Best popular movies like Bloody Summer Camp:

Do you need specific genre & keyword selection to find films similar to Bloody Summer Camp?
<< FIND THEM HERE! >>

Bloody Summer Camp (2021)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Bloody Summer Camp (2021)

In 1986, counsellors at Camp Trustfall are preparing for the new summer. It's all fun and games until one of the new counsellors goes missing. Now, an evil lurks in the darkness. Is it the camp legend come to life or does someone else have an axe to grind?​

Themes:
home invasionevil
Mood:
slashergore
Locations:
wheelchairwoods
Characters:
writer directorkiller
Period:
80s
Story:
tire ironurban legendfun and gamescamp directorsummer campwheelchair boundboobownerjokescut outskippinggoryurbanfansruin β€¦tirefunironcheckkidsjockvehiclemissingtributepervertcastrationfaninvasioncamplegendaxerunningmaskpartyblood (See All)

Urban Legend (1998)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Urban Legend (1998)

Urban Legend tells the story of a group of pretty college students at a remote New England university. The focus of the story is Natalie, a beautiful, academically-gifted student at the fictional Pendleton University. Natalie and her friends are all involved in the Folklore class being taught by Pro β€¦fessor Wexler. Wexler regales his class with urban legends, which include Pendleton's own urban legend about a Psych professor who murdered six students at Stanley Hall 25 years ago. Natalie is the first one to suspect there's a killer on campus, especially after she has ties to all of the victims. No one, including her friends, Wexler, Dean Adams and security guard, of course, believes her until it's too late. Now she finds that she and her friends are part of the killer's ultimate urban legend. (Read More)

Subgenre:
slasher flickteen movieteen horror
Themes:
murderdeathrevengepsychopath
Mood:
slashergoreraincar chase
Locations:
swimming poolgas stationsinging in a car
Characters:
killerteenagerfriendfemale protagonistserial killersecurity guardprofessormysterious killer
Story:
urban legendurbanlegendaxepartybloodviolenceflashbackgunsex scenesingingchasesurprise endingpistolcorpse β€¦blood splattercomputerfalling from heightvomitingcollegetelephonedecapitationjournalistbound and gaggedcandlestrangulationdeath of friendbridgeimpalementradioroommateproduct placementlightninghangingsuspicionfirst partgothicheavy rainlifting someone into the airtied to a bedstabbed in the stomachvillainessjournalismparking garagefemale killerjanitorrear entry sexthunderstormrainstormaxe murdercharacters killed one by onecar troublescene before opening creditsfemale psychopathradio stationspreadeaglefraternitybody in a trunkscalpelcampusdisc jockeycollege campusorchestral music scoregoth girloff screen murdervillain not really dead clichered herringmicrowave ovenpoodledorm roomfall to deathfemale serial killermicrowavepepsitalk radiodead teenagerradio hosthanged boyconvicted felondark and stormy nightchat roomsource musicyelling for helproommate issueslifting a male into the airdead body in a car trunkradio talk showshot with a guncollege roommatecry for helpcall for helploss of best friendcrying for helpbody in a car trunksinging along with radiostuck during sexwest highland white terrierkilled in a carradio call in showfalse scareradio callerthrown through windshieldannoying roommate (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Final Girls (2015)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Final Girls (2015)

When Max (Taissa Farmiga) and her friends reluctantly attend a tribute screening of an infamous '80s slasher film that starred Max's late mother (Malin Akerman), they are accidentally sucked into the silver screen. They soon realize they are trapped inside the cult classic movie and must team up wit β€¦h the fictional and ill-fated "Camp Bloodbath" counselors, including Max's mom as the shy scream queen, to battle the film's machete-wielding, masked killer. With the body count rising in scene after iconic scene, who will be THE FINAL GIRLS left standing and live to escape this film? (Read More)

Subgenre:
independent filmslasher flickteen moviesurvival horrorteen horrorhorror spoofslasher spoofhorror comedyslasher horrorhorror parody
Themes:
murderdeathfriendshiprevengesurrealismkidnappingfearescapevoyeurismseductionbrutalitydeath of mothertime travelbullyingpanic β€¦self sacrificenear death experience (See All)
Mood:
slashersatirespoofhigh schoolparodyambiguous ending
Locations:
woodshospitalforestsinging in a car
Characters:
killerhomosexualteenagermother daughter relationshipdoctortattooteenage girlteenage boyfemale protagonistgirlserial killernursehostagemotherex boyfriend ex girlfriend relationship β€¦parent child relationshipslasher killerself referentialparty girl (See All)
Period:
1980syear 1986year 1987
Story:
urban legendsummer campfansfunjocktributecampviolenceflashbacktwo word titlebare chested malecigarette smokingdancingexplosionknife β€¦chasethree word titlesurprise endingpantiesfirecell phoneshot to deathcar accidentshot in the chestblonderescueslow motion sceneundressingvomitingshowdowncar crashvoyeurf worddecapitationgood versus evilcleavagesurvivalfoot chasegay slurorphansword fightambushmontageimpalementstabbed to deathdinerstabbed in the chestaccidentwhite pantiesexploding carbrunettedrivingsevered headscantily clad femalehit by a cardouble crossvanflash forwardattempted murdervirgindangerstabbed in the backprologuescreamingstripteaseperson on firerace against timelightningprankscarhigh school studentfilm within a filmneck breakingrecord playergirl in pantiesbow and arrowelectronic music scoremacheteslow motionbarnwatching a moviemovie theaterlosshome movievirginitymasked manpresumed deadtarget practiceplayboy magazinemercilessnessescape attemptblack and white scenecigarette lighterjumping through a windowblack and whitebooby trapknife fightfogdisfigurementknife throwinggasolinedark pastbody countcharacters killed one by onegeekmasked killerteleportationporn magazineface maskfinal showdownbloopers during creditsmovie actressfilm in filmshot with an arrowhospital bedcigaretteone linerman kills a womanretrowoman kills a mansole black character dies clichelighting a cigaretteopen endedoverturning carsome scenes in black and whitetragic pastiphonepsychotronic filmburn victimcar rolloverstupid victimclimbing out a windowgrindhouse filmwalkmanfirecrackerzippo lightervinyldeja vuslow motion action scenebear trapsexual innuendohigh school seniorsing alongdouble entendreflaming arrowrubik's cubefake trailerminiskirttime travelerplanningthrown through a windshieldouthousemetascream queenvolkswagen buscamp counselorouttakes during end creditsyear 1957murder by stabbingprank gone wronghorror filmmovie reality crossoverface burntasting bloodshackledmetafictiontotem polegender in titlereference to loch ness monsterslashed to deathtrip and fallbig hairreference to bigfootneo 80sclothes on fireopening creditsunpaid billtime jumpreference to bon jovithrown through the airblood spattered facedistracted driver (See All)

Henry: Portrait Of A Serial Killer (1986)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Henry: Portrait Of A Serial Killer (1986)

Loosely based on serial killer 'Henry Lee Lucas' (qv), the film follows Henry and his roommate Otis who Henry introduces to murdering randomly selected people. The killing spree depicted in the film starts after Otis' sister Becky comes to stay with them. The people they kill are strangers and in on β€¦e particularly gruesome attack, kill all three members of a family during a home invasion. Henry lacks compassion in everything he does and isn't the kind to leave behind witnesses - of any kind. (Read More)

Subgenre:
independent filmcult filmpsycho thrilleramerican horrorindependent horror
Themes:
home invasionevilmurderdeathdrugsrapetortureincestpsychopathbrutalityinsanityexploitationmurder of family
Mood:
slashergore
Locations:
chicago illinois
Characters:
killerbrother sister relationshipprostituteserial killervillainterrorslasher killermysterious villainserial murderermurder of a prostitute
Period:
1980s
Story:
pervertinvasionbloodfemale nuditycharacter name in titlenudityviolencebare breastsgunsurprise endingshot to deathblood splattershot in the chestlow budget film β€¦marijuanacriminaldecapitationbisexualstrangulationvideo camerastabbingdrug dealerstabbed to deathstabbed in the chestchild abusesevered headcontroversypantyhosestalkerevil manattempted rapestalkingneck breakingdismembermentkillingsplattermaniacfemale stockinged legsragemutilationstabbed in the stomachpsychorapistrampagelow budgetdark humorbutcherpsychotronicperversionmurder of a childslaughterstabbed in the eyeabusive fatherbody countkilling spreepsycho killerserial murdervillain played by lead actorpsychopathic killerbad guymadmanmysterious mankillhuman monstersexual violencehomicidal maniacslashingnaked dead womanextreme violencevideo footagematricideknife murdercut into piecessadistic psychopathoff screen murderchild rapemurder of a nude womanmurder spreebroken neckdisturbed individualbutcherygrindhouse filmexploitation filmcrime spreecreepdead woman on floorwoman's neck brokenpsycho terrorbased on supposedly true storydead prostitutesadisticsickofemale hitchhikermurderer duotwo killersmutilated bodygraphic rapesex maniaclead actor's first filmdead woman on toiletdead woman wearing lingerie (See All)

Seed Of Chucky (2004) is one of the best movies like Bloody Summer Camp (2021)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Seed Of Chucky (2004)

The killer doll is back! Glen, the orphan doll offspring of the irrepressible devilish-doll-come-to-life Chucky and his equally twisted bride Tiffany. When production starts on a movie detailing the urban legend of his parents' lethal exploits, Glen heads for Hollywood where he brings his bloodthirs β€¦ty parents back from the dead. The family dynamics are far from perfect as Chucky and Tiffany go Hollywood and get rolling on a new spree of murderous mayhem; much to gentle Glen's horror. Chucky can't believe that his child doesn't want to walk in his murdering footsteps, and star-struck Tiffany can't believe that the movie will star her favorite actress, Jennifer Tilly, who soon becomes an unwitting hostess to this new family in more ways than one... (Read More)

Subgenre:
martial artsblack comedy
Themes:
evilmurderkidnappingpregnancyescapefilmmaking
Mood:
slashergore
Locations:
hospitalcemeterylos angeles californiaengland
Characters:
killerfather son relationshippolicemother son relationshipserial killeractressdirector
Period:
1990s2000syear 1998
Story:
urban legendurbancamplegendfemale nuditycharacter name in titleviolencesequelmasturbationsurprise endingshowercar accidentface slapslow motion scenereenactment β€¦vomitingsubjective cameradecapitationbound and gaggedstabbingdream sequencebirthday partylimousinefired from the jobperson on fireauditionpossessionscreamratsevered armloss of motherobscene finger gesturetwindismembermentoccultgothicinterracial romancedisembowelmentsexual humoraxe murderfifth partchauffeuracidwetting pantspatricidepaparazzihollywood signdarkroomartificial inseminationvillain not really dead clichesanta claus suitventriloquistset on fireevil dollhermaphroditereference to britney spearsnightiecandy barkiller dollreference to martha stewartincantationimmoralitytwo killersvixenvictim invited to dinneranimate dollevil versus evilmultiple birthturkey bastertwelve step programreference to john waters (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Candyman (1992)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Candyman (1992)

Helen Lyle is a student who decides to write a thesis about local legends and myths. She visits a part of the town, where she learns about the legend of the Candyman, a one-armed man who appears when you say his name five times, in front of a mirror. Of course, Helen doesn't believe all this stuff,  β€¦but the people of the area are really afraid. When she ignores their warnings and begins her investigation in the places that he is rumored to appear, a series of horrible murders begins. Could the legend be true? (Read More)

Subgenre:
cult film
Themes:
revengekidnappingbetrayalghostprisonfearescapefuneralartinvestigationseductionangerpsychopathgriefabduction
Mood:
slashergore
Locations:
wheelchairschoolelevatorapartmentchicago illinoisslum
Characters:
policeboyfriend girlfriend relationshipserial killerphotographerartistlittle boymotherpsychiatrist
Story:
urban legendcastrationlegendrunningbloodfemale nuditycharacter name in titleone word titledogkisscigarette smokingtitle spoken by charactersurprise endingfire β€¦beatingcorpsemirrorpaintingcollegetelephonetoiletfalse accusationdrivingcultbathgravestabbed in the backscreamingperson on firegraffitichild murderburned alivenipples visible through clothinggothicslow motionlifting someone into the aircovered in bloodparking garagemental institutionhatredmakeupbathingghettoblack eyedisfigurementbonfireframed for murdermental patientyellingtaking a photographlevitationneedlefolkloreforced to stripdead animalkilling a dogdiscoverybeeabandonmentgang violenceframedurban decaykidamputationbeliefmacabrealtarsecret passageaggressionhookbudweiserlifting female in airmuralhidden roomdead babyslide projectorrottweilerpublic restroomtall mandeath of doghousing projectlifting an adult into the airpast lifecheating on wifelynch mobfalse accusation of murderswarmdisbeliefdisembodied voicepolice lineupsociologistapartment complexaccused of murderfilthraw meatkiller beemedicine cabinetviciousnessbathroom mirrorbloody maryafter lifehook for a handhole in a wallabusive policemanloathingrepulsioncandymanloss of penisvacant apartmentdisbelieving authorityburnt hairhypnotized cast (See All)

Friday The 13th Part 2 (1981)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th Part 2 (1981)

Months after Alice beheaded psycho killer/mother Pamela Voorhees at Camp Crystal Lake, survivor Alice is still traumatized because of the murders. But there is one problem. Mrs. Voorhee's son Jason never drowned and died.So he saw Alice behead Mrs. Voorhees. Jason finds Alice soon and murders her. F β€¦ive years later a camp counselor in training program begins at Campanack Lodge. Right near Jason's home.Camp Crystal Lake. As teenagers in the program start snooping around Camp Crystal Lake, they start getting killed violently one by one. (Read More)

Subgenre:
cult filmsuspenseb horrorpsycho thrilleramerican horrorindependent horror
Themes:
evilmurderdeathfearpsychopathbrutalityinsanityexploitation
Mood:
slashergoredarkness
Locations:
wheelchairwoodspolice carlakecampfirebackwoodsrunning through the woodschase in the woods
Characters:
killerteenagerboyfriend girlfriend relationshipserial killervillainterrorslasher killermysterious villainserial murderermysterious killer
Period:
1980ssummeryear 1984
Story:
summer campcampmaskbloodsexfemale nuditynumber in titleviolencesequelfemale frontal nudityflashbackkissfightnipples β€¦surprise endingpantiestelephone callcorpsedigit in titleblood splatterblondeslow motion scenecatbikinisecond partdead bodynumbered sequelsubjective cameraswimmingdecapitationbrastrangulationmassacrethroat slittingimpalementjokesevered headcontroversyskinny dippingstalkerprologuecharacter's point of view camera shotevil manopening action sceneconvertiblestalkingmurdererobscene finger gesturelove interestkissing while having sexkillingsplatterchessmaniacchainsawfireplacespearnipples visible through clothingmass murdergothicmachetelifting someone into the airragemutilationvillainessphone boothgrindhousevictimmasked manrampageredneckbra and pantiesnew jerseyhit in the crotchbutcherpsychotronicstabbed in the headslaughterbetrefrigeratorbody countlens flarecharacters killed one by onekilling spreepsychoticmasked killerpsycho killernude swimmingserial murderpsychopathic killerbad guycar troublemadmanmysterious manreturning character killed offhuman monsterfreakskirtsexual violencehomicidal maniacslashingwetting pantshillbillyday in titletow truckparaplegicorchestral music scoremultiple murdermasked villainknife murderpitchforkbloody violencesole survivorlunaticsadistic psychopathpsychotronic filmmurder of a nude womanmurder spreedying during sexvillain not really dead clichebutcherygrindhouse filmcrime spreecreepkilled during sexmystery killershackmultiple homicidepsycho terrorweirdodisturbinglifting a female into the airtrailtorturerhanged boygiallo esquesadisticsequel to cult filmboogeymandrive in classiceast coasthorror movie remadesickolost dogice pickcampfire storygruesomejason voorheesdouble impalementbad jokefriday the thirteenthatonal music scoreurinating in fearmachete mutilationtea kettleviolentbrutaltrailer narrated by don lafontainegarrottingtoasting marshmallowssymphonic music scorewessex county new jerseycrystal lake new jerseychild psychologyfade to whitesack maskscare involving catserial teen murdererkilled by machetemenstrual cycledefy authorityfalse scarehand on shoulder scarelatex mask (See All)

