrowmegalomaniacyoung version of characterarcherycrownfortresshearing voicesnarcissismtavernreluctant herotentacleman kills a womanmacguffinwoman kills a manaltered version of studio logogoblinstabbed in the shoulderbleeding to deathevil womanarchertragic lovedeath of familywoman fights a manwarlordsorceresscoup d'etatwoman slaps a manmind readingone woman armybo staffimprovised weaponchainsanimal killingrock climbinghalf brotheranti heroineglowing eyeschild abductionsecret lovethronepower strugglescottish accenthorse drawn carriagenetbanishmentsuit of armoraxe fightsurprise during end creditsorigin of herochild soldierflaming arrowstudio logo segues into filmdukeman fights a womantrackercoronationnarcissistmohawk haircutcaught in a netfemale thieftailrope bridgethrown from heightcloakevil laughterreference to snow whitefreeze to deathevil queenbackflipsentenced to deathelkmagical mirrormeltingsororicidemagical creatureaxe throwingbrothers grimmtunicprequel and sequelblack bloodsnow queen (See All) |
John Form has found the perfect gift for his expectant wife, Mia - a beautiful, rare vintage doll in a pure white wedding dress. But Mia's delight with Annabelle doesn't last long. On one horrific night, their home is invaded by members of a satanic cult, who violently attack the couple. Spilled blo β¦od and terror are not all they leave behind. The cultists have conjured an entity so malevolent that nothing they did will compare to the sinister conduit to the damned that is now... Annabelle. (Read More)
Subgenre: | ghost storyparanormal activity |
Themes: | religionmurderdeathfriendshipsuicideghostpregnancyweddinginvestigationpsychopathsupernatural powerevilhome invasioncrueltytrauma β¦self sacrificedevilpolice investigationnear death experience (See All) |
Mood: | nightdarknessmoving |
Locations: | churchhospitalelevatorkitchenapartmentcatholic churchkitchen knifekitchen fire |
Characters: | doctorhusband wife relationshippoliceafrican americanfriendfemale protagonistnursedetectivepolicemanbabypriestchristianreference to godlittle girlkiller β¦christianitypolice detectivecatholicterrorpregnant womanpregnantneighbor neighbor relationshipreligious fanaticcrying babybaby girlsuicide by jumping (See All) |
Period: | 1970syear 1969year 1970 |
Story: | black magicsouloccultscreampossessionritualflashlightgood versus evilhallucinationcamerawatching tvpunched in the facebased on true storyphotographblood β¦f ratedcharacter name in titleviolenceone word titleflashbackfighttitle spoken by characterknifechasetelephone callfirecryingshot to deathblood splattershot in the chestslow motion sceneshootingbookneighbordemonreference to jesus christfoot chasename in titlestabbingthroat slittingsuicide attemptnonlinear timelinecultnunno opening creditsdrawingchild in perilnews reporton the rungunshotflash forwardcharacter repeating someone else's dialoguepuppetattackdollbaseball batscargiftbasementhaunted housesacrificegraffitiblood spattercouplerecord playerspiritdresslistening to musicspin offstabbed in the stomachtoycrying womanvisithometaking a picturefalling to deathreference to satanblack and white scenethunderstormbookstorewedding dressbarefoot femaledemonic possessionneighborhoodtelekinesisprequelshot multiple timesbeing followedsermontaking a photographforename as titleapparitionhiding in a closetsuit and tiepopcornblood stainhospital roomhearing voicesfilm starts with textlistening to radiofall from heightlocked doorafrican american womanmedical studentreading a booksewing machinesole black character dies clichecrying femaleflametraffic accidentmysterious womanbechdel test passedsymboltraumatic experiencereference to john waynepsychotronic filmdeath by gunshotlocked in a roomhouse firescreaming womanframed photographvinylends with textrocking chairreference to sigmund freudfemale name in titlemoving outflickering lightstabbed multiple timespassive aggressive behaviorevil dollpassive aggressive womanfall to deathlocked inchild's drawingoxygen maskdeath by shootingbaby carriagesatanic cultbiblical referenceblood on handsnurserytoy comes to lifehorror iconreference to charles mansonscratchstab woundwatching someone sleepkiller dollprivate investigationblack and white sequencejump scareshop ownermysterious eventcrayonflamestalking to godjumping from a windowpasadena californiasanta monica californiabusiness suitstabstoragehorror movie prequelpolice investigatorviolent manbook storelocking a doorovercoming fearviolent womananimate dollcult memberdemonic spiritcrying for helpjesus christ quotationopening creditsremembering the pastfinger injurybook as a giftcreepy dollreference to deviltalking to a dollblood on armdrinking coffeeemergency callpossessed dollwhite weddingbig knifegood verses evilsecond hand bookshopshared universethumb wrestling (See All) |
Dr. Joe Darrow is a recently widowed doctor. He is grieving due to the death of his pregnant wife in a Red Cross mission in Venezuela. Although being atheist, he began to believe that his dead wife wants to communicate with him, through her young patients in the Pediatrics of a Chicago hospital.
Subgenre: | black comedysuspensesupernaturaltragedymelodramaparanormal phenomena |
Themes: | grieffuneraldeathlovefriendshipghostpregnancydrinkingfearangersupernatural powerparanoiaguiltfaithdeath of wife β¦panicdyingnear death experienceafterlife (See All) |
Mood: | raintearjerker |
Locations: | junglepolice stationvillageairportchurchbarhospitalairplanebuselevatorwheelchairpolice carchicago illinoistunnelschool bus β¦catholic schoolbus accident (See All) |
Characters: | doctorfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipfriendchildrenboybrother sister relationshipgirlsoldiernursepoliceman β¦babypriestlawyerbest friendlittle girllittle boysecurity guardcatholicemployer employee relationshipdeath of boy (See All) |
Period: | 2000s |
Story: | graveyardcandlehallucinationcameracorpsedreamphotographbare chested malesexone word titleflashbackguncigarette smokingtitle spoken by characterchase β¦surprise endingtelephone callcell phonemachine guncar accidentmirrorslow motion scenedrinkarrestriflebeerneighborhandcuffsrevolverriverfoot chaseambulancearmysuicide attemptmapnunbirddrawingunderwater scenenews reportdrowninglatex glovesgravepilotcharacter repeating someone else's dialoguewidowerpay phoneproduct placementrace against timedeath of childlightningcrosswaterfallfreeze frameanswering machinerevelationflyingheavy rainscene during opening creditscomapatientcrucifixloss of wifedesperationparking garageback from the deaddrug overdosethunderattempted suicidepower outageresurrectionevacuationinsectheavenassault rifleheartrainstormtribefemale doctorparrottranslatorapparitiondoubtphysicianinsomniafemale lawyerhearing voicesparamedicstethoscopetoastcolombiaemergency roomrainbowjumping into watersleeplessnessrescue from drowningsymboltietrespassingpackagebilingualismrainforestvenezuelabirthmarkred crossmistjumping off a cliffmessengercandelabraends with freeze framedefibrillatorschoolyardbirdcageriver rapidsmemorial servicedragonflyorgan donorwaking up from a comareference to christopher columbuscat scanorgan transplantwhite water raftinglandslidepoegelatinmudslidebrain deadintensive care unitmountain roadtribesmanaid workerair stripanesthesiologistnative nuditylaw professorrockslidejungle tribeflatlininghospital cafeteriabald spotgrief counseling (See All) |
Barbra and Johnny visit their father's grave in a remote cemetery when they are suddenly set upon by zombies. Barbra manages to get away and takes refuge in what seems to be an abandoned farm house. She is soon joined by Ben who stopped at the house in need of gas. Beset by the walking dead all arou β¦nd them Ben does his best to secure the doors and windows. The news reports are grim however with creatures returning to life everywhere. Barbra and Ben are surprised when they realize there are 5 people hiding out in the basement: Harry, Helen and Judy Cooper; and a young couple, Tom and Judy. Dissensions sets in almost immediately with Harry Cooper wanting to be in charge. As their situation deteriorates, their chances of surviving the night lessen minute by minute. (Read More)
Subgenre: | cult filmindependent filmsuspensetragedycreature featureallegorysurvival horrorzombie apocalypseamerican horrorzombie survivalindependent horrorzombie outbreak |
Themes: | police brutalitycouragemurderdeathrevengemarriagefearescapemilitarybrutalityparanoiapanicapocalypsecannibalismself sacrifice β¦near death experienceradiation (See All) |
Mood: | gorenightdarknessone night |
Locations: | cemeteryhelicopterforestcarwoodsrural settingkitchenfarmtruckpennsylvania |
Characters: | zombiedoctorhusband wife relationshippolicefather daughter relationshipmother daughter relationshipafrican americanboyfriend girlfriend relationshipbrother sister relationshipprofessorsheriffterrorpolice dog |
Period: | 1960syear 1968year 1967 |