Friday The 13th (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th (2009)

A group of young adults set up tent near the abandoned summer camp where a series of gruesome murders are said to have taken place back in 1980. The perpetrator was a grieving mother, driven insane by the drowning of her child, Jason, whom she believed was neglected by the camp counselors. As legend β€¦ has it, the last survivor of the attacks beheaded the woman. But then Jason came back, and now he is a vengeful and inexorable killer, wielding crossbows, swords, axes and other sharp instruments. The legend proves horribly true, as these campers quickly discover. Six months later, the brother of one of those campers distributes posters of his missing sister. The police believe she took off with her boyfriend; but he knows better. The brother crosses paths with an uptight young rich guy who is having his girlfriend and friends over at his parents' cabin. The brother ends up at the cabin himself just before his sister's attacker sets upon them all. (Read More)

Subgenre:
psycho thrillerslasher flick
Themes:
evilmurderdeathrevengetorturedrunkennesspsychopathbrutalitydeath of mothermurder of a police officer
Mood:
slashergoredarknesshorror movie remake
Locations:
woodsforestmotorcycleboatbathtubbicyclewaterpolice carlakecampfiretunnelschool busbackwoodssex in a tent
Characters:
killerafrican americanboyfriend girlfriend relationshiptattoobrother sister relationshipteenage girlvillainsheriffasian americanterrormysterious villainserial murdererblonde girlgirl nudity
Period:
1980s
Story:
summer campmissingcamplegendaxemaskbloodfemale nuditynuditynumber in titleviolencebare breastsfemale frontal nuditymasturbationdog β€¦bare chested malesex scenefemale rear nuditynippleschasesurprise endingpistoltelephone callfiretopless female nuditywoman on topcorpsedigit in titleblood splatterurinationblonderemakeshot in the headbare buttdead bodymarijuanahallucinationalcoholswimmingdecapitationflashlightbracandlestrangulationtoplessmassacrevideo camerastabbingdeath of friendthroat slittingimpalementstabbed to deathstabbed in the chestsevered headcultscantily clad femalebreast fondlingdrowningskinny dippingstalkerstabbed in the backprologuescreamingmini skirtmoaningmissing persontentevil manopening action scenedisappearancestalkingpremarital sexsuspicionlove interestkissing while having sexmaniacpot smokingfireplacebow and arrowburned aliveelectronic music scoremachetescene during opening creditsmutilationcaptivewalkie talkiebuttockspsychocovered in bloodmasked manrampagerear entry sexgrocery storenew jerseybackpackstabbed in the throatpower outageconvenience storenipplestabbed in the headstabbed in the leghit on the headjumping through a windowperversioncellphonedisfigurementbody landing on a carstabbed in the eyebody countaxe murdersevered legcharacters killed one by onearrowburned to deathpsychoticmasked killermannequinpsycho killerplantserial murdervillain played by lead actorpsychopathic killerbad guybeheadingporn magazinestabbed in the handbonghuman monstercanoestaircaseabandoned househomicidal maniacrear nuditydisposing of a dead bodyshot with an arrowfemale psychopathloud sexslashingno title at beginningbroken mirrorblood stainnude girlbaseball capheld captivedripping bloodday in titletopless girlcowgirl sex positionhanged manhead cut offburnt bodycountry housesole black character dies clichebra removinggraphic violenceopen endedcheating boyfriendmurderessmasked villainknife murderspitting blooddeformitytelevision setpool of bloodfemale victimsadistic psychopathold housenakedsilhouettestupid victimvillain not really dead clichejerklocketpsychosissex from behindwoman in dangerleg woundcreepbudweiserfalling through the floorgpsbear trapsleeping bagwoman moaning from pleasurewoman moaningsevered earmoaning womanfreezerstabbed in the footbutt nakeddrinking from the bottleremake of american filmpsycho terrorfemale serial killerscrewdrivernaked buttweirdowoman's bare buttdrinking gamewater skiingteenager fighting adultbreaking glassgirl toplesshockey maskkitschvideotaped sexmissing person posterhockey stickheavy drinkingtouching someone's breastsdeath by impalementgirl in brasource musictouching breastsremake of cult filmsickounderwater photographylake housefemale bare footstabbed through the chestcamp counselorhearing noisescampfire storymissing sisterfireplace pokersummer housepower cutshower curtainunderground tunneldisobediencehands covering breastsleg cut offbouncing breastsmutilated bodyfriday the thirteenthleg ripped offatonal music scoreaxe in the chestcampgroundmachete mutilationhead chopped offhickremoving a braman and woman naked in bedtaking off braglow sticktouching breastcowgirl sexnaked woman in bedtopless swimmingwoodchipperaxe in the backbug zappermale with earringdoggie style sex positionstabbed through backwoman on top sexdo not disturb signboat dockwessex county new jerseycrystal lake new jerseywakeboardingarrow through the headblood bathimpaled through the headnude female silhouettebleeding headserial teen murdererbreasts bouncingbroken chairkilled by machetewoman covering nudity with her handswoman removes her bracreaking doorwoman covering breastsreference to macgyver (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Ring (2002) is one of the best movies like Bloody Summer Camp (2021)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Ring (2002)

Rachel Keller is a journalist investigating a videotape that may have killed four teenagers (including her niece). There is an urban legend about this tape: the viewer will die seven days after watching it. If the legend is correct, Rachel will have to run against time to save her son's and her own  β€¦life. (Read More)

Subgenre:
paranormal phenomenasupernatural horror
Themes:
murderdeathrevengesurrealismsuicideghostfearfuneralinvestigationvoyeurismsupernatural powerphotographyadoptiondyingmysterious death
Mood:
rainnightmarehorror movie remake
Locations:
wheelchairbathtubwaterelevatorcity
Characters:
family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipdoctorboyteenage girlteenage boyfemale protagonistteachergirlserial killerstudent β€¦writercousin cousin relationshipex boyfriend ex girlfriend relationshipgrandmother grandson relationshipaunt niece relationship (See All)
Story:
urban legendurbanlegendaxebloodf ratedbased on novelflashbackcigarette smokingphotographtitle spoken by charactersurprise endingpantiesshowertelephone call β€¦cell phonedreamhorsemirrorblondeface slapremakewatching tvcomputercamerafalling from heighthallucinationvoyeurislandclassroomtelephonereportergood versus evilcleavagenewspaperjournalistwomanno opening creditsbirdscantily clad femaledrawingforeign language adaptationunderwater scenetreecurseblack pantieselectrocutionmini skirtrace against timeskeletonringfilm within a filmfirst partcabinpsychicgirl in pantiesanswering machinebreaking and enteringbabysitterbarnnosebleedvideotapeladderapartment buildingmental institutionsevered fingerpastmental hospitaldead childcliffbalconychairferryreckless drivingmiscarriageseattle washingtonplaying cardslighthousecartoon on tvhairdark secretwellno title at beginningfalling into watertape recordingflyassistantcoughingcabin in the woodsinfertilitystablekiller childpsychiatric hospitalpsychic powermaggotbechdel test passedinnwatching a videodeath by drowningelevator shafthookevil childinvestigative reporterpick axejumping off a cliffel trainfolk talesubliminal messagefire hosepsionic powerdeliberate crueltywallpapercentipedeabyssdeath of cousinhayloftfamily violencecalling parent by first nameremake of japanese filmremake of asian filmanimated scenefingernailtelevision staticrace against the clockunplugged electronic workshole in the floorpsychiatric treatmentdead teen couplepsychotic childseven dayswhitewashelectrocuted in a bathtubpeanut butter and jelly sandwichthrown down a wellbottomless pitjournalism studentdeformed armhorse breederfalling down a well (See All)

Halloweenviii: Resurrection (2002)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloweenviii: Resurrection (2002)

Serial Killer Michael Myers is not finished with Laurie Strode, and their rivalry finally comes to an end. But is this the last we see of Myers? Freddie Harris and Nora Winston are reality programmers at DangerTainment, and are planning to send a group of 6 thrill-seeking teenagers into the childhoo β€¦d home of Myers. Cameras are placed all over the house and no one can get out of the house... and then Michael arrives home! (Read More)

Subgenre:
independent filmcult filmslasher flickteen horroramerican horror
Themes:
evilmurderdeathrevengefeardeceptionpsychopathsurveillancemurder of a police officer
Mood:
slashergoresatire
Locations:
wheelchairwoodsforestkitchenrooftopfire truck
Characters:
killerteenage girlteenage boyserial killernursesecurity guardvillainpsychiatristslasher killercoroner
Period:
2000s
Story:
jockaxemaskbloodfemale nudityviolencesequelflashbacktwo word titlefightknifechasesurprise endingfire β€¦cell phonecorpseblood splatterfistfightmirrorwatching tvcomputercameraundressingbrawlfalling from heightshowdownf wordsubjective cameradecapitationgood versus evilhalloweenfoot chaseflashlightstrangulationambulancemontagethroat slittingimpalementstabbed to deathstabbed in the chestinternetsevered headpolice officer killednews reportstabbed in the backelectrocutioncharacter's point of view camera shotproduct placementevil mankicked in the facecollege studentlightningskeletondisappearanceneck breakingmurdererthreatened with a knifesevered armobscene finger gesturekillingmaniacchainsawheavy rainlifting someone into the airsecurity cameraloss of loved onemorgueskullfatebroken legmasked manmental institutionrampagestabbed in the throatstabbed in the headblack brae mailrainstormraised middle fingergasolinebody countaxe murdercasual sexcharacters killed one by onesequel to cult favoritekilling spreemasked killernewspaper clippinghalloween partytext messaginginterrupted sexserial murderpsychopathic killervideo surveillancebad guyreturning character killed offhiding in a closetold dark househuman monsterabandoned housewebcamhomicidal maniacclimbing through a windowwhodunithanging upside downlocked doorbreaking a windowbody baghanged manhead cut offfilmed killingmurder attemptbutcher knifeman on firesadistic psychopathlocked in a roombreaking through a doorpeep holestupid victimbreaking a mirrorx rayed skeletonsecret roomcrime spreeleg woundcamera focus on female buttimpersonatoreighth partmichael myersdead teenagerlifting a female into the airboogeymandeath by electrocutionskull crushingjumpsuitsee you in hellcult film referencedecomposed bodybutt grabserial teen killerclown maskpolice officer throat slitovernight in a haunted housereality tv productioneyes wide openwhite maskair hornreal movie shown in fictional situationcord (See All)

Friday The 13th: The Final Chapter (1984)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th: The Final Chapter (1984)

Thought to be killed by the sole survivor of the last massacre at Camp Crystal Lake, Jason Voorhees kills his way back to the camp to once again murder its inhabitants. This time, has Jason met his match in the little boy Tommy Jarvis?

Subgenre:
cult filmpsycho thrillerbody horroramerican horrorindependent horrorsadistic horror
Themes:
evilmurderdeathtorturepsychopathbrutalitysupernatural powerinsanitysadism
Mood:
slashergorebreaking the fourth wallblood and gore
Locations:
hospitalsex in showersex in a bathroom
Characters:
killerbrother sister relationshipteenage girlteenage boyserial killervillainterrorslasher killermysterious villainserial murderermysterious killer
Period:
1980s
Story:
summer campcampmaskbloodsexfemale nuditynumber in titlemale nudityviolencebare breastssequelfemale frontal nuditymasturbationmale rear nudityfemale rear nudity β€¦surprise endingpantiescorpseunderwearblood splatterlow budget filmsubjective cameradecapitationstrangulationimpalementstabbed to deathsevered headchild in perillooking at the cameraskinny dippingstabbed in the backcharacter's point of view camera shotevil manstalkingpremarital sexmurderercabinloss of motherobscene finger gesturekillingmaniacsexual attractionlifting someone into the airragemutilationmorguefourth partpsychogrindhousetowelback from the deadmasked manrampagerednecknew jerseyhit in the crotchstabbed in the neckbutcherstabbed in the headdisembowelmentslaughterdisfigurementbody landing on a carbody countcharacters killed one by onekilling spreemasked killerpsycho killerserial murderpsychopathic killerbad guycar troublemadmanmysterious manstabbed in the handkillhuman monsterhomicidal maniacslashingshot in the eyehillbillymeat cleavernaked dead womanextreme violencegraphic violencestabbed in the facemasked villainknife murderbloody violencedeformitylunaticsadistic psychopathmurder of a nude womanmurder spreevillain not really dead clichedisturbed individualbutcherygrindhouse filmcrime spreedeeply disturbed personpsycho terrordisturbinghockey masklifting a female into the airruraltorturergiallo esquesequel to cult filmstabbedboogeymandrive in classicskull crushinggory violenceeast coastgruesomejason voorheeshead shavingcorkscrewmutilated bodyfriday the thirteenthaxe in the chestmachete mutilationknife through the neckserial teen killertrailer narrated by don lafontainesadistic killerdeformedtwin actresses for twin sisterswessex county new jerseycrystal lake new jerseynose pushed into brainserial teen murdererslaughteredmurder in a shower (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Friday The 13th Part III (1982)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th Part III (1982)

Jason Voorhees, having barely survived a wound to his shoulder from his own machete, is back to revenge on all that visit "his" woods. A new group of friends come over to party at an area close to the campsite. This time, Jason will be stronger than ever, and getting a hockey mask from one of those  β€¦friends. (Read More)

Subgenre:
cult filmslasher flickamerican horror
Themes:
murderdeathpsychopathabductionexploitation
Mood:
slashergoredarkness
Locations:
woodslake
Characters:
killerteenagerboyfriend girlfriend relationshipteenage girlteenage boyserial killervillainterrorslasher killerserial murdererlow self esteemmysterious killer
Period:
1980s
Story:
axemaskpartybloodsexnuditynumber in titlesequelshowerdigit in titlebikininumbered sequelsubjective cameraimpalementthird part β€¦character's point of view camera shotevil manmurderercabinsevered armdismembermentsplattermaniacmass murdermachetelifting someone into the airragebarnroman numeral in titlepsychosevered handgrindhousemasked manstupidityrampagenew jerseystabbed in the throat3 dimensionalconvenience storepsychotronicslaughterstabbed in the eyecharacters killed one by onesequel to cult favoritekilling spreemasked killerpsycho killertorso cut in halfserial murderpsychopathic killerbad guycar troublemadmandefecationhuman monstersexual violencehomicidal maniacslashingshot in the eyehillbillyeyeballhammockextreme violencefamous scoremasked villainknittingpitchforksole survivordeformitysadistic psychopathpsychotronic filmbiker gangmurder spreemass murdererdisturbed individualgrindhouse filmcrime spreelifting female in airsliced in twopregnant woman murdered3 ddate in titledisturbinghockey maskgiallo esquesequel to cult filmyo yodrive in classicskull crushinggory violenceeast coastgruesomejason voorheesdorkfriday the thirteenthcult favoriteserial teen killerbrutalhead crushing3d sequel to 2d filmtrailer narrated by don lafontainewessex county new jerseycrystal lake new jerseykilled with machetesack maskpopcorn making (See All)

The Blair Witch Project (1999) is one of the best movies like Bloody Summer Camp (2021)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Blair Witch Project (1999)

Three film students travel to Maryland to make a student film about a local urban legend... The Blair Witch. The three went into the woods on a two day hike to find the Blair Witch, and never came back. One year later, the students film and video were found in the woods. The footage was compiled and β€¦ made into a movie. The Blair Witch Project. (Read More)

Subgenre:
independent filmcult filmblack comedysuspensemockumentarytragedyfound footagefake documentaryghost storysupernatural horrorfamily tragedyfolk horror
Themes:
fearsupernatural powerpanicwildernessstarvationcamping in the wilderness
Mood:
student filmdarknessmyth
Locations:
woodsforest
Characters:
boyfriend girlfriend relationshipfilmmakercrying babyevil witch
Period:
1990syear 1994
Story:
urban legendurbanlegendrunningcigarette smokingchasesurprise endingcryingcorpsebooklow budget filmriveralcoholsubjective camerahalloween β€¦flashlightvideo camerafour word titlemaplooking at the cameratalking to the cameralatex glovespainscreamingmissing personscreamactor shares first name with characterdarktrapsleepingloss of friendmonologuewitchcraftblockbusterrampageconfrontationhandheld cameravoodoohysteriafolklorehikingabandoned housemessageautumnfrightgrassscareno endingno survivorsscreaming in fearmarylandpaganviral videobased on supposedly true storylost in the woodssevered tongueloss of boyfriendthree friendsdocumentarianobscurityscreaming in horrorchild murderesscrying childunsolved mysteryno musicactor shares last name with characterhand camerahearing noisesmeadowblack and white and colormysterious noiseaspiring filmmakerparanormal phenomenonfaked footagefriends falling outmass hysteriainterview clipsraw footagestick figureno background scorethe star spangled bannerfriendship conflictmissing manrunning in the darkvideotaping oneselfloss of realitychaos in the darkgovernment filmbloody handprintslocal legendsleeping in the forestpackage of cigarettescity folkloremoral deterioration (See All)

Friday The 13th: A New Beginning (1985)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th: A New Beginning (1985)

Five years after killing the goalie hockey-masked killer Jason Voorhees, Tommy Jarvis has grown up in various mental hospitals unable to get over the nightmares about Jason's return. When Tommy is sent to a rural halfway house in New Jersey for mentally disturbed teenagers, a series of grisly murder β€¦s begin anew as another hockey-masked killer begins killing off all people at and around the residence. Has Jason returned from the dead to re-start his killing spree? Has Tommy decided to take over the reign of Jason, or has someone else? (Read More)

Subgenre:
independent filmcult filmpsycho thrilleramerican horror
Themes:
evilmurderdeathrevengefearpsychopathbrutalityinsanitysadismexploitationpolice investigation
Mood:
slashergorerainnightmarenightdarkness
Locations:
woodscemeterysmall townamericabackwoods
Characters:
killerpolicemother son relationshipteenagerbrother brother relationshipserial killervillainsheriffterrorslasher killermysterious villainserial murderermysterious killercountry boy
Period:
1980s
Story:
summer campaxebloodsexfemale nuditynumber in titleviolencebare breastssequelfemale frontal nuditykissdancingchasesurprise endingpanties β€¦digit in titleblood splatterdead bodylow budget filmnumbered sequelsubjective cameradecapitationsword fightmassacrethroat slittingimpalementchild in perilgravestalkercharacter's point of view camera shotevil mandeath of brotherstalkingdeath of sonmurdererobscene finger gesturekissing while having sexmaniacchainsawmachetelifting someone into the airmutilationbarnstabbed in the stomachpsychogrindhousevictimmasked manmental institutionrampagerednecknew jerseyitalian americanbutcherpsychotroniceye gougingslaughterstabbed in the eyebody countaxe murdercharacters killed one by onefifth partsequel to cult favoritepsychoticmasked killerpsycho killerserial murderpsychopathic killerbad guycar troublemadmanmysterious manlaundrydefecationhuman monsterhomicidal maniaccomic relieftombstoneslashinghillbillyeyeballmeat cleavercrushed headextreme violencegraphic violenceorchestral music scorestabbed in the facemasked villainknife murdercut into piecesbloody violencefemale victimlunaticsadistic psychopathpsychotronic filmmurder of a nude womanmurder spreedisturbed individualbutcherygrindhouse filmdeath of grandfathercrime spreereturning character with different actorstabbed with scissorsfatchopping woodaxe in the headmultiple homicidepsycho terrorweirdosmall town sheriffbreakdancingdate in titlehockey masksequel to cult filmdark and stormy nightdrive in classiccandy barclotheslinegory violencesource musiceast coastgarden shearsjason voorheesimposterjumpsuitpopular musicfriday the thirteenthgrave robbermachete mutilationserial teen killercopycattrailer narrated by don lafontaineattempted child murdermale victimwessex county new jerseycrystal lake new jerseycopycat killervertigo shotserial teen murdererlifting a woman into the airspike in the head (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Jason Lives: Friday The 13th Part Vi (1986)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Jason Lives: Friday The 13th Part Vi (1986)

Tommy Jarvis returns to the graveyard to make sure Jason Voorhees is dead and accidentally brings him back to life. Now it's up to Tommy to stop Jason's mindless killing and put him back where he belongs.

Subgenre:
cult filmsupernaturalpsycho thrillerparanormal phenomenaslasher flickteen horroramerican horror
Themes:
evilmurderdeathprisonmonsterpsychopathsupernatural powerinsanitymurder of a police officer
Mood:
slashergorecar chasedarknessbreaking the fourth wall
Locations:
woodsforestcemeterysmall townboatlakeamerica
Characters:
killerpoliceteenagerzombieserial killervillainsheriffterrorslasher killerserial murderer
Period:
1980s
Story:
summer campmasksexcharacter name in titlenumber in titleviolencesequelflashbacksurprise endingblood splatternumbered sequeldemondecapitationflashlightmassacre β€¦ambulancestabbingstabbed to deathsevered headchildlooking at the cameradrowningelectrocutionevil manstalkingneck breakingmurdererunderwatersevered armdismembermentkillingundeadblood spattersplattermaniacmass murdergothicmachetelifting someone into the airmutilationpsychovictimback from the deadmasked manrampagenew jerseybutchershovelstabbed in the headslaughterbody countsevered legsequel to cult favoritekilling spreebloodbathmasked killerpsycho killerserial murderpsychopathic killerbad guybeheadingmadmankillhomicidal maniacslashingactual animal killedsixth partstabbed in the facemasked villainknife murderrecreational vehiclecut into piecesbloody violenceheart ripped outfemale victimsadistic psychopathoff screen murdermurder spreevillain not really dead clicheghoulbutcherypaintballhead ripped offreturning character with different actorreanimationpsycho terrorstruck by lightningdead teenagerhockey masklifting a female into the airdemonicdark and stormy nightdrive in classicgrave robbinggory violenceeast coastunderwater fightjason voorheesdouble impalementmutilated bodyfriday the thirteenthstabcamaromachete mutilationpsycho filmviolentbrutalcomic drunkwessex county new jerseycrystal lake new jerseycut to piecespolice officer crushedstabbing a police officerserial teen murdererkilled by machete (See All)

Prom Night (2008)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Prom Night (2008)

Donnas senior prom is supposed to be the best night of her life, one of magic, beauty, and love. Surrounded by her best friends, she should be safe from the horrors of her dark past. But when the night turns from magic to murder there is only one man who could be responsible, the man she thought was β€¦ gone forever. Now, Donna and her friends must find a way to escape the sadistic rampage of an obsessed killer, and survive their Prom Night. (Read More)

Subgenre:
coming of agesuspenseslasher flickteen movieteen horror
Themes:
home invasionmurderdeathfriendshipdrunkennessdancepsychopathobsessionrivalrymurder of a police officermurder of family
Mood:
slasherhigh schoolnightmarehorror movie remake
Locations:
hotelelevatorpolice stationfire truck
Characters:
killerhusband wife relationshippoliceteenagerfriendboyfriend girlfriend relationshipteenage girlteacherdetectivepolice detectiveuncle niece relationshipaunt niece relationshipdeath of girlfriend
Story:
pervertaxepartybloodmale nudityviolenceflashbackmasturbationdancingtitle spoken by characterknifechasepistolshowercell phone β€¦corpseshot to deathblood splattermirrorshot in the chestremakeslow motion scenehallucinationsurvivalorphanstrangulationdisguiseambulancedeath of friendthroat slittingbridgestabbed to deathstabbed in the chestjokedream sequencepolice officer killednews reportlimousinestalkervirginclownrace against timekicked in the facedeath of childhigh school studentstalkingthreatened with a knifeloss of loved oneswat teampsychologistrapistbarefootcrime scenehaunted by the pastfloodunderage drinkingevacuationpedophileblood on shirtmurder of a childone daycharacters killed one by oneuncleengagement ringparentsdjauntgraduationfire extinguisherhiding in a closethigh school teacherpedophiliacomic relieftrashflaskescaped convictbody in a trunkmtvpromdeath of boyfriendgarbagemugshothiding under a beddeath of familychild molesterstupid victimbreaking a mirrorrookie copsexual predatorrenovationcliquebitten handsex offenderclicheflasherbad actinghotel suitemedicine cabinetbroken dishblack stereotypeprom queenbathroom mirrorcut telephone linecockinesserotomaniaprom kinghotel staffmaster keybridgeport connecticutstupid cop (See All)

Friday The 13th Part Viii: Jason Takes Manhattan (1989) is one of the best movies like Bloody Summer Camp (2021)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th Part Viii: Jason Takes Manhattan (1989)

The graduating class of the local high school is going on a luxury cruise with Jason Voorhees as a stowaway. The heroine Rennie Wickham believes she was almost drowned by Jason as a child. Jason eventually sinks the boat and kills many of the students on it, but many of them escape to Manhattan. A l β€¦ong battle with Jason ensues until Jason is washed away in the New York sewers by a midnight flooding of toxic waste. (Read More)

Subgenre:
independent filmcult filmpsycho thrillerparanormal phenomenaslasher flickteen horroramerican horror
Themes:
evilmurderdeathrevengemonsterpsychopathsupernatural powerdrug addictionmurder of a police officer
Mood:
slashergorerainhigh school
Locations:
woodsnew york cityboatseacityamericasewer
Characters:
killerteenage girlteenage boyzombiepolice officerserial killervillainteacher student relationshipterrorslasher killermysterious villainserial murderer
Period:
1980s
Story:
summer campaxebloodfemale nuditycharacter name in titlenumber in titleviolencesequelbare chested maleexplosionpantiesblood splattermirrornumbered sequeldemon β€¦hallucinationguitarmanhattan new york citydecapitationflashlightgangnew yorkstrangulationvideo camerastabbingthroat slittingimpalementstabbed to deathsubwaywhite pantiesexploding carnecklacedrowningon the runblack pantieselectrocutioncharacter's point of view camera shotevil manattempted rapeunderwaterundeadmaniachypodermic needlelifting someone into the airmutilationpsychoback from the deadmasked manmale underwearrampagenew jerseybutcherblack bradead childdisembowelmentslaughterstabbed in the eyebody countcharacters killed one by onesequel to cult favoritemasked killerpsycho killerserial murderpsychopathic killerbad guybeheadingmadmanhomicidal maniacaccidental shootingstatue of liberty new york citycrushed headdisembodied headcruise shipmasked villainknife murdertoxic wastedeformitylunaticsadistic psychopathmetrooff screen murdermurder of a nude womanmurder spreemass murdererghoulbutcherybody paintblond boyeighth partpolice officer knocked unconsciouspsycho terrorstruck by lightningharpoondead teenagerhockey masklifting a female into the airtwin towerstrailer narrated by percy rodriguezlifeboatspear guneast coastjason voorheesmutilated bodyfriday the thirteenthkilled with a forkhit with a guitarwessex county new jerseycrystal lake new jerseyjerseyserial teen murdererbig applegirl strangling (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

V/h/s (2012)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

V/h/s (2012)

A POV, found footage horror film from the perspective of America's top genre filmmakers. A group of misfits are hired by an unknown third party to burglarize a desolate house in the countryside and acquire a rare tape. Upon searching the house, the guys are confronted with a dead body, a hub of old  β€¦televisions and an endless supply of cryptic footage, each video stranger than the last. (Read More)

Subgenre:
supernaturalfound footage
Themes:
home invasionevilmurderdeathghostdrunkennessdeceptionsupernatural powerreligious cult
Mood:
goredarknessone night
Locations:
barforestroad triplakemotel
Characters:
killerhusband wife relationshipzombiealienghost in mirror
Period:
year 1998
Story:
castrationpartybloodfemale nuditymale nudityviolencefemale frontal nuditymale frontal nuditymale rear nuditybare chested malesex scenefemale rear nudityfemale full frontal nuditytitle spoken by character β€¦male full frontal nudityknifelesbian kisstopless female nuditycorpserescuedemontelevisionsubjective cameradecapitationhalloweenflashlightgangvideo camerathroat slittingimpalementcocainestabbed to deathsevered headritualanthologylooking at the cameratalking to the cameraskinny dippingcharacter repeating someone else's dialoguepossessionhalloween costumepranksplit screendeath of husbandbasementtrapcharacter says i love youhaunted houserevelationbreaking and enteringvandalismvideotapecovered in bloodmasked maneaten aliveswitchbladeburglarystabbed in the throatstabbed in the headdisembowelmenthandheld cameraone daytitle at the endknife throwinglooking at self in mirrorlens flareabbreviation in titlecharacters killed one by onefortune tellermarijuana jointblood on camera lenswoman cryingwebcamvhspotfilmed killingsmoking marijuanavcrman slaps a womanbitten handsuccubusbroken handslash in titleghost childsevered penisvhs tapemasked womanpassed out drunkstabbed in the foreheadvideo chatwatching someone sleepcar hit by a trainnude man murderedhalloween maskpenis ripped offthroat slitnanny cam (See All)

Friday The 13th (1980)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th (1980)

One summer at Camp Crystal Lake, a group of young counselors begin to get ready to lead campers. Unfortunately for the former, someone isn't happy about what's going on in the camp and enjoys playing kill the counselor. As bodies fall to the ground in the camp, no one is safe.

Subgenre:
independent filmcult filmsuspensepsycho thrillerslasher flickteen moviemurder mysteryteen horroramerican horror
Themes:
evilmurderdeathrevengefearvoyeurismcorruptionpsychopathbrutalityinsanityhumiliationsadismcrueltytraumamysterious death
Mood:
slashergorenightdarknessblood and gore
Locations:
woodscarmotorcycleboatwaterrural settingpolice carlaketruck
Characters:
killerpoliceteenagerfriendteenage boypolice officerserial killerpolicemanartistmothervillainsheriffterrortruck driverslasher killer β€¦mysterious villainserial murderer (See All)
Period:
1970s1950ssummer
Story:
summer campcampaxerunningsexfemale nuditynumber in titlemale nudityviolencebare breastsmale rear nuditybare chested malekissfemale rear nuditynipples β€¦three word titlesurprise endingpantiesbeatingcorpsedigit in titleblood splatterfistfightblondeslow motion scenebikinithongbeerdead bodylow budget filmmarijuanahallucinationvoyeurguitarsubjective cameradecapitationbedroombracandleold manmassacrestabbingwomanthroat slittingstabbed to deathdineraccidentsnakecultdream sequenceskinny dippingstrippingdangerprologuescreamingfirst of seriesmoaningdeath of childprankinjectionstalkingdeath of sonmurdererfirst partcabinkissing while having sexkillingteenage sexfreeze framegirl in pantiesmaniacrevelationdesirenipples visible through clothingelectronic music scoredressjeepgothicheavy rainmachetehatstabbed in the stomachhammervillainesspsychoswimsuitgrindhousevictimdead womanfull moonrampagebra and pantieslow budgetnew jerseystabbed in the throatobesitymercilessnesspower outagemutebutcherpsychotroniclostthunderstormbathingdisembowelmentsurpriseatticperversiondead manslaughterbody countlens flareaxe murderroomcharacters killed one by onekilling spreearrowdeath of loved onetank toppsychoticpsycho killerphysical abuset shirtjoyserial murderpsychopathic killersexual awakeningbeheadingcar troublemysterious manshortsdead animalhuman monstercanoeadolescencerepressionsexual perversionhomicidal maniacrestroomfemale psychopathslashingjacketdying mandripping bloodrobeactual animal killedday in titlesummer vacationfemale villainshirtmurder witnessevil womanextreme violencefamous scoreanthropologydisfigured facegraphic violenceorchestral music scoresexual repressionmenacemurderessmultiple murdergame playingbowboard gameknife murderpillowbloody violencesole survivortraumatic experiencefemale victimsadistic psychopathwet clothesgrudgeoff screen murdermurder spreevillain not really dead clichebutcherygrindhouse filmmurder victimcrime spreecurtaintroubled teenblond boybitingmystery killersweateraxe in the headmultiple homicidemistreatmentpsycho terrorfemale serial killerweirdoawakeningdate in titledead teenagerdisturbinglost in the woodsraincoatobese womanvillainess played by lead actressblousegiallo esqueremadesadisticdark and stormy nightdrive in classicmutilated corpsedeath by impalementeast coastaxe murdererbad girlcamp counselorcampfire storygruesomejason voorheesunknown killerbody mutilationfriday the thirteenthatonal music scoremachete mutilationmonopoly the board gamepsycho filmknife through the neckserial teen killercanoeingtrailer narrated by don lafontainekilled with an arrowfemale victimsstormy nightscore employs electronic instrumentsnaked bathingwoman taking off pantsemotionally disturbed personwessex county new jerseycrystal lake new jerseyjerseyelectrical generatorkilled with machetevoice impressionistquietcamp vacationunstable teenager (See All)

Sorority Row (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Sorority Row (2009)

"Sorority Row" sees a group of sorority sisters try to cover up the death of their house-sister after a prank gone wrong, only to be stalked by a serial killer.