Story: | zombificationtorchskullundeadcult directorknocked outgraveyardwatching tvpunched in the faceface slapcorpsepistolexplosionfemale nudityblood β¦violencebare breastsfemale frontal nuditydoggunfemale rear nudityfightcigarette smokingknifechasesurprise endingfiretopless female nudityhigh heelsbeatingshot to deathblood splatterfistfightfoodcar accidentshot in the chestshot in the headshotgunrescuebrawlbare buttrifleheld at gunpointrunninglow budget filmrevolvertelevisionscientistshot in the backsurvivalfoot chaseaxemassacrestabbingwomanbridgearmystabbed to deathstabbed in the chesthouseexploding carman with glassescultradiocontroversycreaturepantyhosenews reporttransformationshot in the foreheadlimousinegravetreebeaten to deathdangerscreamingperson on fireattackfirst of seriesactor playing multiple rolesrace against timescene during end creditsshot in the shoulderdeath of brotheramerican flagtragic eventexploding bodyisolationbasementdie hard scenariofirst partdirectorial debutsevered armgeneralhandgunvigilantewashington d.c.pickup truckdisastertv newsfalling down stairsfireplaceburned aliveelectronic music scoregothicmutantdiseasevirusbarnloss of loved onehammerimpersonationsevered handgrindhouseend of the worldwhite housesocial commentaryback from the deadeaten alivecamera shot of feetseriescameobraverycannibalmercilessnesspower outagechaosresurrectionbroken glassinsectpsychotronicescape attemptscene after end creditsinfectionone daysiegegasolinemutationcellarbonfireburned to deathloss of brothermoral dilemmashot multiple timessurprise after end creditsmedia coveragenasafemale stockinged feetsatellitenews reporterintestinesliving deadmolotov cocktailcremationgerman shepherdblack manpolice chiefabandoned houseplaguefarmhousebroken windowtv reportercameramansicknessfoot closeuphillbillypatricidequarreloffscreen killingfriends who live togetherhandshocksole black character dies clichecowardcar set on firedirector also cinematographermeteorflesh eating zombiepart of a serieswalking deadtv interviewtragic endingmatricidesick childwoman slaps manradio newswoman slaps a manpsychotronic filmimprovised weaponfade to blackfamous lineghoulgrindhouse filmheart in handsocial decaybludgeoningwinchester rifleoutbreakzombie attackman slaps a womanpower strugglewrenchcontaminationno survivorsdoomsdaynewscasterrunning out of gassurprise during end creditsbarricadeblack glovesnailgutszombie childposseexposed breastabandoned carbitten on the armman punches a womanafrican american manhit with a rockmidnight movieexpertremadenational guardmultiple cameosdrive in classicporchtire ironanthropophagusmass deathrefugeends with deathjarentrailshorror movie remadehunting rifleheadshothell on earthlivermeat hooknon personbabehole in chestblack man white woman relationshipmutilated bodyreference to nasaspace probeamoralityhordenonpersonfire pokerzombie bitedeadly diseasehickkeroseneinjured childvenusexplanationhit with a tire ironhead shotnight of the living deadcontemporary settingemergency broadcast systemgas pumpburning bodyhysterical femalematchstickmutant creaturevenus the planetalsatianreference to boris karloffpersonality conflicttrowelgardening toolmindless eatingmass panicsearch and destroyrifle scope (See All) |
The modern world holds many secrets, but the most astounding secret of all is that witches still live amongst us; vicious supernatural creatures intent on unleashing the Black Death upon the world. Armies of witch hunters battled the unnatural enemy across the globe for centuries, including Kaulder, β¦ a valiant warrior who managed to slay the all-powerful Queen Witch, decimating her followers in the process. In the moments right before her death, the Queen curses Kaulder with her own immortality, forever separating him from his beloved wife and daughter in the afterlife. Today Kaulder is the only one of his kind remaining, and has spent centuries hunting down rogue witches, all the while yearning for his long-lost loved ones. However, unbeknownst to Kaulder, the Queen Witch is resurrected and seeks revenge on her killer causing an epic battle that will determine the survival of the human race. (Read More)
Subgenre: | black comedyconspiracysupernaturaldark fantasychristian horror |
Themes: | magicfuneraltorturesurrealismmurderdeathrevengekidnappingbetrayalprisonescapemonsterinvestigationdeceptionmemory β¦supernatural powerapocalypseblindnessvengeancenear death experiencemurder of family (See All) |
Mood: | darkness |
Locations: | churchbarnew york citysnowairplanetaxikitchenapartmentcavecatholic churchschool bus |
Characters: | tattoosoldierpriesthostagetough guywarrioraction herowaitressbiblewitchcatholic priestevil witch |
Story: | black magicpotiondruggedtorchoccultmanipulationcoffincandlegood versus evilhallucinationcorpsedreampistolexplosionblood β¦violenceflashbackfightknifesurprise endingfirevoice over narrationcell phoneshot in the chestshotgunrescuebattleswordfalling from heightshowdownheld at gunpointinterrogationshot in the backassassinstrangulationaxemassacremountaindeath of friendimpalementstabbed to deathprisonerstabbed in the chestno opening creditsanti heroone man armyassassinationchild in perilfictional wardouble crosscreaturefemme fataleflash forwardtreecursestabbed in the backprologueattackmissionrace against timecover uplightningopening action sceneshot in the shoulderbodyguardexploding bodythreatened with a knifequeenarsonstylized violencetraitorbow and arrowburned aliverevelationassassination attemptgothicheavy raincrucifixwitchcraftimpersonationirishmind controlend of the worldback from the deadbar fighteaten alivepresumed deadretirementcrime scenepump action shotgundamsel in distressreverse footageresurrectionimmortalitycigarette lighterdark heroheartaerial shotlonercanedark pastdressing roomtragic heroburned to deathtelekinesisteleportationtelepathyimprisonmentspellenglishman abroadsuffocationnarrated by characterillusionfire extinguisherstabbed in the handbongold dark housegiant monsterhitlerbrooklyn bridgegun held to headcomic reliefplaguesecret societyflycrystalgreenhousepocket watchbakeryman kills a womanoffscreen killingmacguffinfashion showaltered version of studio logosole black character dies clichetimes square manhattan new york citycathedralmaggotopen endedrighteous ragetragic pastdeath of familysubterraneancamera phonesymbolfemale bartendermind readingpentagrampenrookieglowing eyesheart in handmagic spellchrysler building manhattan new york cityregenerationselfiechantingdiscovering a dead bodybattle axedecomposing bodyenglishwoman abroadsecret doorsecret organizationchemistryarsenalman fights a womanrepressed memorypossewarlockirongiant creaturehand through chestcherrycouncilcatwalkstalinalternate worldlucid dreamswarmstabbed through the chestinside the mindweather manipulationfacial cutshape shiftingbiographeraxe throwingnapoleonarsenicblowing smoke in someone's facehuman brandingsiamese catclose up of handflaming swordwitch hunterlife forcesword throwingrapid healingsnapping fingersgiant treeair hostessmental manipulationdead flystabbed through the backweapons cabinetblack plaguefalling down a holecircumscribed pentagramwoman wearing lingeriegummy bearman holding a babyswarm of flies (See All) |
With the intention to venture into the unexplored areas in the deep jungle of the Amazon rainforest at the border between Brazil and Peru, in 1979, a film crew composed of four young Americans attempted to make a documentary about the never seen before indigenous cannibalistic tribes. However, it's β¦already been two months since anyone last heard from the crew, so without further delay, the noted anthropologist Professor Harold Monroe and his rescue team of the seasoned guide Chaco Losojos and his assistant, embarked on a mission to locate them in the depths of the Green Inferno. Following the Yakumos, a tribe that no white has ever seen before, soon enough, the Professor's rescue party will encounter the elusive Yanomamos or Tree People and the fearsome Shamataris or the Swamp People. Eventually, as more evidence is found concerning the fate of the film crew, the Professor will try to recover the raw footage that was paid in blood, and return it to New York to the executives of the Pan American Broadcasting System who crave to get the riveting unedited footage. What has really happened to the overambitious documentarists, and above all, what was in the final two reels? (Read More)
Subgenre: | cult filmtragedyfound footageitalian horrorsadistic horrorextreme horror |
Themes: | torturemurderdeathrapefilmmakingdeceptionbrutalityinsanityhumiliationsadismevilabuseexecutionexploitationcruelty β¦cannibalismabortion (See All) |
Mood: | gorerain |
Locations: | junglenew york cityairplaneboatusa |
Characters: | anthropologistboyfriend girlfriend relationshipsoldierwarriorprofessorfilmmaker |
Story: | amazon jungleamazontorchskullspidermachetesnakedecapitationcamerafemale nuditymale nuditybare chested malebloodnuditysex β¦violencefemale frontal nuditymale frontal nuditymale rear nudityfemale rear nudityfemale full frontal nuditycigarette smokingmale full frontal nudityknifefireshot to deathurinationshootingvomitingriflemale pubic hairrevolverrivertelevisionscientistsubjective camerajournalistnew yorkmassacrebridgeimpalementbirdanimalcontroversynews reportshot in the leglooking at the cameratalking to the cameraskinny dippingpublic nuditydangerscreamingcharacter's point of view camera shotskeletonhairy chestfilm within a filmtraptied uphandgundismembermentkillingmonkeyarsonuzishavingdestructionburned alivekilling an animalrevelationspearelectronic music scoremass murdersexual abusesexual attractionmutilationcovered in bloodpart of trilogyvictimrape victimdead womansocial commentaryhomicideswitchbladesufferingblood on facecannibalmercilessnessgunshot wounddisembowelmentgang rapehandheld cameraperversiondead manslaughterturtletigertribemustachecastrationlieutenantsexual assaultparrottank topburned to deathphysical abusemuddead girlnude swimmingexpeditionbandagecanoefilm crewflutelightertelevision newssexual perversionsexual violenceanimal crueltyshoutingraftdegradationanimal abusecrewunconsciousnessheld captivemissingsnuff filmactual animal killedcarnageatrocityalligatorsouth americaextreme violencecamouflagegropingfilmingfemale victimsnake bitetelevision reporterviolent deathdovesexual humiliationexploitation filminfanticidecaptivityloinclothburningfemale journalistgenital mutilationundershirthutmass mediascreaming in fearsexual torturesexual crueltybanned filmleechscreaming in horrorwild boaranthropophagushuman fleshpregnant woman nudemutilated corpsecold blooded murderentrailsvideo nastywoman in a towelmurder of a pregnant womaneating human fleshshaving creamamazon riveremasculationcovered in mudamazon tribesavagerytransgressive filmgraphic rapetorture deviceextreme filmnorth americatv journalistamazon rainforestphysical torturecannibal tribewooden stakeanacondabarbarismhemorrhagerunning nakedburning villageamazon forestamazoniaman in a towelnaked bathingextreme crueltyinsidemacawtelevision executivenude in natureblow darttribal warfarevileanimal violenceamazonian indian (See All) |
Once a mercenary of Queen Elizabeth I fighting Spaniards in Africa, Solomon met the Devil's Reaper and discovered he was bound for hell. Barely escaping, he soon renounced violence to atone for his past sins, seeking out redemption in a life of peace. That is until the followers of sorcerer Malachi β¦kidnap a Puritan girl, Meredith Crowthorn, and brutally slaughter her family before his very eyes, forcing Solomon to take up arms and return to his violent ways once more to rescue her. (Read More)
Subgenre: | independent filmb moviesword and sorcerysword and fantasychrist allegorygothic horror |
Themes: | magicfuneraltorturereligionmurderdeathrevengekidnappingbetrayaldrunkennessmonsterdeceptionredemptionfaithabduction β¦cannibalismdevilmurder of familycooking over a campfire (See All) |
Locations: | villagecemeterychurchforestsnowwoodsenglandshipcastlecavecampfire |
Characters: | zombiehusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipbrother brother relationshipbrother sister relationshipsoldierpriesthostagewarriorbiblewitchself mutilation β¦ex soldiership captain (See All) |
Period: | winter16th century1600s |
Story: | black magicsoultorchundeadknocked outgood versus evildecapitationcorpseexplosionbare chested malebloodcharacter name in titleviolenceflashbacktwo word title β¦guntitle spoken by characterknifechasesurprise endingfireblood splatterhorsemirrorshot in the chestshot in the headrescueslow motion scenebattleswordfalling from heightmaskbased on comicshowdowninterrogationdemonbritishprayerrivershot in the backsword fightambushaxemassacredisguisethroat slittingarmyimpalementstabbed to deathstabbed in the chestsevered headno opening creditsanti herochild in perildouble crosskingjourneytransformationshot in the foreheadcursestabbed in the backprologueperson on firestatuetentdeath of childscardeath of brotherdeath of sonhorse ridingneck breakingtrapthreatened with a knifemercenarysevered armprincerevelationheavy rainhatslaverycaptivecrucifixtreasurewitchcraftaccidental deathjumping from heightmind controlmonkslaveeaten alivepresumed deadpromisereverse footagecrossbowstabbed in the throatgash in the facestabbed in the legsibling rivalrydark herodead childjumping through a windowdungeonmurder of a childhealingrainstormcliffdisfigurementdark pastaxe murderdemonic possessionsevered legburned to deathwilhelm screamdaggerteleportationcrowmudblood on camera lensillusioncrucifixiondrifterbag over headrobbermonasterygiant monsterevil spiritportalfortresssorcerershot in the eyetavernmercy killingpatricideepiloguedeath of familyinnmasked villainfather son reunionsorceryanimated creditsgrim reaperdreadlocksimmolationlocketpitdeal with the devilfratricidescottish accentlong haired malehorse chaseknife in the chestflintlock pistolhorse drawn carriagejumping out a windowscrolllordspaniardorigin of heropaganfrozen lakehealerfuneral pyrebrother versus brotherpacifistnorth africahuman skullkidnapped girloutnumberedbritish flagcloakrainy dayabbeystabbed through the chesttravellerclosing credits sequencehanged bodypuritanpushed from heightaxe in the chestcovered wagonhead chopped offunion jacklast wordstrap doorflaming swordburning villageleather maskelizabethan erabrother against brotherscars on backstabbed through backbased on pulp magazinehuman in a cagewitch burningevil versus evildisownedhole in hand1550scloak and daggerpile of goldprison wagonburned villageyear 1600 (See All) |
Chucky hooks up with another murderous doll, the bridal gown-clad Tiffany, for a Route 66 murder spree with their unwitting hosts, two eloping high-school graduates.
Subgenre: | cult filmblack comedyconspiracysupernatural |
Themes: | police brutalitysurrealismmurderdeathloverevengekidnappingmarriagemoneybetrayalpregnancyfearescapeweddingdeception β¦seductionrobberypsychopathbrutalitysupernatural powerparanoiaredemptionsadismunrequited lovepanicmurder of a police officerpolice corruptionnear death experienceregret (See All) |
Mood: | gorecar chaseslasherpoetic justice |
Locations: | police stationcemeteryhotelbathtubwaterkitchenpolice carroad tripmotel |
Characters: | police officerhomosexualpoliceteenagerboyfriend girlfriend relationshiptattooteenage girlteenage boyserial killerdetectivepriesthostagethiefpolice detective β¦maidgay teenagerex boyfriend ex girlfriend relationshipuncle niece relationshipgay friendself referentialmurder of girlfriend (See All) |
Period: | 1990s |
Story: | voodooskullspiderknocked outgraveyardritualcoffinflashlightwatching tvcorpsepistolphotographbare chested malesexblood β¦character name in titleviolencesequelgunkissfightcigarette smokingknifechasesurprise endingfirecryingcell phonebeatingshot to deathblood splattercar accidentmirrorshot in the chestrescueslow motion scenebare buttlettershowdownheld at gunpointrock musiccar crashdead bodymarijuanahandcuffsrevolvertelephonef wordorphanambushstrangulationmansionmontagethroat slittingbridgeimpalementstabbed in the chesttied to a chairexploding carfalse accusationdisarming someonedrawinghit by a cardouble crosspolice officer killedvanfemme fatalenews reportmarriage proposalon the runattempted murderargumentstalkercharacter repeating someone else's dialoguedangerstabbed in the backscreaminglocker roomelectrocutionpay phonefugitiveumbrellarace against timedollbaseball batlightningskeletonringscarfishnet stockingsstalkingfilm within a filmchildbirthexploding bodypremarital sexratsuspiciontied upobscene finger gesturenewspaper headlinearsoncorrupt copmaniacprivate detectiveflirtingchainsawpot smokingsabotagefireplacehead buttgothicheavy rainsociopathscene during opening creditsragemutilationtoyfourth partphone boothbirthblack humormexican standofffemale killerback from the deadmale underwearpresumed deadwoman in jeopardydamsel in distressnicknamesevered fingernew jerseyblood on facemisunderstandingdual wieldgash in the faceresurrectionconvenience storedark humorshot in the faceescape attemptcigarette lighterframe upcon artistlaughterthrown through a windowbooby trapwisecrack humortitle at the endrainstormdisfigurementknife throwingraised middle fingertrailertied feetdead woman with eyes opensequel to cult favoriteframed for murderprivate investigatorengagement ringclose up of eyesspellgothmarijuana jointabandoned buildingblood on camera lenssuffocationharassmenthysteriaface maskfinal showdownteenage lovescene before opening creditsabuse of powerpicturelighterpolice chieftelling someone to shut uphomicidal maniacdisposing of a dead bodytrailer homeframedmasturbation referenceburnt facebody in a trunkhit by a truckcookietrailer parkmacguffinwoman kills a mandomestic abusecleaning ladyburnt bodycar set on firechapeldisfigured facehit with a shovelrepeated linemultiple murderamuletknife murderrecreational vehiclepillowhandymantongue in cheekpentagrammurder of a nude womanmass murdererstupid victimvillain not really dead clicheinnocent person killedproposalgrave diggingovenasphyxiationdecomposing bodyabusive relationshipevil dollnail polishfemale serial killernailwine bottlereference to frankensteinchange of heartdead parentshockey maskfragments of glassanti villainfemale thiefstabbed in the heartknife wounddeath of unclewaterbedplanting evidenceevil laughterfalse accusation of murderhandcuffed to a bedkiller dollairbagsoul transferencedumb policereference to martha stewartincantationlovers on the lamsee you in helltwo killersaccused of murdermultiple stabbingrunaway teensmothered with a pillowknife in backchief of policesmothered to deathwoman electrocutedexploding trailerfemale sociopathreference to jerry springerhunkbreaking a plateburnedtalking dollbig nosebiting handpiercing ripped outcleaning up bloodelectrocuted in bathtublegal guardianalpha maleelectrical firereference to bonnie and clydetight dressbreathalyzernose piercinghidden bodycriminal duoerieloss of unclemeatballspushed through a windowshot through the headbindsuitebiting an earelopingtreatcrayon drawinglip piercingreference to christian slatersinister coupleplanting drugswater bed (See All) |
In Tokyo, Shigeharu Aoyama is a widower that grieves the loss of his wife and raises his son Shigehiko Aoyama alone. Seven years later, the teenage Shigehiko asks why his middle-aged father does not remarry and Shigeharu meets his friend Yasuhisa Yoshikawa, who is a film producer, and tells his inte β¦ntion. However, Shigeharu has difficulties to approach to available women to date and Yasuhisa decide to organize a sham audition for casting the lead actress for the fake movie. They receive several portfolios of candidates and Shigeharu becomes obsessed by the gorgeous Asami Yamazaki. Despite the advice of the experienced Yasuhisa, Shigeharu calls Asami to date and he falls for her. But who is the mysterious Asami? (Read More)
Subgenre: | cult filmindependent filmpsychological thrillersadistic horror |
Themes: | grieftorturesurrealismmurderdeathfriendshipmarriagedrinkingfearangerdivorcelonelinesspsychopathobsessiondeath of mother β¦paranoiadrug usedatinghumiliationsadismabusecrueltydeath of wifestarvationreligious cult (See All) |
Mood: | nightmarerain |