Subgenre:
black comedy
Themes:
murderdeathfriendshipbetrayaldrunkennessguilt
Mood:
slashergorehorror movie remake
Locations:
kitchenfire truck
Characters:
killerfather son relationshipboyfriend girlfriend relationshipbrother sister relationshipserial killerinterracial relationshipalcoholicmysterious killerdeath of a friend
Story:
tire ironaxepartybloodfemale nudityviolencefemale frontal nuditymale rear nuditybare chested malefemale rear nudityknifechasesurprise endingpanties β€¦showerfirecell phonecorpseblood splattermirrorshot in the chestblonderemakeshotgunslow motion scenepunched in the facebare buttsecretvomitingheld at gunpointlingeriecollegehallucinationhandcuffsvoyeuralcoholcleavageflashlightstrangulationambulancedeath of friendthroat slittingimpalementstabbed in the chestaccidentwhite pantiesscantily clad femalehit by a carpublic nudityblack pantiescharacter repeating someone else's dialogueperson on firemini skirtchampagnecover upcollege studentscreambraceletpranklong takestalkingbasementcharacter says i love youburned alivelooking at oneself in a mirrorsociopathfaintingscene during opening creditscatfightloss of friendtherapistnosebleeddead womanbroken legpump action shotgunwoman in jeopardystabbed in the throatironygash in the facestabbed in the neckstabbed in the headsenatorstabbed in the legaccidental killinghot tubraised middle fingercanered pantiescharacters killed one by onedead woman with eyes openmisogynyfemale in showerlyingfirefighterlaptop computervodkatext messagingintimidationgraduationfire extinguishermolotov cocktailhiding in a closetreference to facebookmisogynistwebcamdisposing of a dead bodyconstructionsororityjacketbubble bathwoman in bra and pantieswrist slittingreference to youtubeshot through the mouthfilmed killingcheating boyfriendbutt slapcamera phoneflare gunhouse on firemurder of a nude womandragging a bodycomeuppancefalling through the floortied to a treegpsdiscovering a dead bodystabbed in the mouthhooded figureaxe in the headcprdrink thrown into someone's facemine shafthandcuffed to a bedhit on the head with a fire extinguisherfoaming at the mouthwoman stabbedrotting corpsestabbed through the chinbeer kegprank gone wrongsorority housesorority girlcalling for helpcollege graduationwild partyreference to lindsay lohanrunning out of ammosoap bubblevaledictorianflare gun as weaponfalling down a shaftshot glassstabbed through the mouthfoamshot in the mouthbeer bongluncheonsorority partyfall through floorpleading for helpjust desserts (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

High Tension (2003) is one of the best movies like Bloody Summer Camp (2021)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

High Tension (2003)

Alexia travels with her friend Marie to spend a couple of days with her family in their farm in the country. They arrive late and they are welcomed by Alexia's father. Late in the night, a sadistic and sick killer breaks into the farmhouse, slaughters Alexia's family--including their dog--and kidnap β€¦s Alexia. Marie hides from the criminal and tries to help the hysterical and frightened Alexia, chase the maniac, and disclose his identity in the end. (Read More)

Subgenre:
independent filmsuspenseb movieb horrorindependent horrorsadistic horrorpsychological horrorfrench horrorhorror b movie
Themes:
home invasionevilmurderdeathfriendshipsurrealismkidnappingrapefeartorturepsychopathdeath of fatherbrutalitydeath of motherinsanity β€¦sadismunrequited loveexploitationdeath of wifemadnessmurder of fathermurder of husbandmurder of mothermurder of brothermurder of son (See All)
Mood:
slashergorenightmarecar chasenightdarknessblood and gore
Locations:
woodshospitalforestbathtubrural settingroad tripfrancetruckgas stationsinging in a carbackwoodsback country
Characters:
killerfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipfriendboybrother sister relationshipteenage girlfemale protagonistserial killerstudent β€¦best friendvillainterrorfrenchslasher killerbest friendsmysterious villainserial murderermysterious killerdeath of boy (See All)
Story:
pervertaxebloodfemale nudityf ratedviolencebare breastsfemale frontal nudityflashbackmasturbationdogguncigarette smoking β€¦photographknifelesbian kisschasesurprise endingshowertelephone calldreamcorpseblood splattercar accidentmirrorurinationshot in the headshotgunslow motion sceneshootingriflesunglassesbedcar crashdead bodylow budget filmbathroomneighborvoyeurtelephoneshot in the backsubjective cameradecapitationsurvivalflashlightbound and gaggedmassacrestabbingthroat slittingimpalementstabbed in the chesthousesevered headscantily clad femalevanon the rundollevil mandeath of childdeath of brotherpursuitstalkingdeath of sondeath of husbandmurderersleepingeuropekillingblood spattersplatterchild murdermaniacchainsawfireplacekilling an animalmass murderlistening to musicsurvivormutilationstabbed in the stomachpsychosevered handgrindhousestrangerrape victimfollowing someonerapistfemale killerrampagerednecktensionsurveillance cameramobile phonegash in the facebroken glassmental hospitalplot twistbutcherperversionmurder of a childslaughterswingclassmatebody countaxe murdersexual assaultcharacters killed one by onekilling spreeparrotpsycho killerdead dogbeing followedblood on camera lensserial murderpsychopathic killersuffocationtaking a showerbarbed wirevideo surveillancebad guyearphonesmadmanclosetnecrophiliaminimal castkillkilling a doghuman monsterhomicidal maniacfarmhousefemale psychopathslashinglistening to a radiocornfieldpiercinggreenhouserazor bladeurinalexamfemale villainevil womanextreme violencemurder of wifefilling stationgraphic violencemurderessstabbed in the facecar radiohiding under a beddeath of familyfeetcut into pieceslesbian subtextbloody violencebutcher knifefemale victimsadistic psychopathmurder spreevineyardchainsdriving at nightdisturbed individualbutcherygrindhouse filmbludgeoningwalkmanexploitation filmcrime spreestraight razorcreepbloody body of a childdeeply disturbed personserial rapistsexual predatorgas station attendantfemale serial killerplastic bagweirdocircular sawpadlockbreaking a car windowdoor bellmultiple personality disordergiallo esquepolice vanpsychiatric wardgory violencesickoaxe murdererbad girlpreyambient musicunreliable narratorfemale murdererjumpsuitshower curtainnecrophiliacvision of the futureaxe in the cheststabhead in a toiletstabbed with glasskeychainsex with the deadfrench shock cinemapierced belly buttonsadistic killersouthern francefemale victimsfrench cinemalesbian lead charactergas pumpslashed to deathearplugsrear ending a carpsychotic killerserial rapesolarisationfrench manserial killing (See All)

Scream (1996)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Scream (1996)

1 year after her mother's death, Sydney Prescott (Neve Campbell), and her friends started experiencing some strange phone calls. They later learned the calls were coming from a crazed serial killer, in a white faced mask and a large black robe, looking for revenge. His phone calls usually consist of β€¦ many questions, the main one being: Whats your favorite scary movie? Along with many scary movie trivia, ending with bloody pieces of innocent lives scattered around the small town of Woodsboro. (Read More)

Subgenre:
cult filmcoming of ageblack comedysuspenseconspiracypost modernslasher flickteen movieteen horrorpsychological thrillerhorror spoof
Themes:
home invasionmurderdeathfriendshiprevengeinfidelitybetrayalfeardrunkennessescapeinvestigationextramarital affairdivorcepsychopathbrutality β€¦death of motherparanoianear death experiencedeath of daughter (See All)
Mood:
slashergoresatirehigh schooldarkness
Locations:
woodsforestsmall townkitchenpolice stationschool bus
Characters:
killerfamily relationshipshusband wife relationshipfather son relationshippolicefather daughter relationshipteenagermother daughter relationshipboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boyfemale protagonistserial killervillain β€¦sheriffsingle fatherslasher killerself referential (See All)
Period:
1990s
Story:
jockmaskpartybloodf ratedviolenceone word titlebare chested malecigarette smokingtitle spoken by characterknifechasesurprise endingpistolfire β€¦cell phonecorpseshot to deathblood splattercar accidentshot in the chestblondeface slapshot in the headrescueslow motion scenepunched in the facewatching tvcomputercatarrestfalling from heightshowdownheld at gunpointbeercar crashinterrogationhandcuffstelevisiontelephonef wordsubjective camerasurvivalfoot chaseflashlightbound and gaggedcaliforniadisguiseambulancedeath of friendthroat slittingstabbed to deathstabbed in the chestweapontied to a chairbrunettefalse accusationno opening creditsdisarming someonevannews reportshot in the foreheadstalkervirgindangerstabbed in the backsuburbwidowerelectrocutionfirst of seriescharacter's point of view camera shotproduct placementscreamhangingprankshot in the shoulderamerican flaghigh school studentstalkingcheerleaderpremarital sexsuspicionfirst partthreatened with a knifecult directorgaragesingle parentstrong female charactereavesdroppingropeanswering machinefalling down stairsteen angstrevelationnipples visible through clothingloss of virginityheroinelifting someone into the airgroup of friendskicked in the stomachvideotapegossipcovered in bloodfaked deathstrong female leadcrushed to deathsocial commentaryhomicidemasked manpresumed deadduct tape over mouthcrime scenedamsel in distresscameohaunted by the paststealing a carunderage drinkingpower outageevacuationplot twistescape attemptframe upstabbed in the legfat manjumping through a windowdisembowelmentblood on shirtconvictlens flarefemale reportercharacters killed one by onemasked killerframed for murdermedia coveragenews reporterintestinesanniversaryyellingdirector cameohiding in a closethigh school teacherhomagevideo storediscoverypopcornclimbing through a windowwhodunitcameramandeputycrushed headdeath of boyfriendrepeated linetragic pasttabloidpsychological torturewrongful imprisonmenttelevision reporterfamous linevillain not really dead clichewrongful arrestbreaking a bottle over someone's headwoman in dangerquestionred herringwater fountainsittingfalling off a roofdutch anglerookie copmystery killergeneration xcut armcurfewloss of girlfriendaccomplicehigh school principalabandoned cardead teenagerhomoeroticteen violencefake bloodmurderer duovideo store clerkthreatening telephone callhanged bodyend credits roll callknife in backreflection in eyemotivehit with a doorphone terrorhiding in a bathroomtelephone terrortrailer narrated by don lafontainemetafictionreference to richard gerevoice changerreference to freddy kruegerwatching horror movie on tvintestinereference to meg ryanbeer bongbased on paintingfilm geekreference to anthony perkinsreference to ricki lakewatching a horror moviereference to jamie lee curtis (See All)

Blair Witch (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Blair Witch (2016)

Near Burkittsville, in the Black Hills Forest, on the root of a lightning-struck tree, the couple of Lane and Talia find a DV tape sticking out of the ground. The content of the found tape is mostly footage of static, however, near the end, there is also an intriguing small part where someone is try β€¦ing to escape from something that is after him, screaming and running in an abandoned house. After accidentally stumbling across the uploaded footage, James, believing that this is his final chance to put an end once and for all in the unresolved mystery of his sister's Heather disappearance, some twenty years ago in the same woods, he assembles a team of friends in search of answers. Sooner or later, the team will go astray in the heart of a green maze that is riddled with the chilling legend of Elly Kedward, the Blair Witch who relentlessly keeps messing with their sanity, gradually taking them down, one by one. Eventually, James will find himself in the epicentre of the evil activity, trapped inside the very house where his sister disappeared, unaware of the fact that, once more, the witch will demand her sacrifice. (Read More)

Subgenre:
suspensesupernaturalfound footagevideosurvival horrorpsychological thrillerpsychological horrorfolk horror
Themes:
evilmurderdeathfriendshipkidnappingbetrayalghostfearescapedeceptionsupernatural powerparanoiapaniccampingnear death experience
Mood:
gorerainambiguous endingmyth
Locations:
woodsforestsmall townnightclubcampfiretunnel
Characters:
boyfriend girlfriend relationshiphostagewitchself mutilationdeath of girlfriend
Period:
2010s
Story:
legendrunningbloodcharacter name in titleviolencesequeltwo word titletitle spoken by characterchasesurprise endingcell phonecorpseblood splatterrescuefalling from height β€¦vomitingriverf wordsubjective camerasurvivalflashlightdeath of friendimpalementstabbed to deathstabbed in the chestfalse accusationapologyno opening creditsdouble crosscreaturesearchthird parttreecursedangerscreamingcharacter's point of view camera shotmissing persontentknocked outcollege studentlightningactor shares first name with characterdisappearancebasementsuspicionprofanitysleepingfreeze frameheavy rainloss of friendwalkie talkieoverallsvideotapewristwatchyoutubeinterracial friendshipcrushed to deathbroken legtensionmercilessnessescape attemptblack and white sceneinfectionaerial shotattichandheld camerarainstormcharacters killed one by onetripteleportationtracking deviceyellingminimal castvomitold dark houseabandoned housedronenight visionno title at beginningfilm starts with textcabin in the woodsdeath of boyfriendcamcorderparasitewatching a videosymbolpentagrampsychotronic filmtime loopgrindhouse filmleg injuryno endingbanishmentmarylandbarricadefilm studentcamping triploss of girlfriendshaky camlost in the woodsrebootloss of boyfriendcrawlingvomiting bloodhearing noisesriver crossingcentipedetime paradoxmysterious noiselovecraftianbroken footdark forestno cell phone signalrunning in the darkblair witchcrossing a riveropening creditsbootstrap paradoxsleeping in the foresthouse in the woodsblair witch projectmysterious figure (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Halloween (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloween (2007)

The residents of Haddonfield don't know it yet... but death is coming to their small sleepy town. Sixteen years ago, a ten year old boy called Michael Myers brutally kills his step father, his elder sister and her boyfriend. Sixteen years later, he escapes from the mental institution and makes his w β€¦ay back to his hometown intent on a murderous rampage pursued by Dr Sam Loomis who is Michael's doctor and the only one who knows Michael's true evil. Elsewhere a shy teenager by the name of Laurie Strode is babysitting on the night Michael comes home... is it pure coincidence that she and her friends are being stalked by him? (Read More)

Subgenre:
tragedypsycho thrillerslasher flickamerican horror
Themes:
home invasionevilmurderdeathsuicidekidnappingrapetorturepsychopathbrutalitydysfunctional familyinsanitysadismpolice investigationmurder of a police officer β€¦mysterious death (See All)
Mood:
slashergoredarknessblood and gore
Locations:
small townstrip club
Characters:
killerteenagerafrican americanboyfriend girlfriend relationshipboyserial killerhostagevillainpsychiatristsheriffterrorslasher killerserial murderer
Period:
1970s
Story:
pervertmaskbloodsexfemale nuditymale nudityviolencefemale frontal nudityfemale rear nudityfemale full frontal nudityphotographtitle spoken by characterknifechasepistol β€¦woman on topbeatingcorpseblood splatterremakeshot in the headfalling from heightdead bodytelevisionstrippershot in the backf wordsubjective camerastrangulationmassacrestabbingthroat slittingimpalementstabbed to deathstabbed in the chestjokechild in perilcontroversygraveyarddrowningauthorbeaten to deathstabbed in the backattackuniformcharacter's point of view camera shotevil manbaseball bathangingshot in the shoulderstalkingpremarital sexmurdererloss of motherprofanitykillingteenage sexblood spattersplattermaniackilling an animalelectronic music scoremass murderlifting someone into the airrageloss of friendpsychopsychologistvictimhome moviebroken legmasked manrampagecrime scenetensionmanhuntshot in the facemental hospitalbutcherheadphonesperversionmurder of a childdark pastbody countbroken armduct tapecharacters killed one by onekilling spreepumpkinbloodbathpsychoticswearingmasked killerpsycho killerhit with a baseball batmexican americanserial murderpsychopathic killerbad guymadmanporn magazinedead animalhuman monstertrick or treatingabandoned housesexual violencetombstoneslashingschool principalautumnstrong languagewhite trashdripping bloodbloody body of childpalm treecarnagenaked dead womanloss of sisterkiller childpsychiatric hospitalextreme violencedisfigured facegraphic violencemultiple murdermasked villainmatricideknife murderbloody violencebutcher knifeloss of familyfemale victimsadistic psychopathmurder spreedying during sexanimal killingmass murderervillain not really dead clichebutcheryjack o'lanterncrime spreedying wordscreepescaped mental patientdeeply disturbed personchild killedthroat rippinghigh school friendmental asylumforkmultiple homicidepsycho terrormidwestweirdocreepymichael myersdisturbingdeath of petlifting a female into the airloss of boyfriendtorturerchild murders a childhanged boysadisticboogeymanreference to charles mansongun storepsychiatric wardskull crushinggory violencesatanicsickocontroversialcarrying a dead bodymurder of a policewomanjumpsuitclosing credits sequencesororicidebritish manmutilated bodychoked to deathempty swimming poolpsycho filmmultiple versionsviolentbathroom stallbrutalteen sexdisturbed childinsanekilled with a forkmonster as victimsadistic killeranimal mutilationslashed to deathwhite maskabusive childhoodthroat slitinstitutionalizationaluminum baseball batslaughteredinstitutionalizedchild as murdererfake skeleton (See All)

The Texas Chain Saw Massacre (1974) is one of the best movies like Bloody Summer Camp (2021)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Texas Chain Saw Massacre (1974)

40 years ago, five youths on a weekend getaway in the Texas countryside fell prey to a butcher in a mask made of human skin and his cannibalistic family, and horror cinema would never be the same. Violent, confrontational, and shockingly realistic, director Tobe Hooper's THE TEXAS CHAIN SAW MASSACRE β€¦ terrified audiences in a way never thought possible when it was unleashed on a politically and socially tumultuous America in 1974. Facing a storm of controversy, censorship, and outcry throughout its troubled release, this masterpiece of horror has stood the test of time to become a landmark motion picture and cultural milestone. To celebrate the film's 40th anniversary and its enduring ability to scare audiences both new and old, Dark Sky Films proudly presents THE TEXAS CHAIN SAW MASSACRE in an all-new 4k digital transfer and with a newly created 7.1 surround sound mix supervised by Tobe Hooper. Get ready to experience fear in a whole new way. (Read More)

Subgenre:
independent filmcult filmblack comedysuspensetragedypsycho thrillerslasher flicksurvival horrorteen horroramerican horrorindependent horror
Themes:
evilmurderdeathfriendshipkidnappingfeartortureescapepsychopathbrutalityparanoiadysfunctional familyinsanitysadismexploitation β€¦paniccannibalisminheritancemadnessnear death experience (See All)
Mood:
slasheravant gardedarknessambiguous ending
Locations:
wheelchaircarcemeterykitchenfarmroad triptruckgas stationtexascountryback country
Characters:
killerfamily relationshipsteenagerboyfriend girlfriend relationshipbrother brother relationshipbrother sister relationshipteenage girlteenage boyserial killerhostagevillainterrorself mutilationtruck driverslasher killer β€¦serial murdererself inflicted injury (See All)
Period:
1970syear 1973
Story:
urban legendwheelchair boundrunningmaskbloodviolencephotographknifechasesurprise endingvoice over narrationbeatingcorpseblood splatterurination β€¦blondecamerawritten by directorfalling from heightvomitingsunglasseslow budget filmcollegedecapitationsurvivalfoot chaseflashlightbound and gaggedambushmassacredeath of friendimpalementstabbed in the chesttied to a chairdinnerman with glassesradiodouble crosscontroversyvangraveyardnews reportfive word titlegravebeaten to deathdangerscreamingattackfirst of seriesproduct placementevil manknocked outskeletonscardeath of brotherhairy chestcountrysidetragic eventstalkingglassespigmurderertied upfirst partthreatened with a knifechickendirectorial debutgrandmothercult directorcross dressingcowkillingsplatterfreeze framemaniacpickup truckchainsawropegothiclifting someone into the airgroup of friendsmutilationbarnloss of friendcookvandalismbeardhammerspiderblockbusterpsychocovered in bloodgrindhousevictimproduced by directorskullhitchhikerhitchhikingmasked manfull moonrampageredneckwoman in jeopardydamsel in distresstensionlow budgetgrandfatherhippiecannibalmercilessnessdark humormutebutcherpsychotronicescape attemptcigarette lighterhit on the headjumping through a windowone dayvegetarianswingbarbecuebody countlens flarelaughingcharacters killed one by onekilling spreetank toploss of brotherbloodbathmasked killersouthern accentclose up of eyesserial murderpsychopathic killerbad guycar troublehysteriamadmanyellingface maskminimal castvomithead woundold dark housescene before opening creditshuman monstermeatestatetexanabandoned househomicidal maniacfarmhouseanimal crueltyslashingcar washfilm starts with texthit by a truckhillbillyoffscreen killingheld captiveeyeballsummer vacationdeath of boyfriendwindmillmacabrefacial scarmasked villainslaughterhousepsychological tortureshrineradio newsbloody violencehit with a hammersole survivorpolaroid camerafemale victimpsychotronic filmsledgehammercut handmurder spreeclose up of eyeastrologyfurniturebonedisturbed individuallifting person in airbutcherygrindhouse filmsocial decaybludgeoningextreme close upwoman in dangerleg injuryscreaming womansinisterstraight razorcryptcreepman in a wheelchairbroomno endingtoothcaged animalwrenchstate name in titlejumping out a windowsouthbird cagegas station attendantdecomposing bodyrunning out of gaswriting in bloodcut armscreaming in feardinner tablefrozen bodypocket knifeskinweirdocreepybanned filmdead teenagerdisturbinggeneratorstate in titleboneslifting a female into the airruralhuman skulltorturergrave diggermidnight moviehenremadesadisticscreaming in horrordrive in classicfinger cutbirdcagetroubled productionanthropophagushand woundsouthern gothicreference to draculagrave robbinghoroscopemalletevil laughterhorror movie remadehypothermiascream queenyelling for helpsickoburning a photographeating human fleshcontroversialpolaroid photographinbreedinggruesomehell on earthman eatermeat hookrotting corpsesummertimeporch swingarmadillochainsaw murderdreadatonal music scoredesecrationmeat grindermisdirectionpsycho filmfrozen alivedisorientationpower toolbrutalleatherfacebased on ed gein18 wheelervictim invited to dinnercontemporary settingfarmlandrolling down a hillheadlightspower generatorshot in sequencehuman bonemad familybell bottomscut fingerpenknifewearing human skinbroomstickhead traumahouse of horrorsreference to zorroevil smilehaving picture takengroup of fivehit on the head with a hammerdesolateeighteen wheelersoda machinesucking bloodflashbulbfood trayforeshadowstrapped to a tablecutting the palm of one's handhit with a broomrolling downhillscreen doorblowing a raspberrycannibal familycut legevil familytool in title (See All)

Cell (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Cell (2016)

When a strange signal pulsates through all cell phone networks worldwide, it starts a murderous epidemic of epic proportions when users become bloodthirsty creatures, and a group of people in New England are among the survivors to deal with the ensuing chaos after.

Subgenre:
independent filmsuspensesupernaturalpost apocalypsesurvival horrorzombie apocalypsedisaster film
Themes:
home invasionmurderdeathrevengesuicidefeardrunkennessescapedeceptionbrutalitysupernatural powerparanoiainsanitysurveillancepanic β€¦apocalypsecannibalismnear death experience (See All)
Mood:
gorebehind the scenesnightmareambiguous ending
Locations:
woodsbartrainforestcemeteryairplaneairportkitchenapartmentcampfiretunnelschool teachercar bombnew englandcar fire β€¦train driver (See All)
Characters:
father son relationshipmother son relationshipteenagerboyfriend girlfriend relationshipbrother sister relationshipteenage girlteacherzombiepolice officerstudentartistsecurity guardteacher student relationship
Period:
2010s
Story:
tire ironaxepartybloodbased on novelviolenceone word titledogfightcigarette smokingdancingtitle spoken by characterexplosionknife β€¦chasesurprise endingpistolfirebased on bookcell phonebeatingdreamcorpseshot to deathblood splattershot in the chestshot in the headshotgunrescueslow motion scenecatswordbrawlfalling from heightshowdownrifleheld at gunpointbombshot in the backsurvivalfoot chaseflashlightambushmontageimpalementstabbed to deathdinertoiletstabbed in the chestsubwayexploding cardisarming someonedrawingchild in perilhit by a cardouble crosssearchtransformationshot in the foreheadbartenderattempted murderbeaten to deathdangerscreamingkeyperson on fireattackfantasy sequencepay phoneon the roadbaseball batexploding bodyundeaddisasterfireplacebow and arrowburned aliverevelationmachetelistening to musicscene during opening creditssurvivormutantviruscooksecurity cameracaught having sexeccentriccovered in bloodmind controlend of the worldburialeaten alivebarefootmobile phonedual wielditalian americanboston massachusettscannibalchaosshovelstabbed in the legairplane crashaccidental killingaerial shotatticblood on shirtdisfigurementrefrigeratorgasolineaxe murdermutationburned to deathsmokesurprise after end creditshit with a baseball batenglishman abroadtext messagingdjmysterious manliving deadvietnam veteranfinal showdownbag over headhiding in a closetconstruction workervomitepidemictowerworld dominationabandoned housejukeboxmegalomaniacinsomniaanarchyexploding truckdamman kills a womansuicide bomberwoman kills a manburnt bodymetal detectortitle same as bookmatricidecrowbarpool of bloodmainehoodiemass gravepsychotronic filmimprovised weaponexploding airplanehusband murders wifeman hits a womangrindhouse filmvietnam war veteransausageice cream truckdoomsdayhooded figurec4 explosivesscreenplay adapted by authorset on fireconspiracy theoristtaxidermyabandoned carairport securitybased on the works of stephen kingelectromagnetic pulsehusband wife estrangementmass deathstrapped to a bombthrown from heighttennis ballfoaming at the mouthdrive in theaterwoman murders a manshared dreamsignalabandoned apartmentaxe in the chesthordehooded sweatshirtinsomniacabandoned cityexplosives expertabandoned schoolprep schoolterminalwhiskysoccer fieldcontrol towerfalse endingcell phone detonatorsuicide vestmysterious figure (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Splinter (2008)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Splinter (2008)

While camping in the woods, Polly Watt and her clumsy boyfriend Seth Belzer damage their tent. They decide to spend the night in a low-budget motel. Meanwhile the criminals, Lacey Belisle and Dennis Farell, have trouble with their runaway car while heading to Platt and they walk on the lonely road.  β€¦When Polly passes by Lacey, she stops the car and the couple is rendered by Dennis. However, Polly hits something in the road and while replacing the tire, they are attacked by a weird splinter. The car overheats and they stop in a gas station, where they are trapped by zombies, victims of the splinter parasite. (Read More)

Subgenre:
body horror
Themes:
deathsuicidemonsterguiltself sacrificemurder of a police officer
Mood:
gore
Locations:
woodsgas station
Characters:
boyfriend girlfriend relationshippolice officerhostage
Story:
tire irontireviolenceone word titlecigarette smokingchasesurprise endingpistolfirecorpseblood splattershot in the chestshot in the headshotgunheld at gunpoint β€¦beerbathroomshot in the backhit by a carcreaturetentbaseball batmurderersevered armfireworksicesecurity camerahammersevered handbroken legstealing a carinfectionblood on shirthandheld cameraone dayconvictbody landing on a carbroken armsevered legdead woman with eyes opentorso cut in halfanniversaryvideo surveillanceescaped convictamputationcarjackingparasitespitting bloodarm cut offhatchetpolicewoman killingtrail of bloodjumping from a rooftopfreezerreanimationhand cut offscrewdrivercamping tripfreezingbroken fingerfinger cuttorn in halfmatchesassimilationexploding gasoline stationdead policewomanthermometerdog hit by a cartemperaturediversionpushing a carcutting arm (See All)

House Of 1000 Corpses (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

House Of 1000 Corpses (2003)

In "House of 1000 Corpses", two young couples take a misguided tour onto the back roads of America in search of a local legend known as Dr. Satan. Lost and stranded, they are set upon by a bizarre family of psychotics. Murder, cannibalism and satanic rituals are just a few of the 1000+ horrors that  β€¦await. (Read More)

Subgenre:
independent filmcult filmdark comedyslasher flickcreature featuresadistic horror
Themes:
murderdeathsurrealismkidnappingrapejealousyfeartorturefuneralmonsterseductiontheftdeath of fatherinsanitymental illness β€¦sadismtheatrecannibalismmadnessmurder of a police officer (See All)
Mood:
slashergorerainnightmare
Locations:
cemeterypolice carroad tripcavegas stationmuseumtunnelshedcave in
Characters:
family relationshipsfather son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoobrother sister relationshipserial killerthiefsheriffslasher killerpolice lieutenantevil doctor
Period:
1970syear 1977
Story:
urban legendlegendaxemaskbloodnumber in titleviolenceflashbackbare chested maledancingphotographknifechasesurprise endingpistol β€¦firebeatingdreamcorpsedigit in titleshot to deathblood splattercar accidentshot in the headshotgunslow motion scenewatching tvthongrifleheld at gunpointhallucinationrevolvershot in the backsubjective camerahalloweenbound and gaggedstabbed to deathstabbed in the chesthousetied to a chairmapsevered headman with glassescoffinritualgraveyardshot in the foreheadgravecharacter repeating someone else's dialogueperson on firecharacter's point of view camera shotactor playing multiple rolesmissing personevil manlightningskeletonhanginghalloween costumelong takedisappearancecheerleadercrosssplit screenpigtied upcharacter says i love youthreatened with a knifecult directormaniacpoemtv newsundergroundmass murdertape recorderlifting someone into the airtied to a bedcaptivewalkie talkiegiantphone boothflatulencepsychosevered handskullhome movierapistcommercialhitchhikercrushed to deathmasked mangas maskduct tape over mouthnicknameface paintgash in the faceshot in the facenewsreel footagemental hospitalbody landing on a carknife throwingraised middle fingerlanterndead woman with eyes openpsychoticmannequintorso cut in halfhit with a baseball batintestinesmadmanburied aliveneedleshot in the neckold dark househuman monsterfreakmental retardationnight visionbillboardpsychedelicbody in a trunkdeputyauto mechanicdeath of boyfriendsleeping in a carburnt bodytow truckneck bracereference to john waynebreaking through a doorburn victimghoulevil clownpitattempted robberyjack o'lanternspotlightradio djdepravitycandlelightliquor storeknife in the chesthidden gunserial rapistno survivorstv hostcult figurekiller clownhand cut offfemale serial killerreference to mickey mousetrick or treatsatanic ritualbreaking a car windowmusic score composed by directorscalpingsevered facemissing person posterbroken windshieldreference to charles mansonclown makeupdumb criminalhiding in a carclown facefried chickendrinking and drivingrabbit costumetourist attractionstocking capstraight edge razorfunhousevictim invited to dinnerreference to donald duckroadside attractionfetus in a jarmounted animal headreference to jayne mansfieldshooting out tirehead bracereference to nancy drewreference to ed geinreverse negativedunce cap (See All)

The People Under The Stairs (1991) is one of the best movies like Bloody Summer Camp (2021)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The People Under The Stairs (1991)