Locations: | beachbarhospitalrestauranthotelelevatorwheelchairjapansearooftop |
Characters: | doctorhusband wife relationshipfather son relationshipfather daughter relationshipmother daughter relationshipfriendboyfriend girlfriend relationshipboyteenage girlteenage boynursedanceractresslittle girllittle boy β¦japaneseolder man younger woman relationshipfathersingle fatheruncle niece relationshipaunt niece relationshipself destructivenessstepfather stepdaughter relationship (See All) |
Period: | 1990s |
Story: | ritedruggedceremonyscreamdecapitationhallucinationwatching tvcomputerunderweardreamphotographdancingfemale nuditybare chested malenudity β¦sexbloodbased on novelviolenceone word titlefemale frontal nudityinterviewflashbackdogkisscigarette smokingnipplestitle spoken by charactererectionpantiestelephone callcell phonemirrordrinkundressingvomitingliebeerbedcafepianotelephonesubjective camerafoot chasebedroombraconcertold manstrangulationvideo cameraambulancesuicide attemptfishdinnerchild abusesevered headfishingtonguecontroversysearchfemme fatalemarriage proposalcoffeebartenderpaintrainingflash forwardbusinessmanwidowerliarumbrellaauditionmissing personscarpianistdisappearanceinjectiondateballetdismembermentfalling down stairssyringekilling an animaldesirehypodermic needlelooking at oneself in a mirrorhappinessmutilationoverallslosssadomasochisms&mtokyo japansufferingsevered fingerpet dogsonco workerscissorsschool uniformlaughterpedophilefilm producerperversionstabbed in the eyehousekeeperroommisogynyplaying pianodead dogpiano playerpervertvideo tapewifeneedleparalysiskilling a dogmen's bathroomstairwaysubtitlesstepfathersexual perversionfemale psychopathmasochismtraffic jamyoung womanhusbandpiercingunhappinessballerinaamputationlollipopmissingbleedingfilm productionbody bagextreme violencemurderesswoman in a bikiniscriptwoman undressingscreenplayflashback within a flashbacksevered footbroken neckgrindhouse filmbody partremarriageballet dancerman in a wheelchairtelephone numbermiddle aged manpassing outbedriddenparallel worldsevered eargarroteburnweirdoacupuncturepneumoniafemalespiked drinkleg bracesevered tonguegolf ballclose up of mouthrecord companydance studioincensewashroomagonyrubber glovesbeaglemystery womanshorelineburn scarcasting callsackpushed down stairspaleontologistreference to julia robertsreference to katharine hepburnresumeyogurtvoice over readingballet dancingballet shoesdioramasit inupright pianocamera shot of a woman's legsjob applicantforebodingclinking glassesmace spraymissing fingerspasmpiano wireclothes cut offmissing limbbaton twirlerbody in bagrod and reeltongstuning forkbroken collarboneburning oneselfawakened by a phonefoot amputationnegativismturning self in to the policefake auditionpracticing golfpretty woman (See All) |
Two years after the events of Scream, Sidney Prescott and Randy are attending Windsor college. They are trying to get on with their lives...Until a new Ghostface killing spree begins. With the help of Dewey and Gale, Sidney must find out who's behind the murders. As the body count goes up, the list β¦of suspects goes down. (Read More)
Subgenre: | cult filmblack comedysuspenseconspiracypost modernslasher flickteen movieteen horrorhorror spoof |
Themes: | murderdeathloverevengebetrayalfeardrunkennessescapeinvestigationdeceptionvoyeurismpsychopathparanoiainsanitysadism β¦theatremurder of a police officernear death experience (See All) |
Mood: | goresatireslasher |
Locations: | police stationhospitalbicyclepolice carfire truck |
Characters: | police officerpoliceteenagerboyfriend girlfriend relationshipfemale protagonistserial killerdetectivehostagekillerpolice detectiveex boyfriend ex girlfriend relationshipself referential |
Period: | 1990s |
Story: | bare chested male bondagecult directorknocked outscreamcostumeflashlightgood versus evilhallucinationwatching tvcomputerpunched in the faceface slapcorpsepistolbare chested male β¦bloodf ratednumber in titleviolencesequelinterviewkisscigarette smokingsingingpartyknifechasesurprise endingcell phonebeatingdigit in titleshot to deathblood splattercar accidentshot in the chesturinationshot in the headrescueslow motion scenebrawlmaskshowdownheld at gunpointsunglassessecond partcar crashcollegevoyeurtelevisiontelephonef wordreportersurvivalfoot chasegay slurbedroomjournalistambushaxevideo cameraambulancestabbingdeath of friendthroat slittingimpalementstabbed to deathstabbed in the chestinternetfalse accusationno opening creditsdisarming someonehit by a cardouble crosspolice officer killedvannews reportshot in the legnecklaceshot in the foreheadracial slurattempted murderlibraryauthorstalkercharacter repeating someone else's dialoguemicrophonestabbed in the backscreamingattackpay phoneproduct placementstatuecover upkicked in the facecollege studentlightningprankscarbodyguardstalkingfilm within a filmisolationsuspicionstagecharacter says i love youthreatened with a knifeshot in the armstrong female characterpizzatwenty somethingeavesdroppingtv newsfalling down stairsheroineshot in the stomachfamecatfightsurvivorgroup of friendsstabbed in the stomachcrucifixmovie theatervillainessvideotapeblockbusterrehearsalpress conferencestrong female leadinterracial friendshipcrushed to deathsocial commentarymasked manpresumed deadfemale warriorduct tape over mouthcrime scenecameohaunted by the pastconstruction sitestabbed in the throatmercilessnessevacuationfalling to deathescape attemptstabbed in the heade maillens flarefemale reporterplaycharacters killed one by oneethnic slursequel to cult favoritekilling spreemasked killermedia coverageclose up of eyesenglishman abroadintimidationnews reporterdirector cameoreturning character killed offex cophiding in a closetohiocafeteriafake identitypolice chieffemale psychopathpopcornwhodunitcameramanfraternitysororitybusiness cardman kills a womanoffscreen killingfemale villainwoman kills a mandeath of boyfriendstabbed in the shouldershot in the throatcollege campusstabbed in the facetragic pastreference to star warslimpwoman slaps a manfamous linestupid victimvillain not really dead clicheclimbing out a windowvcrthrown from a car555 phone numberred herringfemale journalistsittingfilm schoolwoman punching a manmystery killergeneration xcult figurecut armfilm studentmob of reportersbroken handaccomplicereference to charles mansonthrown from heightdeath by impalementauditoriumstab woundthreatening telephone callthrown through a glass doorinstant messagingprank callsorority housereference to quentin tarantinoreference to o.j. simpsonphone terrorstabbed in the earreference to jeffrey dahmerreference to ted bundytelephone terrortheater directorcopycatvalley girlmetafictionthrown off a balconytv cameramanvoice changerreference to kevin costnerreference to the godfatherfake knifemise en abymereference to jennifer anistonreference to kevin baconreference to the terminatorbreaking bottle over headcopycat killerreference to sandra bullocktalking during a moviewoman kills a womanfalling off a stagesorority partysorority sisterfilm geekreference to james cameronsoundproof roomimpaled by pipestage director (See All) |
John and Laura Baxter are in Venice when they meet a pair of elderly sisters, one of whom claims to be psychic. She insists that she sees the spirit of the Baxters' daughter, who recently drowned. Laura is intrigued, but John resists the idea. He, however, seems to have his own psychic flashes, seei β¦ng their daughter walk the streets in her red cloak, as well as Laura and the sisters on a funeral gondola. (Read More)
Subgenre: | cult filmindependent filmsuspensesupernaturalbritish horrorcult classic |
Themes: | grieffuneralsurrealismmurderdeathmarriagedrinkingdrunkennesssupernatural powerguiltmental illnessblindnesswritingdeath of daughterafterlife β¦death in childbirth (See All) |
Mood: | gorerain |
Locations: | police stationairportchurchhospitalrestauranthotelboatbicyclewaterrural settingcityitaly |
Characters: | police officerfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipchildrenboygirlserial killerpolicemanpriestsister sister relationship β¦villainmaid (See All) |
Period: | 1970s |
Story: | seizureoccultcandlehallucinationunderwearcorpsephotographfemale nuditymale nuditybloodbare breastsfemale frontal nudityflashbackmale frontal nuditysex scene β¦kisscigarette smokingnipplesknifechasethree word titlesurprise endingshowertelephone calltopless female nuditypunctuation in titlefoodhorsemirrorslow motion scenecatarrestbare buttlettervomitingapostrophe in titledead bodycafeprayermale pubic hairsubjective cameraold manambulancewomanbridgeeatingwidowfemale pubic hairnunbathpantyhoseold womandrowningflash forwardbased on short storycharacter's point of view camera shotsuitcasedollstatuereadingdeath of childcity name in titlepursuitsadnessratpsychicitalianfaintingarchitectureloss of loved onebuttocksaccidental deathlossladderfatewhiskeydwarfhaunted by the pastnipplelostdeath of protagonistdead childpolice inspectorbrushing teethriding a bicyclemale objectificationapparitionimperative in titleseanceloss of daughterbroken mirrormarried couplestretchervenice italypremonitionloss of childblind womanmediummotorboatbishopcowgirl sex positionpondbleeding to deathpsychic powerorchestral music scorebriton abroadbloody violencedeath by drowningpsychotronic filmchance meetingdressinggrindhouse filmmurder victimtrancecanalmosaicmental instabilitybritish accentgrievingunhappy endingraincoatgondolastained glass windowfemale star appears nudegiallo esquenude pantyhosescaffoldsibling relationshipmale in a showerdeliberate crueltygrieving mothermusic score features pianoprecognitiondead daughterthe color redtalking with the dead5 year oldartificial respirationspilled drinkstray catgrieving fatherchild drowningringing a bellsleazy giallodyetalking dollwomen's restroomreference to john miltonslashed to deathaccidental drowningmale star appears nudebegins with deathmultiple sex positionsprimal screamsaint nicholasboeing 727woman faintingexsanguinationgrieving parentdrowned bodysecond sightwoman getting dressedapplying mascaraitalian flagrefusing to believechurch restoration (See All) |