The People Under the Stairs is the story of a young boy (Fool) from the ghetto and takes place on his 13th birthday. In an attempted burglary (along with two others) of the home of his family's evil landlords, he becomes trapped inside their large suburban house and discovers the secret of the "chil β€¦dren" that the insane brother and sister have been "rearing" under the stairs. (Read More)

Subgenre:
independent filmcult filmblack comedydark comedypsycho thrillersurvival horroramerican horror
Themes:
home invasionevilmurderdeathkidnappingdeceptionincestpsychopathinsanitymental illnesssadismgreedcannibalismwealthstarvation β€¦claustrophobia (See All)
Mood:
slashergoresatiredarknesssocial satire
Locations:
los angeles californiaslum
Characters:
policefather daughter relationshipmother daughter relationshipafrican americanbrother sister relationshipvillainterrorkiller dog
Period:
1990s
Story:
pervertbloodviolencedogcigarette smokingtitle spoken by characterknifepistolcorpseshot to deathblood splattershot in the chestface slapshotgunbirthday β€¦flashlightmansionimpalementhousechild abusechild in perilvanracial slurcharacter repeating someone else's dialoguesuburbelectrocutiondollevil mandeath of childskeletonbasementcharacter says i love youcult directorterminal illnessmaniacfalling down stairsfireplacekilling an animalbreaking and enteringgothicscene during opening creditsragemutilationstabbed in the stomachspiderpsychosevered handgrindhouseskullsadomasochismmasked manrampagesevered fingerstabbed in the throathit in the crotchcannibalchild protagonistdynamiteghettobooby trapatticperversionmurder of a childsoulbody countdead boycellarlasersightlandlordpsycho killergothserial murderpsychopathic killerbad guymadmanhiding in a closetold dark houseschemeevictionhuman monsterlighterhomicidal maniacfemale psychopathclimbing through a windowslashinganimal abusebayonetslingshotpondfuneral homemurderessroofexploding housecrowbardeformitytrapdoorwhite dresswoman slaps a mansadistic psychopathmurder spreedisturbed individualgrindhouse filmstarvingdeeply disturbed personmissing girltarot cardchild with a gunfalling off a roofmoney falling through the airgold coinbitten handpsycho terrorfemale serial killershot through a wallsecret passagewayhidden doorrobbery gone awryrottweilersevered tonguesick motherhidden treasureanthropophaguschild murderessnameless characterfurnacedragging a dead bodysickoabused childbad girlpitbullmute childtenementmutilated bodyhung by wristsbreaking through a wallfire pokerbible belttrapped in a housecrawling through an air shafthit with a brickscared to deathstepping on someone's footeyes gougedhouse of horrorscrawl spacebondage equipmenthuman eaten by a dogscalding waterskull ring (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Curse Of Chucky (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Curse Of Chucky (2013)

After the events of Seed of Chucky, Nica, a young woman forced to a wheelchair since birth, has to regroup her sister, Barb and her brother-in-law, Ian for a funeral after the death of her mother. While dealing with Barb, Ian, along with their 5-year-old daughter, Alice; Nica receives an odd package β€¦ - a creepy doll. After people start showing up dead, the fearless Nica soon suspects that the creepy doll is much more than just a doll. (Read More)

Subgenre:
paranormalamerican horror
Themes:
evilmurderdeathadulteryescapefuneralpsychopathsupernatural powerdeath of mothersadismmurder of a police officermurder of family
Mood:
slashergore
Locations:
wheelchaircemeteryelevatorcourtroom
Characters:
family relationshipshusband wife relationshipmother daughter relationshippolice officerserial killersister sister relationshipterroraunt niece relationshipslasher killerbrother in law sister in law relationship
Period:
year 1988year 2013
Story:
axebloodcharacter name in titleviolencesequelflashbackknifelesbian kisssurprise endingcorpseblood splatterslow motion scenewritten by directorfalling from height β€¦car crashf worddecapitationthroat slittingstabbed to deathtied to a chairjudgesevered headchild in perilcharacter repeating someone else's dialoguestabbed in the backelectrocutiondollelectronic music scorescene during opening creditssevered handhome movieduct tape over mouthcameoblack and white scenestabbed in the legscene after end creditsevidencedeath of sistereye gougingstabbed in the eyeaxe murdernannyclose up of eyesblood on camera lenscartoon on tvbag over headold dark houseblackouthomicidal maniacfilm projectoryoung version of characterblood stainwoman in bra and pantieseyeballwrongful convictionparaplegicsixth partstabbed in the facedirect to video sequel to theatrical moviehandicappedvillain not really dead clichestabbed with scissorsdeliveryevil dolldark and stormy nighthorror iconreference to charles mansondeath by electrocutionkilled in police carmanic laughterkiller dollmurder disguised as suiciderat poisonsunflowerjump scaremurdered priestpolice officer throat slitanimate dollvictorian houseelectronic music score in style of orchestral music scorenanny campoisoned food (See All)

Scouts Guide To The Zombie Apocalypse (2015)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Scouts Guide To The Zombie Apocalypse (2015)

A reckless janitor accidentally releases a zombie from a laboratory of research. Meanwhile, the teenagers scouts Ben Goudy and Carter Grant decide to camp for the last time since they are too old to be scouts. The problem is that they do not want to harm the feelings of their friend Augie Foster and β€¦ the Scout Leader Rogers. They have a flat tire after hitting a deer on the road and Carter's sister Kendall Grant, her boyfriend and her friend Chloe stop their Jeep to see whether they need a ride. They invite Ben and Carter to go to a party in the night. The two scouts leave the camping during the night to go to the party. When they drive through the town, they do not see a living soul and they decide to visit a night-club since the bouncer is not at the door. They discover that people have turned into zombies and they team-up with Ben's recent acquaintance Denise Russo, who is bartender in the nightclub, and Augie that was left alone at the camp and came to the town. Soon they discover that the non-infected inhabitants have been evacuated and the town will be bombed by the government. They decide to rescue Kendall but they find that the address her boyfriend gave to them is wrong. What can they do to save Kendall? (Read More)

Subgenre:
coming of ageblack comedyb movieabsurdismslapstick comedyteen movieteen comedyzombie apocalypseurban fantasy
Themes:
home invasionmurderdeathfriendshiprevengebetrayalfeardrunkennessescapedeceptionmilitaryrivalryunrequited loveexploitationapocalypse β€¦couragemurder of a police officernear death experienceunlikely heroghost town (See All)
Mood:
gorehigh schoolbreaking the fourth wallone night
Locations:
woodsbarschoolforesthelicoptermotorcyclesmall townbuspolice stationstrip clubcampfirelaboratory
Characters:
teenagerboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boyteacherzombiesoldierpolice officerhostagebest friendwaitressalcoholicolder woman younger man relationshipself mutilation β€¦homeless manneighbor neighbor relationship (See All)
Story:
tire irontirecampaxepartybloodviolencebare breastsmale frontal nuditymale rear nuditybare chested malegun β€¦kissfightphotographexplosionknifelesbian kisschasesurprise endingpistolfiretopless female nuditycell phonecorpseshot to deathblood splattermachine guncar accidentshot in the chestshot in the headshotgunrescueslow motion scenecatwritten by directorcondombare buttpaintingbeerbombcar crashjailclassroomalcoholstripperscientistshot in the backf worddecapitationsurvivalfoot chaseflashlightambushcaliforniamassacremontageimpalementstabbed to deathstabbed in the chesttied to a chairmapaccidentsevered headradiohit by a carpolice officer killedvanshot in the legold womanshot in the foreheadon the rungunshotattempted murdercharacter repeating someone else's dialoguevirginbeaten to deathdangerstabbed in the backportraitprologuekeysuburbperson on fireattackuniformproduct placementrace against timemissing persontentscene during end creditsdiarygymamerican flagbodyguardwighigh school studentsplit screenexploding bodybasementloss of fatherpolicewomanpremarital sexcharacter says i love youthreatened with a knifesevered armdismembermentundeadmonkeygaragetopless womanfalling down stairshand grenadefireplaceburned alivekilling an animalhead buttcagediseasevirusjail cellwalkie talkieexploding buildingbarefoot malecovered in bloodgrindhouseteenage protagonistback from the deadeaten alivereverse footagejanitorstealing a carbraveryu.s. armycrossbowblood on faceunderage drinkingstabbed in the throatobesityhit in the crotchhomelessstabbed in the neckresurrectionconvenience storeshot in the facebroken glassevacuationstabbed in the headmentorcigarette lighterstabbed in the legexploding headrivaljumping through a windowinfectionaerial shotwisecrack humorblood on shirtfriendship between boysone daydeerdisfigurementgasolinestabbed in the eyeclassmatebody countaxe murdermutationtrophysevered legflat tiremale virginheroismdjblood on camera lensearphonesflagfire extinguisheroutcastshot in the neckdead animalhomagedefecationhead blown offarmored carjournallightermale friendshipabandoned housemallblood stainburnt facehead bashed inreluctant herobitten in the neckshot in the handaltered version of studio logohead cut offevil womantrampolinebadgesitting on a toilettraffic accidentbouncerstabbed in the facecellreference to star warscut into piecesscatological humorvending machineimprovised weaponburn victimshot in the crotchhouse on fireanimal killingpunch in facestupid victimknocked out with a gun buttteenage heromale male hugoutbreakzombie attackscreaming womanscientific researchselfiehardware storeliquor storestabbed in the mouththroat rippingnight clubpaddlesurprise during end creditsbechdel test failednail gunaxe in the headlearning the truthbarricademan wearing a wigfalse teethcorporalscientific experimenthand through chestscouttoupeeblood on handsboy scoutgeneration yreference to britney spearssevered penisbustid cardtoilet stallabsurd violenceclassmate classmate relationshipstabbed in the crotchcleanerhit with a frying panstabbed in the foreheadvulgar languagehit with a car doorgory violencedead deerfirst aidscreaming girltaking off underwearmarshmallowmopwoman hits manmillennialrecruitmentcampsiteknothole in chestteeth knocked outfertilizeractor talks to audiencehordejaw ripped offmale female fightbiting someonerunning out of ammoface burntooth knocked outescape out a windowgarbage chutescoutingbank notecopped feelreference to dolly partonescape out windowhomemade explosivekilling a deerobscene hand gesturecat ladyescaping out a windowpenis ripped offlock pickingcagedweed whackerescape by the windowrecruitment videoreference to bambibitten in the armreading someone's diaryface blown offwater treatment plantgearing upzombie animalevil old womanheart massagescoutmasterstabbed through the neckzombie cat (See All)

The Evil Dead (1981)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Evil Dead (1981)

Five college students take time off to spend a peaceful vacation in a remote cabin. A book and audio tape is discovered, and its evil is found to be powerful once the incantations are read out loud. The friends find themselves helpless to stop the evil as it takes them one by one, with only one surv β€¦ivor left with the evil dead and desperately tries to fight to live until morning. (Read More)

Subgenre:
independent filmcult filmblack comedydark comedystop motion animationslasher flickdark fantasygross out comedyamerican horrorsupernatural horror
Themes:
evilmurderdeathrapeghostdancesupernatural powersadismsupernatural rapebook of evil
Mood:
slashergoreone night
Locations:
woodsforestcarsinging in a car
Characters:
friendboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boystudentself mutilationself cannibalism
Period:
1980s
Story:
axebloodfemale nudityviolencekissthree word titlesurprise endingfireblood splatterremakeshot in the headshotgunwritten by directorshootingbook β€¦low budget filmcollegedemonriversubjective cameradecapitationstabbingbridgestabbed to deathsnakesevered headanti heronecklacepaingravetreestalkerstabbed in the backkeyfirst of seriescharacter's point of view camera shotpossessionisolationbasementhauntingfirst partcabindirectorial debutcult directordismembermentchainsawoccultspiritfireplacedestructionsexual abusegroup of friendsmutilationcaucasianblockbustersevered handgrindhouseblack humorburialreverse footagetrappeddark humorpsychotronicstabbed in the legfogdead maneye gougingh.p. lovecraftsiegedemonic possessionsexual assaultroomsevered legcharacters killed one by onecellardeath of loved onetripplaying cardsclose up of eyesdead girlblood on camera lensbeheadinglevitationviolence against womenevil spirittelling someone to shut upvery little dialoguesexual violencestabbed in the armtape recordingtennesseekiss on the lipscabin in the woodsamputationbased on short filmmichiganhandextreme violenceflametragic lovebloodshedstressfemale victimtongue in cheektapepsychotronic filmsevered footgrindhouse filmcardsno endingcult figuredecomposing bodystabbed in the footlifted by the throatshaky camdead teenagergrandfather clockobject in vaginaabsurd violencecult movie castevil deadover the topnecronomiconevil laughdecapitated headpixelationhorror movie remadepart stop motionvideo nastycar won't startjump scaremelting faceincantationporch swingpossessed womanunusual sex actburying a dead bodygraphic rapeanimate treepossessed manstabbed with a pencilabuse against womenancient bookbook of the deadcharacter says go to hellsex with a foreign objectmockingspirit worldkilled with an axeancient cityfighting with selfgiant plantpoked in the eyeattacked by a plantgroup of fivelocked in a cellardemonic undeadpendulum clockperverse sexthrown across a roomshovel through headpretending to be asleepraped by treessaying boosumerianunnatural phenomenonjewelry as giftsumer (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Freddy Vs. Jason (2003) is one of the best movies like Bloody Summer Camp (2021)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Freddy Vs. Jason (2003)

It's been nearly ten years since Freddy Krueger terrorized people in the dreams, and the towns folk want to keep him erased from their memory. Freddy still has one more plan on getting back to Elm Street. He resurrects Jason Voorhees and sends him off to kill. The more bodies which fall to the groun β€¦d, the stronger in which Freddy becomes. This is until, Freddy realizes that Jason isn't going to step aside easily, and must be taken down himself. (Read More)

Subgenre:
independent filmcult filmsuspensesupernaturalpsycho thrillerparanormal phenomenaslasher flickamerican horrorcanadian horror
Themes:
evilmurderdeathrevengesuicidekidnappingghostfeartorturedrunkennesspsychopathdeath of fatherbrutalitysupernatural powerdeath of mother β€¦insanityabductiontraumafear of water (See All)
Mood:
slashergorerainhigh schoolnightmarebreaking the fourth wallblood and gore
Locations:
forestcemeterysmall townpolice stationlakeschool nurse
Characters:
killerfather son relationshipmother son relationshipfather daughter relationshipboyfriend girlfriend relationshipteenage girlteenage boyzombieserial killerlittle girlvillainsheriffterrorslasher killermysterious villain β€¦serial murderer (See All)
Period:
2000s
Story:
summer campmaskpartybloodcharacter name in titleviolencesequelflashbackphotographexplosionsurprise endingpistolshowerfirevoice over narration β€¦dreamcorpseblood splatterslow motion scenebrawlfalling from heightcar crashdemondecapitationfoot chasestabbingimpalementsevered headdream sequencechild in perilunderwater scenevandrowningskinny dippinglibrarycharacter repeating someone else's dialoguevirginprologueperson on fireelectrocutioncharacter's point of view camera shotcover upevil mandeath of childdeath of brotherhigh school studentstalkingneck breakingpremarital sexmurderercabinsevered armdismembermentkillingundeadsplatterchild murdermaniacburned aliveheroinemass murdermachetelifting someone into the aircomaragemutilationpsychosevered handvictimgoatcrushed to deathmasked manrampagesevered fingernew jerseymisunderstandingbutcherpsychotronicmedicationmurder of a childalternate realityeye gougingslaughterbody countdemonic possessioncharacters killed one by onekilling spreegeekburned to deathmasked killernewspaper clippingpsycho killertorso cut in halfblood on camera lensserial murderpsychopathic killerbad guybeheadingmadmanmysterious manfinal showdownnecrophiliakilldockohiolockerevil spiritsexual violencehomicidal maniacstonerslashingdomineering motherflaskhanging upside downburnt facecornfielddeputywrist slittingkidnapperdripping bloodchild kidnappingravedeath of boyfriendcrossoverburnt bodypsychiatric hospitalgraphic violenceclawmasked villainbloody violencedeformityfemale victimsadistic psychopathpsychotronic filmbreaking through a doormurder spreemass murderervillain not really dead clicheghoulbutcherychild abductionescaped mental patientfedoracaterpillarglovearm ripped offchild killedsevered earsliced in twoeighth partpsycho terrormidwestchild killerobituarychild murdererhand through chestdead teenagerhockey masktorturerdemonicboiler roomsadisticmissing person posterburnt handpassed out drunkserial child killerbroken backtranquilizergory violenceeast coastlucid dreamsataniccamp counselorgruesomejason voorheesdouble impalementhell on earththrown through a glass dooreleventh parttwo killersshared dreamdisbelieving adultfreddy kruegerfriday the thirteenthmonster versus monsternightmare becomes realityreanimated corpsemachete mutilationpsycho filmserial teen killerbrutaltroubled childhoodreference to the three stoogesmutilated childsevered nosehead spinmonster as victimserial child murderelm streetslashed to deathspringwood ohioabusive childhoodserial child murdererwessex county new jerseycrystal lake new jerseyevil versus evilkilled with machetekiller vs killerdreams vs realityserial teen murdererkilled by machete (See All)

P2 (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

P2 (2007)

The story centers on a corporate climber who gets stuck working late on Christmas Eve and finds herself the target of an unhinged security guard. With no help in sight, the woman must overcome physical and psychological challenges to survive.