A zombie is found aboard a boat off the New York coast which belongs to do a famous scientist. Peter West, a journalist, travels to the Antilles with Ann, the daughter of the scientist. On the way, they meet with with Brian, a ethnologist, and Susan. When they arrive at Matul Island, they find Dr. M β¦enard, and discover a terrifying disease which is turning the islanders into horrifying zombies which devour human flesh and seem indestructible.... (Read More)
Subgenre: | cult filmindependent filmsuspensecreature featuresurvival horrorbody horrorzombie apocalypsezombie survivalitalian horrorsadistic horrorzombie outbreak |
Themes: | murderdeathfeardeath of fatherbrutalitysupernatural powersadismcrueltydeath of wifeapocalypsecannibalismtraumamurder of a police officer |
Mood: | goredarknessblood and gorezombie film |
Locations: | cemeterynew york cityboat |
Characters: | zombiedoctorhusband wife relationshipnurse |
Period: | 1970syear 1979 |
Story: | zombificationvoodooundeadscreamcameraface slapcorpsepistolexplosionfemale nuditybloodnumber in titleviolencebare breastsfemale frontal nudity β¦gunfemale rear nudityfightfemale full frontal nuditynippleschasesurprise endingshowerfireshootoutdigit in titleshot to deathblood splattermirrorshot in the chestshot in the headshotgunslow motion scenegunfightthongbare buttheld at gunpointdead bodyislandsciencemanhattan new york citycombatshot in the backnew yorkmassacrestabbingdeath of friendthroat slittingstabbed in the chestfemale pubic hairsevered headpolice officer killedshot in the foreheadpaincursebeaten to deathscreamingperson on firesevered armspearvirusmutilationgrindhousesharknaked womanend of the worldback from the deadeaten aliveinvasionobesitycannibalmercilessnessgash in the facegunshot woundshot in the facedeath threatstabbed in the headhit on the headexploding headdisembowelmentautopsyblood on shirteye gougingslaughterstabbed in the eyedark pastdeath of loved oneworld trade center manhattan new york cityintestinesliving deadmolotov cocktailhead woundhead blown offblood stainbullet ballethead bashed inscene of the crimestatue of liberty new york citybitten in the neckcrushed headscuba divingcarnagebody bagextreme violenceflesh eating zombiegraphic violencemaggotcut into piecesbloody violencezombie violencepool of bloodpsychotronic filmbreaking through a doorsevered footgrindhouse filmshark attacknewspaper reporteroutbreakzombie attackexploitation filmhead ripped offmad doctortropical islandbitebitten in the throatexit woundbitingdoomsdaypolice officer knocked unconsciousbitten on the armflesh eatingitalian cinemadrive in classiceye injuryinfamygory violenceoxygen tankeast coastvideo nastystab woundsequel by name onlyeating human fleshbitten in the facehell on earthflesh eating zombiesmutilated bodyresident evilzombie bitedeadly diseasenotorietybitten by a zombienude reflected in mirrorwrapped in a bedsheeteye woundzombie invasioneye skeweringhuman eaten by zombiesleg bitingswim capdiving mask (See All) |
Dr. Miranda Grey is a psychiatrist who works in a penitentiary, in the mental institution sector. She is married with Dr. Douglas Grey, the chief of department where Dr. Pete Graham also works. Chloe Sava, a patient of Dr. Miranda formerly abused by her stepfather, claims that she is frequently rape β¦d by the devil in her cell. After leaving the asylum in a stormy night, Dr. Miranda has a car accident, and when she wakes up, she is an inmate of the institution, being accused of an horrible crime and having no memory of the incident. (Read More)
Subgenre: | suspensesupernaturalparanormalpsycho thriller |
Themes: | torturemurderdeathsuicidekidnappingmarriagerapeghostprisonfearescapememorypsychopathsupernatural powerparanoia β¦drug useinsanitymental illnesssurveillanceevilunrequited lovepanicdeath of daughtermissing childescape from prisonthe devilmurder of husbandrape and murder (See All) |
Mood: | nightmaregorerainneo noirslasherdarkness |
Locations: | police stationhospitalswimming poolcarbathtubtaxipolice car |
Characters: | psychiatristdoctorfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshiptattoofemale protagonistserial killernursepolicemanlawyerreference to god β¦killersecurity guardvillainsheriffterrorself mutilationdoctor patient relationshipstepfather stepdaughter relationshipslasher killerserial murdererself immolationself cuttingsuicide by jumping off a bridge (See All) |
Story: | seizurepossessionflashlighthallucinationtearswatching tvcomputercorpsedreampistolexplosionphotographfemale nuditybare chested malesex β¦bloodf ratedviolencefemale frontal nudityinterviewflashbackgunkissfightknifechasesurprise endingshowertelephone callfirecryingcell phoneblood splattercar accidentmirrorshotgunshootingriflerunningcar crashreportersubjective cameraswimmingsurvivalfoot chaseaxevideo camerawomanthroat slittingbridgesuicide attemptprisonerfalse accusationunderwater scenecigar smokingshot in the foreheadattempted murdermicrophonescreamingperson on firefantasy sequencepay phonefugitiveumbrellaevil manlightningattempted rapeinjectionpursuitstalkingdeath of husbandmurderertrustkillingtherapypizzamaniacsyringehypodermic needlegothicheavy rainbarnsecurity camerajail cellpatientbuttocksdesperationpsychorape victimrapistmental institutionbarefootwoman in jeopardyjanitorprison guardpillssurveillance camerathunderdeath threatmental hospitalco workerdelusionmedicationframe uptime lapse photographythunderstormwomen's prisonabsent fatherevidencerainstormfemale doctoraxe murdernervous breakdowncellarkilling spreereckless drivingowlnewspaper clippingframed for murderpsycho killerdead girlmemory lossintimidationgothserial murderpsychopathic killervideo tapebad guymental patientmadmanelectricitykillmental breakdownblackouthomicidal maniacsatanismslashingblood stainspreadeagledenialhearing voiceslistening to a radiostethoscopescalpelfallingwrist slittingroadblockpsychiatric hospitalshockextreme violencecamcordergraphic violenceinmatebloody violenceman on firetrapdoorfemale victimpurgatoryprophetsadistic psychopathelectric chairchainssolitary confinementgas explosionmurder victimcircumcisionsecret roomserial rapistflickering lightcar wreckconnecticutpsycho terrordead husbandjumping off a bridgerepressed memoryhospital gowndisturbingbreaking glassfingerprintsdemonicnew hampshiresedativepenitentiarysadisticdefense attorneyconfinementpsychiatric wardlogiccatatoniatwo killerssinkholeblood pressurecutterinstinctneurosurgeonpsycho filmspontaneous combustionlistening to a car radioholding one's breath underwatercriminally insanedetourfrench shock cinemadependencefreaking outfemale victimsbrake failurehighway patrolmanurban gothicwrist bandagecovered bridgeelectric generatorfootprintsswimming gogglescell blockchained to a bedwoman on firedistorted soundanimal tortureserial rapetemporary insanitymedical restraintsfloodlightbroken car headlight (See All) |
When an eccentric millionaire offer a group of opposites $1,000,000 to spend the night in a so called "Haunted House" with a murderous past, they figure it is a quick way to get quick money and leave. All of them are sure it is some made up story just to mess with their heads a little and test their β¦ courage. But, once they stay in the house they start to think about the mistake they made in coming there when mysterious things start to happen. (Read More)
Subgenre: | black comedyconspiracysupernaturalsurvival horror |
Themes: | couragesurrealismmurderdeathrevengemarriagemoneybetrayalghostdrinkingfeardrunkennessescapedeceptionseduction β¦supernatural powerparanoiainsanitysurveillanceunemploymentself sacrificenear death experience (See All) |
Mood: | goreone nighthorror movie remake |
Locations: | barlos angeles californiabathtubelevatorwheelchaircave |
Characters: | doctorhusband wife relationshipafrican americannursesecurity guardalcoholic |
Period: | 1990s1930s |
Story: | skullknocked outflashlightdecapitationhallucinationwatching tvcomputerpunched in the facecorpsepistolphotographfemale nuditybloodfighttitle spoken by character β¦partyknifechasesurprise endingfirecell phoneshot to deathblood splatterfistfightshot in the chestremakerescuedrinkbrawlheld at gunpointsunglassesbirthdaydemonf wordsubjective camerasurvivaljournalistambushaxeimpalementstabbed to deathstabbed in the chestfalse accusationsevered headdouble crossbirthday partycreaturefemme fataleracial slurflash forwardattempted murderprologuescreamingelectrocutioncharacter's point of view camera shotskeletonbasementhauntingsuspicionhaunted houseriotsurgeryfireplacegothicsecurity cameraeccentriccovered in bloodstrangerfaked deathpresumed deadmental institutioncameobraveryguestimpostorstabbed in the neckbroken glassmental hospitalescape attemptblack and white sceneframe upscene after end creditsbooby trapatticblood on shirtone daybulletproof vestfemale reportersevered legethnic slurcellarsurgeongeekframed for murdersurprise after end creditsgothstabbed in the handfake identityevil spiritabandoned houseroller coastertv reporterbillionairecameramaninsane asylumbubble bathscalpeloffscreen killingpsychiatric hospitalcamcordercut into piecestheme parkhuman experimentinvitationelectric chairpencilstupid victimhillclimbing out a windowmad doctorpoltergeistbullet proof vestcheckgold diggersurgical operationtrophy wifedecomposing bodytorture chamberancestorfragments of glassrich snobdeus ex machinaabandoned hospitalrotting corpseshape shiftingparty invitationdescendantstabbed with a pencilcriminally insanemulti millionairescheming wifereference to jim jonesstrapped to a bedhaunted hospitalpractical jokerex baseball playermovie studio executivestabbed through the necksurgery without anesthetic (See All) |
Across The Universe is a fictional love story set in the 1960s amid the turbulent years of anti-war protest, the struggle for free speech and civil rights, mind exploration and rock and roll. At once gritty, whimsical and highly theatrical, the story moves from high schools and universities in Massa β¦chusetts, Princeton and Ohio to the Lower East Side of Manhattan, the Detroit riots, Vietnam and the dockyards of Liverpool. A combination of live action and animation, the film is paired with many songs by 'The Beatles' (qv) that defined the time. (Read More)
Subgenre: | documentary footagerock musical |
Themes: | police brutalityrevolutionfreedomfuneralsurrealismmurderdeathfriendshipmarriagedrugsjealousypoliticspregnancydrunkennessescape β¦danceartmilitarydepressiondrug useabuseunrequited lovetheatrepanicfalling in lovenear death experiencecheating death (See All) |
Mood: | rainhigh schoolbreaking the fourth wall |
Locations: | cemeteryhelicopterchurchbeachbarhospitalnew york citysnowbusnightclubtaxiwheelchairshiptruckrooftop β¦taxi driverschool busbus stationfire escapecorpse in water (See All) |
Characters: | police arrestinterracial relationshippolice officerhusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipafrican americanfriendboyfriend girlfriend relationshipsingerbrother sister relationshipprostitute β¦teachersoldiernursealienstudentpolicemandancerpriestlawyersister sister relationshipartistsingle motherwaitressprofessoruncle nephew relationshippimpdeath of boy (See All) |
Period: | 1960swinter |
Story: | interracial coupletorchwatching tvpunched in the facecorpseexplosionphotographdancingfemale nuditymale nuditybare chested malebloodf ratedfemale frontal nudity β¦male rear nuditygunkissfemale rear nudityfightcigarette smokingtitle spoken by charactersingingpartychasethree word titletelephone callfirecryingsongtitle directed by femalebeatingmachine gunurinationblondeslow motion scenebattlearrestundressinglettershootingriflebombrunningmarijuanajailbritishclassroomguitarmanhattan new york cityalcoholtelevisionswimmingnewspaperbandconcertcaliforniabasketballmontagearmyimmigrantrock bandsubwayno opening creditsassassinationdrawingunderwater sceneroommatejourneypantyhosenews reportlooking at the cameraimmigrationmicrophoneprotestfantasy sequencetentcollege studentuniversitydomestic violencegymamerican flaginjectioncheerleadercrossdeath of sonrock 'n' rollsadnesspremarital sexclassgraffitipubnewspaper headlineheroinrunawayriotcircusfemale stockinged legssyringeflyinghypodermic needleperformancetitle based on songjail cellguitaristdemonstrationbeardamerican footballhammerbuttocksvietnam warphone boothcomposerburialhitchhikerstreet lifehitchhikingapplehookerjanitorimaginationbloody noseveteranbreakupu.s. armyfanmourninghippieanimated sequencepool tableshot in the facebroken glassnewsreel footagefootball playertheatre audiencemedical examinationabsent fatherdead childbilliardsdrunksketchblack eyechoirsongwritersnowingdressing roombowlingwar veteranbruisemeetingdeath of loved oneillegal immigrantpatriotismmusic bandposterthanksgivinglighthouseanti warclosetdockplaying pooldetroit michiganlockergolf clubblack pantyhoseescalatortelevision newsdeportationstrikehangoverbroken windowclimbing through a windowlaundromatmaking outlsdcornfieldelectric guitarlandladymegaphonetoastdance clubbowling alleybreaking a windowamericanabumhearsepromvolunteerjockdomestic abusedeath of boyfriendmoustacheacoustic guitarcollege campuswashing machinecultural differencepatriotironingtelevision setinfantrythe beatlestour buscounter culturestatue of libertygururadicalloudspeakersmoking potmarchrock singerestranged fatherguard dogdrug triplootingstrawberryletter writingimperialismprotestormuralpassing outcerealrecord producersearch for fatherdog tagreference to martin luther king jr.barricadefloatingliverpoolgiggreenwich village manhattan new york citybiological fatherhigh school danceprotest marchwelderfootball fieldkeyholesexy nurseshipyardsketchingpolitical unrestpsychedeliarepairmanplatoonriot policeafrobus triplocked in a closetmilitary draftwar woundhare krishnathanksgiving dinnerpatrolslow dancingtrippybasic trainingdropoutnude drawingfootball practicepeace signreference to lyndon johnsonchest hairflying machinethanksgiving daydrafttitle sung by characterblack white relationsgreyhound busbleachersbomb makingdelicatessenphysical examreference to brigitte bardoturine samplegraffiti artgospel choirjukebox musicalrecord contractwall paintingprinceton universitysinging to the cameraoutdoor concertphysical examinationprotest songsocial unrestrecord dealwashington square manhattan new york citycollege boundcollege kidmarch on washingtonpicket signrecord executivetranscendental meditationprotest riotdockworkerhomemade bombstreet theaterfloating bodypsychedelic drugreference to jack kerouacanti war movementbus depotdraft noticeex lovers back togetherlesbian attractionlooking at the audiencestudent movementburning paperdayton ohiopacketriotingsliding down a banisterocean wavesolarisationuncle samarmy inductioncranberry saucedouble negative (See All) |
Through a revolutionary technology that unlocks his genetic memories, Callum Lynch (Michael Fassbender) experiences the adventures of his ancestor, Aguilar de Nerha, in 15th Century Spain. Callum discovers he is descended from a mysterious secret society, the Assassins, and amasses incredible knowle β¦dge and skills to take on the oppressive and powerful Templar organization in the present day. (Read More)
Subgenre: | martial artssuspenseconspiracycyberpunkscience fantasy |
Themes: | couragesurrealismmurderdeathrevengekidnappingbetrayalprisonfearescapedeceptionmemoryangerdeath of fatherdeath of mother β¦paranoiatime travelredemptionguiltsurveillanceexecutionexploitationpanicregret (See All) |
Locations: | villagehelicopterchurchdesertlondon englandbicycleelevatorshiprooftoptexaslaboratoryspainrooftop chase |
Characters: | doctorfather son relationshipmother son relationshipfather daughter relationshiptattoosoldierpriesthostagetough guywarrioraction herosecurity guardamerican abroadself mutilationbabe scientist |
Period: | 1980s2010syear 198615th century |
Story: | torchmanipulationknocked outritualgood versus evilhallucinationcomputerpunched in the facecorpseexplosionphotographbare chested malebloodviolenceflashback β¦fighttitle spoken by charactersingingknifechasesurprise endingfirepunctuation in titleshot to deathfistfightmachine gunhorseshot in the chestshot in the headrescueslow motion scenebattleswordbrawlpaintinghand to hand combatbombapostrophe in titlecriminalcombatscientistshot in the backsubjective camerafoot chaseassassinsword fightambushstrangulationaxemassacrebasketballthroat slittingarmyimpalementstabbed to deathmixed martial artsprisonerstabbed in the chestweaponno opening creditsanti heroassassinationdrawingchild in perilfictional wardouble crossshot in the leglatex glovestrainingflash forwardone against manycharacter repeating someone else's dialoguedangerstabbed in the backprologueelectrocutionattackcharacter's point of view camera shotmissionrace against timecover upkicked in the facetough girlscarinjectionneck breakingloss of fathertied upthreatened with a knifemercenaryloss of mothershot in the armsubtitled scenebattlefieldpowerprincestylized violencehenchmanchessrioteavesdroppingropedestinygrenadebow and arrowrevelationspearhypodermic needlehelmetsecurity camerajail cellstabbed in the stomachkicked in the stomachcaucasianjumping from heightvirtual realityfaked deathknightart galleryfateaction heroinefemale killersocial commentaryapplefemale warriorshieldhaunted by the pastprison guardbraverycrossbowstabbed in the throatbased on video gamestabbed in the neckescape attemptoilbible quotestabbed in the legpunched in the chestdark heroaerial shotknife fightconvictknife throwingdark pastcorporationrescue missiondaggernewspaper clippingsouthern accentfemale assassinhistorical fictionfemale fighterparkourworld dominationsecret societyshot with an arrowyoung version of characterarcherytrailer homestabbed in the armemperordeath rowartifactcolonialismman kills a womantrailer parkcrashing through a windowmacguffinpalm treeeaglewoman kills a manfight the systemmadrid spaincathedralmetal detectorhigh techarcherbladerepeated linegeneticstragic pastwoman fights a manwarlordceoreference to adam and eveprison wardenhusband murders wiferelicarmoryevil corporationx rayed skeletonsinistercrypttotalitarianismhorse chasedeoxyribonucleic acidhorse drawn carriagejumping from a rooftopmegacorporationaxe fighthooded figuresecret organizationwoman punches a manflaming arrownightstickancestorvisionarybatontranquilizer dartreference to the bibledartlethal injectionpseudo sciencesultanenforcerspear throwingpublic executionchariotinitiation ritevirtualityfree willdisobediencefree fallbaja californiafree runningresearch facilitydescendantknights templartunictranquilizer guncutlassspanish inquisitionchristopher columbusknife in shoedeath row inmatehidden weaponfight with selfreference to marie curiestrapped to a chair1490syear 1492father son reunited (See All) |
Max Renn runs a TV channel, and when looking for new material to show--he discovers "Videodrome." His girlfriend, Nicki Brand, goes to audition for the show, and Max gets drawn into the underlying plot that uses the show as its front for a global conspiracy.