Subgenre:
independent filmblack comedysuspensepsycho thrillerslasher flickpsychological thrillerholiday horrorchristmas horror
Themes:
murderdeathrevengekidnappinginfidelitychristmasbetrayalfeardrunkennessescapeinvestigationdeceptionlonelinesspsychopathobsession β€¦paranoiainsanitymental illnesssurveillanceabductioncrueltypanicmadnessnear death experience (See All)
Mood:
slashergoreneo noircar chasedarknessone night
Locations:
new york citycarsnowwatertaxielevatorurban settingpolice carcityoffice
Characters:
policefemale protagonistpolice officerpolicemanhostagesecurity guardpolice detectiveslasher killermysterious villain
Period:
winter
Story:
tire ironaxerunningpartybloodnumber in titleviolenceone word titledogfightexplosionknifechasesurprise endingtelephone call β€¦firecryingcell phonehigh heelsbeatingcorpsedigit in titleblood splatterfistfightcar accidentmirrorpunched in the facebrawlplace name in titlecar crashhandcuffsvoyeurmanhattan new york cityf wordsubjective cameracleavagesurvivalfoot chasenewspaperflashlightbound and gaggedwinestrangulationvideo cameraambulancestabbingwomantied to a chairnonlinear timelineexploding carfalse accusationapologyhit by a cardouble crossduelattempted murderargumentstalkerorganized crimestabbed in the backscreamingperson on fireelectrocutionattackcharacter's point of view camera shotproduct placementknocked outkicked in the facechristmas treeattempted rapebodyguardstalkingexploding bodyisolationdie hard scenarioobscene finger gesturerecord playermaniacholidaypickup truckeavesdroppinganswering machineburned alivekilling an animalsociopathsecurity cameracaptivekicked in the stomachvideotapeimpersonationcovered in bloodteddy bearfaked deathparking garageanimal attackcrushed to deathduct tape over mouthbarefootwoman in jeopardydamsel in distresstensionfloodstealing a cartrappedbloody nosesurveillance cameramisunderstandingpower outagebusinesswomantitle appears in writingco workerescape attemptstabbed in the headchristmas evesexual harassmentdisembowelmentaerial shotblood on shirtdead manone daybuildinggasolinestabbed in the eyelonerbody countduct tapenervous breakdowncharacters killed one by oneburned to deathreckless drivingchloroformphysical abuseflat tiredead dogintimidationintestinesreference to elvis presleyaccountantcar troubleyellingchristmas presenttaserdisposing of a dead bodyanimal abusemind gamebody in a trunkdruggedhandcuffedwoman kills a manstabbed in the shouldermurder witnesssexual frustrationcar set on firetow truckgropingoverturning carmenacenervousnesshomeless personwoman fights a mantormentcrowbarpsychological torturefemale victimwhite dressimprovised weapontrunklocked in a roommolestationanimal killingchristmas lightsdoormanman hits a womanstupid victimfake accentreal timesurveillance footagechrysler building manhattan new york citycat and mousecrime of passiontauntingdeeply disturbed personchristmas decorationstragic villainwrench911power failurebipolar disorderwoman punches a mancrushed by a carforkman fights a womanhomeless womannight watchmanrottweilerman punches a womansingle set productionwoman hits a mandog bitehandcuffed womanrental carnew york city skylinefire hosechased by a dogno cellphone signalduct tape gaglock pickdumb policesprinkler systempettingflipping carstabbed with a forksleeping womanclaustrophobicderangedemployee employee relationshippersonality disorderstuck in an elevatorattacked with a knifefingernail cut offdragged by a carelvis presley impersonatorsanta costumevictim invited to dinnercar showroomdeath of a petvideo screenkilling a petflooded roomwet dressburned up cartitle appears on screenbitten in the legbroken cameratitle appears in text on screenchicken racerace impersonation (See All)

Creep (2014)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Creep (2014)

When a videographer answers an advert of the website Craigslist for a one-day job in a remote mountain town to video the last messages of a dying man. The job takes a strange turn when the last messages get darker and darker. The videographer continues to see the job through, but when it is time to  β€¦leave he is unable to find his keys, and when he receives a strange phone call he finds his client is not at all what he initially seemed to be. (Read More)

Subgenre:
independent filmfound footage
Themes:
home invasionmurderfilmmakingdeceptionpsychopathobsessionwilderness
Mood:
nightmare
Locations:
woodsforestcarbathtubapartmentlaketown
Characters:
killerserial killeractor director writer
Period:
year 2012
Story:
axemaskone word titlebare chested maleknifesurprise endingtelephone callcell phonewritten by directorpaintinglielow budget filmsubjective cameramountainvideo camera β€¦stabbed to deathdinerapologyno opening creditsbathnecklacetalking to the cameraconfessionparkstalkerwritten and directed by cast memberstalkingautomobilethreatcabinsleepingsubtitled scenefreeze framehuggingwolfvideotapemasked manwhiskeyshovelstabbed in the headdeath of protagonisthandheld cameratitle at the endintruderaxe murderbenchwritten by starlyingdrugged drinkserial murdervideo tapeminimal caststuffed animaldying mancabin in the woodsvideo footagemale in bathtubdisturbed individuallocketpackagevideo diaryaxe in the headcar keysdigital videostuffed toylock of hairtwo directorswatching someone sleeplake housejump scaregarbage baglooking for workvideo messagementally unstabletwo handersitting on a benchanimal maskcalling the policesecret filmingman in bathtubreference to craigslistantagonist as protagonistunpunished antagonistdisturbed personhonda civicopening creditshouse in the woodsmentally unstable manwolf costumewritten by actorlocket with photographmountain townrape confessiontape recorded confession (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

A Nightmare On Elm Street 2: Freddy's Revenge (1985)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street 2: Freddy's Revenge (1985)

A new family moves into the house on Elm Street, and before long, the kids are again having nightmares about deceased child murderer Freddy Krueger. This time, Freddy attempts to possess a teenage boy to cause havoc in the real world, and can only be overcome if the boy's sweetheart can master her f β€¦ear. (Read More)

Subgenre:
cult filmsupernaturalparanormalparanormal phenomenaslasher flickteen horrorbody horroramerican horrorsupernatural horrorurban fantasylgbt horrorcult classichorror b movie
Themes:
evilmurderdeathfriendshiprevengesurrealismkidnappingghostfearescapemonstervoyeurismpsychopathbrutalitysupernatural power β€¦paranoiasadismpanicmysterious deathshower murder (See All)
Mood:
slashergorerainhigh schoolnightmaredarknesspoetic justice
Locations:
barschoolswimming poolsmall townbusdesertbaseballstormgay barschool busbus driverabandoned factoryschool bus driver
Characters:
killerfamily relationshipshusband wife relationshiphomosexualfather son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipfriendboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boy β€¦teachergirlserial killerstudentpolicemanlittle girlvillainterrorself mutilationdriverslasher killerserial murderergay teacher (See All)
Period:
1980syear 1985
Story:
urban legendkidslegendpartybloodcharacter name in titlenuditynumber in titlemale nudityviolencesequelmale rear nuditybondagedogbare chested male β€¦fightcigarette smokingknifechasesurprise endingshowertelephone callfirecryingdreamdigit in titleunderwearblood splatterface slapshotgunslow motion scenewatching tvundressingbikinibare buttsunglassessecond partplace name in titledead bodyneighbornumbered sequeldemonhallucinationvoyeurclassroomcriminalf wordsubjective camerafoot chasename in titlemassacrestabbingbasketballimpalementfootballstabbed to deathstabbed in the chestsnakeapologydream sequencebirdchild in perilcreaturespankingtransformationbartenderpublic nuditystabbed in the backscreaminglocker roomperson on firecharacter's point of view camera shotpossessionevil mankicked in the facelightningscreamdiaryconvertiblegymhigh school studentexploding bodybasementratmurderercharacter says i love youthreatened with a knifeclasshaunted houseobscene finger gesturewhippingbare chested male bondagenewspaper headlineredheadundeadmaniaccoachapplauseidentityteen angstburned alivekilling an animalnipples visible through clothingelectronic music scorewoundmass murderbeer drinkinggothicgay characterlooking at oneself in a mirrorlistening to musiclifting someone into the airjoggingmutilationmousestabbed in the stomachbarefoot malepsychovisitcovered in bloodgrindhousesadomasochismteenage protagonistcrying mans&mback from the deadmale underwearfull moonrampagedamsel in distressseriesblood on faceunderage drinkinggash in the facebutcherescape attempthit on the headmurder of a childrainstormdisfigurementraised middle fingerhomoeroticismsuspectbarbecuebody countbriefscellarkilling spreealarm clocktelekinesisnewspaper clippingpsycho killermale objectificationserial murderpsychopathic killertaking a showerbad guybarking dogmadmanhigh school teacherstuffed animalohiocafeteriaassumed identitysecond in seriesevil spirithomicidal maniacbroken windowfish tankslashingbroken mirrorbus stopsplit personalityburnt facepush upshearing voicesnewspaper articlevolleyballbare chested boyjock strapteenage sexualitymale name in titlelocked doorbreaking a windowpool partykicked in the headstabbed in the shoulderwhite briefsmoving inmurder suspectcrotch grabreading a newspaperawkward situationjumping into watershape shifterclawwoman in a bikinidance sceneheatriding a bikedead birdundressing someonesadistic psychopathpsychotronic filmwet clothesbaseball teambreaking through a doorfeet on tablemurder spreedragging a bodyvillain not really dead clichebreaking a mirrorbutcherygrindhouse filmsleepwalkingplant in titlearms tied overheadleg injuryidentity crisisdomineering fatherno endingglovecaged animalcrying maleshower roomwagontalking to oneselfboom boxbad dreampassive aggressive behaviortoastercut armsecretly observinghand injuryrepeated eventpsycho terrorlifted by the throatlocked inchild killerjumping ropechild murdererhand through chestgym classinvisible mansocial outcastblood on handsgay subtextgym teacherplace in titlescarred facedemonicstreet in titleboiler roomsadisticsequel to cult filmclassmate classmate relationshipgarden partykidnapped girlpower plantdrive in classichorror iconburnt handtaking off shoeswalking in the rainhomoerotic fightserial child killertennis racketcoors beerfurnacescreaming mantaking off pantsgory violencemale in a showernursery rhymetennis ballsleep deprivationwatching someone sleeplong tonguemelting facelifting a male into the airexposed brainhand bandagehell on earthmale bare buttmysterious eventburn scarcaged birdkidnapped womanobscene gestureshape shiftingskin rippingarm injuryscience teacherbaseball coachoverweight manteen sexualityfreddy kruegerjumping into a swimming poolnightmare becomes realitybird in a cageraw meatpossessed manclimbing a laddermale female fightsleeping shirtlessbad guy winsbiology teacherbiting someonegrillgroundedspurting blooddragging someoneattempted child murderescape out a windowclothes torn offpet birdsleep disorderclothes ripped offlocking a doorunpunished antagonistcracked mirrorhigh school coachkidnapped boymurder of a nude manscore employs electronic instrumentsserial child murdertaking off socksurban gothicbarred windowelm streetopen endingslashed to deathspringwood ohiothrowing something at someonehit on the head with a ballsleeping in classactor reprises previous rolebloody footprintcrying for helpmale bondagemistaken belief that someone is deadrunning barefoottrampled to deathdomineering husbandschoolmate schoolmate relationshipserial child murderercar over a cliffexploding animalleather barmale antagonistbandaged armescape by the windowface injuryhomophobic remarkreference to jack kerouacsleeping in underwearwrapped in a blanketbiology classburned handfalling asleep in classreading someone's diaryschool gymserial teen murdererarm bandagebroken doorhijacked busleg bandageplaying baseballpossessed boys&m clubsadistic teacherscar tissuecrotch grabbingdrinking coffeeface scarkilled in a showerlying on the floorripped off clothestowel snappingburning oneselffemale voyeurkidnapped manlocked in a carquestioning sexualitybiting legcutting someonedriving off roadhead rippingintroverted boymass panicmurder in a showerpassive aggressive manpouring rainsleeping fully clothedbossy fathergrabbing one's crotchscreaming boytalking with one's mouth full (See All)

I Spit On Your Grave (1978) is one of the best movies like Bloody Summer Camp (2021)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

I Spit On Your Grave (1978)

The film follows Jennifer, a writer who is working on a new novel and needs to get out of the city to finish it. She rents a riverside cabin in upstate New York to work on her novel, attracting the attention of a number of rowdy male locals. They catch Jennifer one day and strip her naked for the vi β€¦llage idiot (Matthew) and rape her. Jennifer is later attacked and raped a further two times by the four degenerates, and her novel is also destroyed. But Jennifer recovers, and in her now-twisted, psychotic state, she begins to seek revenge on the men. (Read More)

Subgenre:
independent filmcult filmb movievideoamerican horrorsadistic horrorhorror b movie
Themes:
evilmurderdeathrevengekidnappingrapefeartorturevoyeurismseductionangerpsychopathbrutalityhumiliationsadism β€¦exploitationcrueltyvengeancerape and revengerevenge murder (See All)
Mood:
slashergore
Locations:
new york citychurchforestcarsmall townbathtubbicyclewaterlakegas stationcountry
Characters:
killerfemale protagonistgirlserial killerwriterlustvillainserial murdererself justicesex with a stranger
Period:
1970s
Story:
pervertcastrationaxebloodfemale nuditymale nudityviolencebare breastsfemale frontal nuditymale frontal nuditybare chested malegunfemale rear nudity β€¦female full frontal nuditycigarette smokingnipplesmale full frontal nudityknifeleg spreadingpantiesfondlingcryingbeatingmirrorbikinilow budget filmvoyeurmale pubic hairriveralcoholtelephonecleavagenewspapergangnew yorkfemale pubic hairwhite pantiesdrivingman with glassesscantily clad femalecontroversydrowningjeanspublic nudityone against manysmokinggraveauthorscreamingunderground filmevil manhangingfemale removes her clothesglassesthreatmurderercabinhandgunvigilantekillingrecord playereyeglassesclaim in titlenipples visible through clothinginjurysexual abuseragemutilationdesperationgrindhousevictimrape victimrapistfemale killerredneckwoman in jeopardylow budgetmercilessnessdeath threatdark herosexploitationpanties pulled downgang rapeperversionbody countaxe murderbruisecharacters killed one by onekilling spreemisogynypsycho killerwoman in bathtubserial murderpsychopathic killerkillviolence against womenvigilantismmisogynisthuman monstercanoefemale removes her dressmental retardationsexual perversionsexual violencefemale psychopathloserharmonicadegradationanal rapebubble bathheld captivewhite trashwrathmotorboatcarnagefemale villainatrocitywoman wearing only a man's shirtbleeding to deathhammockextreme violencegraphic violencemurderesssmall breastsfemale prisonerfemale victimshared bathsadistic psychopathone woman armymurder spreeviolent deathdelivery boygrindhouse filmnoisesexual humiliationsuspendersfemale writersex on the floorgenital mutilationdeath by hangingmultiple homicidemistreatmentconnecticutdebaucheryfemale serial killersexual sadismcreepysexual crueltybanned filmdisturbinghanged boysadisticdrive in classiceye candyinfamygory violenceeast coastmisandryvideo nastyfemale murderergruesomelasciviousnessreference to coca colawoman murders a manoral rapefemale vigilantereading in bedrevenge killingextreme filmman forced to stripturning the tableswriter as protagonistmaking lovewoman haterpredator turns victimcut off penisderanged manpredator becomes preyrapist comeuppancetorture threatjean jacketsexy legsunpunished crimeforced fellatiopucciniloss of peniswoman's revengewoman on all foursbag of groceriesbottle rapemale genital mutilationrepetitive rape victimdisgusting (See All)