Subgenre: | cult filmindependent filmsuspenseconspiracyvideocyberpunkbody horrorcorporate conspiracy |
Themes: | torturesurrealismmurderdeathrevengesuicidebetrayalfearescapedeceptionseductionparanoiainsanityexploitationpanic β¦philosophytechnology (See All) |
Mood: | nightmaregoresatireambiguous ending |
Locations: | restauranthotelapartmentusa |
Characters: | psychiatristlustjapaneseprofessorsecretaryself mutilationengineerwriter directorself inflicted gunshot woundsuicide by shootingsuicide by shooting one's self in the head |
Period: | 1980s |
Story: | cult directormanipulationhallucinationface slapcorpsedreampistolexplosionfemale nuditymale nuditybare chested malenuditysexbloodviolence β¦one word titlefemale frontal nudityflashbackmasturbationmale rear nuditygunfemale rear nudityfemale full frontal nuditycigarette smokingtitle spoken by charactersurprise endingfireshot to deathblood splattershot in the chestshot in the headwritten by directorcondombare buttheld at gunpointbombtelevisiontelephonebound and gaggedstrangulationtied to a chaircultanti heroassassinationdouble crossnews reportshot in the foreheadattempted murderlimousinemicrophonedangerfantasy sequenceauditionlong takescarexploding bodypremarital sexshot in the armlove interestwhippingpizzapornographyrevelationelectronic music scoregothicshot in the stomachscene during opening creditsred dresstied to a bedmediavideotapecovered in bloodgrindhousevirtual realitysadomasochismmind controlmilksocial commentarywhipdark humordisembowelmentperversionalternate realitycorporationkilling spreegothintestinesvideo tapemysterious manbrainwashingworld dominationnight visionelectronic musicblack marketradio stationpiercingpornographersnuff filmfight the systemfilmed killinghomeless persontelevision setceomurder spreephilosophersocial decayvcrextreme close upman slaps a womanshoulder holstersex on first dateman slaps womanreference to sigmund freudhidden guntv stationtalk show hosttumorgarroteman hits womanconferencejamaicanhand through chestvisionaryradio hostactress breaking typecastremadeabsurd violenceheadsetsubliminal messagetrailer narrated by percy rodriguezacting musiciancanuxploitationabandoned shipentrailssatellite dishassimilationvirtualityabandoned churchillegalityspectacleshole in chestpinunderground pornographymovie reality crossovervideo recordercable tvtv show within a filmtrade showtelevision executiveblurred boundariesboat yardopticiangimp masktoronto canadapirate broadcastsatellite televisiontelevision as portaldesensitizationvideo libraryagony aunt (See All) |
In the final days of World War II, the Nazis attempt to use black magic to aid their dying cause. The Allies raid the camp where the ceremony is taking place, but not before a demon - Hellboy - has already been conjured. Joining the Allied forces, Hellboy eventually grows to adulthood, serving the c β¦ause of good rather than evil. (Read More)
Subgenre: | martial artsblack comedysuperheroparanormal phenomenasteampunkparanormal investigation |
Themes: | magicfuneralmurderherowrestlingapocalypse |
Locations: | cemeterynew york cityrussiamuseumtunnel |
Characters: | love triangleaction heroprofessorself mutilation |
Period: | world war two1940s |
Story: | black magicceremonysouloccultgood versus evilface slapcorpsepistolexplosionbloodcharacter name in titleone word titletitle spoken by characterfireshootout β¦shot to deathfistfightcar accidentbattleswordgunfightbrawlfalling from heightbased on comicshowdownhand to hand combatdemonrevolverhalloweenassassinsword fightbased on comic booknew yorkthroat slittingimpalementstabbed to deathmixed martial artsstabbed in the chestsubwaybrunetteno opening creditsanti heroone man armyhit by a carunderwater scenecigar smokingshot in the legone against manygravestabbed in the backfbiperson on fireelectrocutionpay phonecover upkicked in the faceopening action sceneshot in the shoulderexploding bodytrapfirst partdestinygrenademutantfbi agentexploding buildingsevered handmilkcrushed to deatheaten alivemental institutionreverse footagevisionstabbed in the throatresurrectiontitle appears in writingfather figureaquariumstabbed in the legdisfigurementwilhelm screamsurprise after end creditstelepathytorso cut in halfcartoon on tvoutcastportaltrafficmegalomaniacstabbed in the armkittenhanged manrepeated lineroofgarbage truckcarouselalternate dimensionhit by a trainrosarydecomposing bodyrubik's cubenarration from the gravesevered tongueclairvoyancecandy barpyrokinesisfighting in the airslide locked backtinnitusdark horse comicsnazi occultismmale soldierman eating monsterreanimated corpseinterspecies romancenazi experimentsecret government organisationsix packoccult detectiveowning many catscombat photographymoldaviawebbed fingersaquatic humanoidbreathing apparatustentacled monsterblue flameshumanoid demon (See All) |
Following up the previous Nightmare film, the dream demon Freddy Krueger is resurrected from his apparent demise, and rapidly tracks down and kills all three of the surviving Elm Street kids. However, Kristen (who has the ability to draw others into her dreams) wills her special ability to her frien β¦d Alice before her demise. Afterwords, Alice soon realizes that Freddy is taking advantage of that unknown power she now wields to pull a new group of teenage children into his foul domain. (Read More)
Subgenre: | cult filmindependent filmmartial artsblack comedysuspensesupernaturalparanormalamerican horror |
Themes: | funeralmurderrevengepsychopathsupernatural powerevil |
Mood: | nightmaregorerainhigh schoolslasher |
Locations: | cemeterybeachhospitalsmall townelevatorschool nurseblood in water |
Characters: | father son relationshipfather daughter relationshipteenagermother daughter relationshipafrican americanbrother sister relationshipserial killertough guylittle girlwaitresskillervillainterrorslasher killerserial murderer |
Period: | 1980s |
Story: | soulundeadcoffinpunched in the faceface slapcorpsedreamphotographbare chested malebloodnumber in titlesequelfemale frontal nuditydogcigarette smoking β¦surprise endingfiredigit in titleblood splatterurinationplace name in titlerock musiccar crashneighbornumbered sequeldemonambulancedeath of friendstabbed to deathdinerstabbed in the chestsevered headcharacter repeating someone else's dialoguelocker roomwidowerperson on firepay phoneevil mankicked in the faceskeletondeath of brothercheerleaderdeath of songlassesmurdererunderwatersevered armsleepingkillingpizzamaniacsurgeryteen angstelectronic music scoreslow motionwoman with glasseslifting someone into the airmutilationstabbed in the stomachkicked in the stomachfourth partmovie theatercrushed to deathback from the deadrampageseriesresurrectionbutcherstabbed in the headblack and white scenedaydreamdisfigurementabusive fatherlooking at self in mirrorbroken armkilling spreepsycho killerserial murdervillain played by lead actorpsychopathic killerbad guyreturning character killed offneedlejunkyardohiodefecationold dark housecockroachevil spirithomicidal maniacbugweightliftingclimbing through a windowfish tankslashingbroken mirrorasthmaburnt facebody in a trunkdripping bloodafrican american womanpunching bagjockdeath of boyfriendhome videoclawsadistic psychopathburn victimmurder spreetime loopbutcheryplant in titlehead ripped offreturning character with different actorwater fountainfedoralifting female in airbandanaglovetroubled teendeja vufalling through the floorman dressed as womanpayphonereanimationcrushed by a cardaydreamingrepeated eventfalling asleepchild killersleeping pillsbitten on the armchild murdererhand through chestdisturbingtorturerafrican american mandemonicoverprotective fatherstreet in titleboiler roomsadisticsequel to cult filmreference to aristotledrive in classicserial child killerwaterbedlucid dreamdead body in waterthrown through a wallburn scarpin upsandcastlefreddy kruegerreflection in watertumbleweeddart boardserial teen killerbitten by a doghand through headnunchuckreflection in car mirrordog urinationtheatre marqueeasleep at the wheelloss of best friendhole through torsoserial child murderelm streetspringwood ohiofilm starts with a quotepin up girlserial child murdererfemale stuck in sticky substanceproducer cameofalling asleep in classscar tissuevolkswagen cargrumpy father (See All) |
Ash is transported with his car to 1,300 A.D., where he is captured by Lord Arthur and turned slave with Duke Henry the Red and a couple of his men. When Ash is thrown into a pit, he defeats two monsters and wins respect of Arthur's army and vassals. The Wiseman points Ash as The Chosen One that wil β¦l retrieve the Necronomicon but Ash is only interested in returning home. When he learns that the only way to return to his time is using the Necronomicon, Ash decides to travel to the unholy land of the Deadites. The Wiseman advises that he must say the words "Klaatu Barada Nikto" to safely get the evil book. However, Ash forgets the last word and an army of the dead resurrects to attack Arthur fortress and recover the Necronomicon. The battle between the living and the dead is about to start and the support of Henry the Red is the only way to help Ash and Arthur to defeat the army of darkness. (Read More)
Subgenre: | cult filmmartial artsblack comedyabsurdismsword and sorceryepicslapstick comedyfish out of watersteampunkdark fantasysword and fantasy |
Themes: | magicsurrealismfearmonsterherosupernatural powertime travelevilpanicbook of evil |
Mood: | gorespoofavant gardesequel to cult horror |
Locations: | cemeteryforestcardesertwoodsenglandcastle |
Characters: | zombiesoldiertough guywarrioraction herowitch |
Period: | 1990s20th centuryyear 1992 |
Story: | chainedtorchskullundeadcult directorscreampossessiongraveyardgood versus evildecapitationface slapbloodnuditysexviolence β¦bare breastssequelkissfightsingingchasethree word titlesurprise endingvoice over narrationblood splatterfistfighthorsecar accidentmirrorshotgunbattleswordbookhand to hand combatrunningdemonfightingcombatsword fightambushaxearmyimpalementmixed martial artsprisoneranti herodisarming someoneone man armyfictional warcreaturesearchthird partgunshotduelone against manycurseprologueuniformactor playing multiple rolesstatuelightningopening action sceneskeletonscarautomobilecabindismembermentbattlefieldstylized violencechainsawfireplacebow and arrowspearfarcequestcaptivesevered handknightgun fuslavefull moondamsel in distressreverse footageshieldexplosivethundercrossbowwhiphit in the crotchshot in the faceprophecypsychotronicmedieval timesarmorh.p. lovecraftsiegekingdomsword dueltragic herosequel to cult favoritearrowspelldoppelgangerlevitationgatespit in the facefreakarcherydouble barreled shotgunbeastfortressreluctant heroone linergun violencetrampolinewindmillgravestoneblacksmithpigtailstongue in cheekbagpipeschosen onepitwinchester riflerepeating rifleshot with a bow and arrowalternate versionmistbattle axecult figureogrechemistryflaming arrowdukeprosthetic limbevil twincartcatapultvortexbannerevil deadbattering ramover the topsame actor playing two charactersnecronomiconpart stop motionanvilbraidslanceanimate objectminiature personhorseback14th centuryalternate endingsame actor playing two characters simultaneously on screencult film reference1300shuman duplicationenchantmentbook of the deadsalesclerkcitadelhead spinoldsmobileanimate skeletondiscount storedemonic undeadvoice over flashbackwise manskeleton warriorartificial handportcullistwo headed personmetal handwar crychainmailsumerian (See All) |
A young girl (Baby Doll) is locked away in a mental asylum by her abusive stepfather where she will undergo a lobotomy in five days' time. Faced with unimaginable odds, she retreats to a fantastical world in her imagination where she and four other female inmates at the asylum, plot to escape the fa β¦cility. The lines between reality and fantasy blur as Baby Doll and her four companions, as well as a mysterious guide, fight to retrieve the five items they need that will allow them to break free from their captors before it's too late... (Read More)
Subgenre: | cult filmmartial artstragedysteampunkcaper |
Themes: | funeralsurrealismmurderdeathbetrayalescapedancegangstersurveillanceself sacrificesamurai |
Mood: | satire |
Locations: | helicoptertrainsnowbuskitchencastlestrip clubbrothelbus driverbus stationtrain explosion |
Characters: | police officerzombiedoctorpoliceprostitutefemale protagonistsoldierdancerpriesthostagesister sister relationshipwarriorsecurity guardteacher student relationship β¦snipermayorsniper riflepimp (See All) |
Story: | coffincandleflashlightdecapitationhallucinationpunched in the faceface slapcorpsedreampistolexplosiondancingbloodf ratedviolence β¦flashbacktwo word titlegunknifechasesurprise endingfirevoice over narrationshootoutshot to deathblood splattermachine gunshot in the chestshot in the headshotgunrescueslow motion scenebattleswordarrestfalling from heightrifleheld at gunpointhand to hand combatbombbathroomrobotdemonprostitutionhandcuffscombatshot in the backfoot chasesword fightdeath of friendthroat slittingstabbed to deathstabbed in the chestmapnonlinear timelinechild abusesevered headno opening creditsradiocreaturecigar smokingshot in the legshot in the foreheadstabbed in the backprologuekeymini skirtmissiondragonrace against timeevil mankicked in the faceattempted rapeshot in the shoulderexploding bodyworld war onethreatened with a knifesilencerbattlefieldmissilebow and arrowkilling an animalheavy rainsexual abusecooksecurity cameratemplekicked in the stomachtherapistplanetgiantlaserrocket launcherrapistanimal attackback from the deadfemale warriorgas maskcyborgmental institutiondiamondimaginationexplosivecrossbowkatana swordgash in the facestabbed in the neckresurrectionshot in the facemental hospitalstabbed in the headthunderstormstabbed in the legpunched in the chestschool uniformsexploitationdynamiteaccidental killingdeath of sisterblack eyehologramalternate realityschoolgirl uniformstabbed in the eyedressing roomsevered leggatling gunlaser gunbullet timecrowtorso cut in halfclose up of eyesfemale assassingiant robotkatanafire extinguisherswastikamolotov cocktailtimebombspit in the facefemale bondingpistol whipsuper strengthalarmmini dresslighterstepfatherplane crashflareinsane asylumshot in the eyeblackboardshort skirtshot point blankguardiantop secretbomberforgeryfighter planebiplaneexploding airplaneclimbing out a windowknocked out with a gun buttalice in wonderlandtrenchstarts with narrationdojosexual predatorvermontcovert operationfemale pilotdark heroinebody torn apartfemale empowermentminiskirtpunched in the crotchextreme closeupexploding planefire breathing dragonlobotomyeye candylooking through a keyholeblimpkicked in the ballsstomach ripped openinside the mindescapeegirl gangescape plantelescopic rifleexploding trainflying dragonaerial bombardmentdream sequence within a dream sequenceknocked out with gun buttdesk bellhit with a gun butthit on the head with a riflehuman versus dragonbody landing on carmaster keythigh high sockstriplanesliding down a drain pipe (See All) |
300 years have passed since the Sanderson sisters were executed for practicing dark witchcraft. Returning to life thanks to a combination of a spell spoken before their demise and the accidental actions of Max, the new-kid-in-town, the sisters have but one night to secure their continuing existence. β¦.. (Read More)
Subgenre: | cult film |
Themes: | magicrevengeghostfearangersupernatural powerhumiliationunrequited lovefalling in lovebook of magic |
Mood: | high school |
Locations: | cemeterymotorcyclemuseumsewer |
Characters: | zombiebrother sister relationshipteenage girlteenage boysister sister relationshiplittle girlbullywitchevil witch |
Period: | 1990s17th century1700s |
Story: | potiontorchspiderundeadscreamcandlegood versus evildecapitationtwo word titlecigarette smokingtitle spoken by charactersingingsurprise endingfirecrying β¦catbedsubjective camerahalloweenhousetied to a chairtransformationpainvirginproduct placementdeath of childscene during end creditshanginghalloween costumecabinhaunted housefalling down stairsburned alivetalking animallifting someone into the airhatwitchcraftsevered fingerrejectionimmortalityhypnosischairhalloween partyarrogancemale virginspellcandydead animaltrick or treatingdoubtlighterbicyclingtombstonecottageshoerhyme in titlecabin in the woodssunrisewarningnoosebus rideblack catpillowsaltlobsterwitch costumeliquidhorror for childrenvillain turns goodovensittingtelephone numberhuman becoming an animalchild killerturned to stonedevil costumelifting a female into the airroadkillcaged humanspit taketalking catchased by a dogevil laughterpet foodblown coverflying broomcurseddisbelieving adultlightingsiren the alarmsiren the creaturedracula costumefire sprinklerspellcastingdrum setmouth sewn shutbeheadeddeath by poisonfuture shockmagical booksmashed pumpkininterrupted kissreference to madonna the singermanhole coversalem massachusettsmagical broomstickwitch burningkilnrevenantsacred groundtoilet paperingyouth restoredselling soulpoliceman costumedaylight saving timedeath by sunriseexploding personfiery redheadflattenedforced to danceevil musicrenaissance costume (See All) |
PRIEST, a post-apocalyptic sci-fi thriller, is set in an alternate world -- one ravaged by centuries of war between man and vampires. The story revolves around a legendary Warrior Priest from the last Vampire War who now lives in obscurity among the other downtrodden human inhabitants in walled-in d β¦ystopian cities ruled by the Church. When his niece is abducted by a murderous pack of vampires, Priest breaks his sacred vows to venture out on a quest to find her before they turn her into one of them. He is joined on his crusade by his niece's boyfriend, a trigger-fingered young wasteland sheriff, and a former Warrior Priestess who possesses otherworldly fighting skills. (Read More)
Subgenre: | martial artspost apocalypsedystopiacyberpunkchrist allegory |
Themes: | funeraltorturereligionmurderdeathrevengekidnappingbetrayalmonsterherodeceptiondeath of fatherdeath of motherredemptionhome invasion β¦justiceself sacrificeghost town (See All) |
Mood: | nightmaregorenightdarknesspoetic justice |
Locations: | cemeterychurchbartrainmotorcyclesmall towndesertelevatorcitycavetownbar brawlmotorcycle chasetrain explosionwalled city |
Characters: | husband wife relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoobrother brother relationshippriesthostagetough guychristianvampirewarrioraction herovillainbible β¦sheriffuncle niece relationshipex soldierhuman versus monsterfacial tattoo (See All) |
Period: | future |
Story: | oil lampskullmachetecoffinflashlightgood versus evildecapitationpunched in the facecorpseexplosionphotographbare chested malebloodcharacter name in titlebased on novel β¦violenceone word titleflashbackgunfightcigarette smokingtitle spoken by characterknifechasesurprise endingfirevoice over narrationshootoutbeatingblood splatterfistfightmachine gunshot in the chestshotgunrescuebattlebrawlfalling from heightbased on comicshowdownheld at gunpointhand to hand combatinterrogationcombatkung fusurvivalbased on comic bookambushmassacremountainthroat slittingimpalementstabbed to deathstabbed in the chestweaponsevered headno opening creditsanti heroone man armyfictional warcreaturetransformationon the runconfessionone against manycharacter repeating someone else's dialoguebeaten to deathstabbed in the backprologuespiritualityperson on fireelectrocutionattackbased on mangamissionrace against timedollstatuekicked in the facetough girllightningfarmerscardeath of brothercrossexploding bodyneck breakingthreatened with a knifecabinmercenarychickensevered armvigilantestylized violencestrong female characterbulletkilling an animalrevelationhead buttheavy rainmutantcowboy hatjail cellcrucifixkicked in the stomachnosebleedasian womanjumping from heightcovered in bloodhonoraction heroineanimal attackcrushed to deathsocial commentarybar fighteaten alivepresumed deadfemale warriorfull moonguarddamsel in distresstarget practiceveteransandcrossbowteamanimated sequence3 dimensionalgash in the facestabbed in the leg3dpunched in the chestdark herodynamitejumping through a windowdisembowelmentblood on shirtfascismboyfriendknife throwingdark pastlanternmutationgadgetsevered legcellardaggertorso cut in halftracking devicefemale soldierprayingcrucifixionruinsvigilantismparkourworld dominationconfessionalshot with an arrowmegalomaniacflask18 year oldflarequitting a jobgramophonepocket watchvigilante justicebased on graphic novelbitten in the neckmeat cleaveracrobatstabbed in the shoulderfight the systembladerepeated linesuperhuman strengthtragic pastsubterraneancut into piecestrapdoornight timemass gravevampire hunterone woman armypsychotronic filmanti heroinegogglesman with no nameacrobaticssome scenes animatedvampire slayerstarts with narrationhit by a trainwire fubritish actor playing american characterpassenger traintrain conductorcoming out of retirementmotorcycle stuntnieceexploding motorcyclecouncilinsubordinationoutpostalternate worldtrain wreckclergytrackinggeiger countertotalitarianknife in chestsuperhuman speedtrain derailmentexploding trainhit by a motorcyclefight on train roofhuntressmonolithsolar panelblack hathiveriding motorcyclehuman versus vampireopening credits18 year old girldisobeyfall through floorvampire queengiant statuelong haired womanwoman with long hairfemale vampire hunter (See All) |