Evil Dead II (1987)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Evil Dead II (1987)

Ashley Williams travels to a secluded cabin in the woods with his girlfriend Linda where they find a tape recording of a professor and a book of evil. This unleashes a bunch of evil spirits that constantly terrorize Ash. Meanwhile a journalist comes to the area to study the book of evil. Ash and her β€¦ end up having to survive this swarm of evil until morning comes. (Read More)

Subgenre:
independent filmcult filmblack comedyepicdark fantasygross out comedyhorror spoofamerican horrorsupernatural horror
Themes:
evilmurdersurrealismghostdancemonstermemorytime travelsadismbook of evil
Mood:
gorenightmareavant garde
Locations:
woodsforestairplanekitchencastlestormbackwoods
Characters:
husband wife relationshipboyfriend girlfriend relationshipbrother sister relationshipdancerself mutilation
Period:
1980s1990s20th centuryyear 1987
Story:
axebloodsexnumber in titleviolencesequelkisschasethree word titlesurprise endingpantiesvoice over narrationsongunderwearblood splatter β€¦mirrorshotgunfalling from heightbooksecond partlow budget filmbathroomnumbered sequelpianodemonhallucinationdecapitationgood versus evilstabbingstabbed in the chestsevered headanti herotreecursestabbed in the backpossessionskeletonbasementhauntingratcabinsevered armshot in the armobscene finger gesturecult directordismembermentundeadsplatterchainsawfalling down stairsspiritfireplacetape recordertouristroman numeral in titlesevered handknightreverse footageloss of sonshovelpsychotronicthunderstormexploding headfogeye gougingdeerh.p. lovecraftstabbed in the eyedemonic possessioncellarplaying pianodaggerbeheadinglevitationstorehair pullinghead blown offevil spiritportaltornadoknocked unconsciousarcheologysawed off shotgunhillbillycabin in the woodsone linereyeballmeat cleavertragic lovebloodshedtongue in cheekloss of parentsrocking chaircult figurependantreanimationhand cut offshot through a wallwine bottlemousetrapvortexbreaking glassdisembodied handabsurd violenceevil deadover the topsame actor playing two charactersgreen bloodnecronomiconbridge collapsedecapitated headhead cut in halfpixelationactor playing dual rolepart stop motionshallow grave14th centurytarmacsame actor playing two characters simultaneously on screenstop motion scenereanimated corpseanimate tree1300sbook of the deadshattering glassharpyoldsmobilefighting with selfattacked by a plantdemonic undeadromantic songblack bloodcutting off own handtrophy animalglass breakingself strangulationsprayed with blood (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Wrong Turn (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Wrong Turn (2003)

Subgenre:
independent filmcult filmblack comedysuspensefish out of waterslasher flickteen moviesurvival horrorteen horrorpsychological thriller
Themes:
home invasionmurderdeathfriendshiprevengekidnappingfeartortureescapepsychopathbrutalityparanoiainsanitypaniccannibalism β€¦couragehuntingmurder of a police officerwildernessnear death experience (See All)
Mood:
slashergore
Locations:
woodsforestbathtubpolice cartruckcavegas station
Characters:
teenagerboyfriend girlfriend relationshipteenage girlteenage boypolice officerhostageinterracial relationshipself mutilationslasher killer
Period:
2000s
Story:
axebloodsexviolencecigarette smokingexplosionknifechasesurprise endingpistolfirecryingcell phone β€¦beatingcorpseshot to deathblood splattercar accidentshot in the headshotgunrescueslow motion scenefalling from heightshowdownriflecar crashmarijuanacollegeshot in the backdecapitationsurvivalfoot chaseflashlightbound and gaggedambushmountaindeath of friendstabbed to deathtoiletstabbed in the chestmapexploding carsevered headdisarming someonehit by a carpolice officer killedshot in the legtreestalkerdangerstabbed in the backprologuescreamingperson on firefirst of seriesdollcollege studentscene during end creditsprankstalkingfirst partthreatened with a knifewaterfallsevered armnewspaper headlinedismembermentarsonpickup truckpot smokingbow and arrowmachetemutantgroup of friendstied to a bedjumping from heighttorchbroken legredneckdamsel in distressstealing a carbraveryjob interviewcannibalmercilessnesspolice officer shotengagementbooby trapaerial shotblood on shirtone daydisfigurementgasolinebody countaxe murdersevered legcharacters killed one by onearrowtank topsmokeflat tiresouthern accenthit with a baseball batbarbed wirecar troublemolotov cocktailjunkyarddead animalold dark househuman monstermental retardationarcheryshot in the eyedeputyhillbillycabin in the woodsroadblockoffscreen killingcdmedical studentdeath of boyfriendstabbed in the shouldertow truckarcherexploding houseslaughterhousepsychological tortureroadpool of bloodrock climbingstupid victimvillain not really dead clicheclimbing out a windowpolice officer shot in the headextreme close upleg woundsinistershot with a bow and arrowbear trapsevered eargas station attendantcar wrecksurprise during end creditsabandoned cardead teenagerwest virginiaham radiostate trooperclichelatin americanwatchtowerdragging a dead bodyhead cut in halfevil laughteraxe murdererdenturesinbreedingmountain mandeath trapdeath of fiancevictimizationamateur radiowoman wearing a tank toprolling down a hillradio towercell phone out of rangeno cell phone signalstabbed through the mouthgas tankpine forestreference to a white picket fenceboiling potwrong turntreating a woundranger tower (See All)

You're Next (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

You're Next (2011)

When a gang of masked, ax-wielding murderers descend upon the Davison family reunion, the hapless victims seem trapped... until an unlikely guest of the family proves to be the most talented killer of all.

Subgenre:
black comedyconspiracyslasher flickdeadpan comedy
Themes:
home invasionmurderdeathdeceptionpsychopathdeath of fatherdeath of motherdeath of wifepanicinheritance
Mood:
slashergore
Characters:
killerhusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipbrother brother relationshipbrother sister relationshipserial killeraustralian
Story:
axeviolencebare breaststwo word titlebare chested malecigarette smokingknifesurprise endingtopless female nuditycell phonecorpseshot to deathblood splatterslow motion scenepunched in the face β€¦neighborshot in the backfoot chaseflashlightwinemansionthroat slittingimpalementstabbed to deathstabbed in the chestno opening creditspolice officer killedshot in the foreheadargumentcharacter repeating someone else's dialoguebeaten to deathstabbed in the backcollege studentshot in the shoulderdeath of brotherbasementtrapclaim in titlefireplaceheroinemachetefaintingcovered in bloodmasked mancamera shot of feetcrossbowstabbed in the neckdark humorkicked in the crotchtitle appears in writingstabbed in the headsibling rivalryjumping through a windowthrown through a windowbooby trapdeath of sistertitle at the endstabbed in the eyelooking at self in mirroraxe murdercharacters killed one by onearrowmasked killermale in showerclose up of eyesman cryingshot through a windowwoman cryingfamily reunionbroken windowstabbed in the armhired killerhead bashed inwoman in bra and pantiespatricidecrashing through a windowman punching a womancollege professordeath of boyfriendstabbed in the shoulderstabbed in the facehiding under a bedmasked villainmatricidefilm starts with sexbloody violencebutcher knifesole survivorwedding anniversaryflash camerafratricideleg woundsaying gracethroat cutbrickwoman wearing black lingeriejumping out a windowwoman punching a manstabbed multiple timeswriting in bloodstabbed in the footbig familybitten handrich familystartledloud musichit with a frying panmale in a showerno cellphone signalcleaversurvivalistblenderthrown through a glass doorfacial cutfamily portraithit in the throatstabbed with a screwdrivervictim invited to dinnervicodinclotheslinedvictim fights backpiano wirestabbed with a glass shardlooking under a bedstepping on a nailbreaking a lightbulb (See All)

The Strangers (2008) is one of the best movies like Bloody Summer Camp (2021)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Strangers (2008)

After returning from a wedding reception, a couple staying in an isolated vacation house receive a knock on the door in the mid-hours of the night. What ensues is a violent invasion by three strangers, their faces hidden behind masks. The couple find themselves in a violent struggle, in which they g β€¦o beyond what either of them thought capable in order to survive. (Read More)

Subgenre:
independent filmsuspensesurvival horror
Themes:
home invasionmurderfeartorturepsychopathparanoiapanic
Mood:
slasherone night
Locations:
rural settingkitchenshedcar fire
Characters:
boyfriend girlfriend relationshipserial killerterror
Period:
year 2005
Story:
invasionaxebloodviolenceflashbackcigarette smokingdancingknifesurprise endingcell phonebeatingcorpseshot to deathblood splattershot in the head β€¦shotgunwritten by directorcar crashpianoalcoholfoot chasebedroomflashlightcandledisguisedeath of friendstabbed to deathstabbed in the chesttied to a chairnonlinear timelineno opening creditsmarriage proposalchampagneevil manknocked outstalkingthreatisolationrecord playerpickup truckfireplaceice creambarnvandalismstabbed in the stomachcovered in bloodstrangerfemale killermasked manpump action shotgunconfrontationblood on shirtswingintruderwedding receptionmasked killerflat tireengagement ringmormonwoman in bathtubinterrupted sexharassmentbag over headhiding in a closetvery little dialoguehomicidal maniaccottagemind gamebubble bathfilm starts with textcabin in the woodsscene of the crimebleeding to deathcountry housemasked villainknife murderpsychological torturebutcher knifebreaking through a doorcut handcat and mousestarts with narrationtauntingnightgownwriting in bloodred lightham radiocrawlingbroken windshieldmasked woman911 callwind chimecandlelight dinnershower curtainunmaskingtwisted ankleloading a gunheld at knifepointsmoke alarmrose petalmasked intruderassembling gunsack maskflannel (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Them (2006)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Them (2006)

Clementine, a teacher in a French School in Bucharest, lives with her husband, Lucas, in a remote real estate in Snagov. During the night, Clementine is woken by weird noises outside their house, and Lucas sees their car being stolen. The lights are turned off, the phones are disconnected and they s β€¦ee that they are no longer alone. When weird lights appear outside, they hide in the cellar and try to ask for help from what could be a dreadful night of pure terror... (Read More)

Subgenre:
independent filmfrench horror
Themes:
home invasiondeath
Mood:
slashernightone night
Locations:
woodsforestcarkitchentunnelschool busschool teachercar thief
Characters:
teenagermother daughter relationshipboyfriend girlfriend relationshipchildrenboyteenage boywriter
Period:
year 2002
Story:
invasionbloodviolenceone word titledogcigarette smokingchasesurprise endingpantiesbased on true storycell phonefalling from heightcar crashclassroomtelevision β€¦strangulationhousebeaten to deathscreamingcouplegamenipples visible through clothingbreaking and enteringcaptivestrangerbroken glassintruderplayelectricityromaniahead woundfemale teacherlightervillaroad accidentcountry housekiller childgrindhouse filmleg woundexpatriateno survivorsnailbased on supposedly true storyabandoned carschool childteen violencejump scareunderground tunneldictationhooded sweatshirtcatacombsstrange noisechild's playbucharest romaniawake uprattletraveling through a sewercouple killed (See All)

Saw (2004)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Saw (2004)

Waking up in a undisclosed location in a unknown room two men, adam and gordon are trapped into a single room with a dead body. Given random tools with riddles hidnen around the room. Wondering who could have done this there are clues to who might of done it; the jigsaw killer. The question is not j β€¦ust who but why would a serial killer leave two men in a room. Both adam and gordon hiding secrets they must trust and work together to get out or die...can they survive jigsaws game or die trying? (Read More)

Subgenre:
independent filmcult filmslasher flicksurvival horrorsadistic horror
Themes:
home invasionmurderkidnappingmarriageinfidelitytortureescapeextramarital affairpsychopathcancerinsanityclaustrophobiaself harm
Mood:
slashergorecar chase
Locations:
hospitalhotelurban setting
Characters:
killerhusband wife relationshippolicefather daughter relationshipdoctorserial killerdetectivephotographerhostagepolice detectiveself mutilation
Story:
violenceone word titleflashbackgunsurprise endingpistolcorpseshotguncamerasecretbathroomrevolverbound and gaggedthroat slittingstabbed to death β€¦toiletchild in perilpolice officer killedclownpuppetperson on firepoisonfirst partburned alivegothicslow motiontape recorderblockbusterparking garageblack humorbarefootcrime scenetrappeddisembowelmentbooby trapbody countextortionimprisonmentvideo surveillancehiding in a closetrestroompolaroidmind gameelectric shockamputationbased on short filmsawaudio cassettechainedextreme violencemacabredarkroomtwo way mirrorpsychological torturelocked in a roomflashback within a flashbacksevered footvillain not really dead clichebludgeoningbear trappretending to be deadrepentanceevil dollorderlyforced suicidegame of deathchild in dangerdeath trappig maskbad guy winsplaying godtrapped in a roomdioramavillain escapeswalking on broken glassfamous theme (See All)

A Nightmare On Elm Street 4: The Dream Master (1988)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street 4: The Dream Master (1988)

Following up the previous Nightmare film, the dream demon Freddy Krueger is resurrected from his apparent demise, and rapidly tracks down and kills all three of the surviving Elm Street kids. However, Kristen (who has the ability to draw others into her dreams) wills her special ability to her frien β€¦d Alice before her demise. Afterwords, Alice soon realizes that Freddy is taking advantage of that unknown power she now wields to pull a new group of teenage children into his foul domain. (Read More)

Subgenre:
independent filmmartial artscult filmblack comedysuspensesupernaturalparanormalamerican horror
Themes:
evilmurderrevengefuneralpsychopathsupernatural power
Mood:
slashergorerainhigh schoolnightmare
Locations:
hospitalbeachcemeterysmall townelevatorschool nurseblood in water
Characters:
killerfather son relationshipfather daughter relationshipteenagermother daughter relationshipafrican americanbrother sister relationshipserial killertough guylittle girlwaitressvillainterrorslasher killerserial murderer
Period:
1980s
Story:
kidsjockbloodnumber in titlesequelfemale frontal nuditydogbare chested malecigarette smokingphotographsurprise endingfiredreamcorpsedigit in title β€¦blood splatterurinationface slappunched in the faceplace name in titlerock musiccar crashneighbornumbered sequeldemonambulancedeath of friendstabbed to deathdinerstabbed in the chestsevered headcoffincharacter repeating someone else's dialoguelocker roomwidowerperson on firepay phoneevil mankicked in the faceskeletondeath of brothercheerleaderdeath of songlassesmurdererunderwatersevered armsleepingkillingundeadpizzamaniacsurgeryteen angstelectronic music scoreslow motionwoman with glasseslifting someone into the airmutilationstabbed in the stomachkicked in the stomachfourth partmovie theatercrushed to deathback from the deadrampageseriesresurrectionbutcherstabbed in the headblack and white scenedaydreamsouldisfigurementabusive fatherlooking at self in mirrorbroken armkilling spreepsycho killerserial murdervillain played by lead actorpsychopathic killerbad guyreturning character killed offneedlejunkyardohiodefecationold dark housecockroachevil spirithomicidal maniacbugweightliftingclimbing through a windowfish tankslashingbroken mirrorasthmaburnt facebody in a trunkdripping bloodafrican american womanpunching bagdeath of boyfriendhome videoclawsadistic psychopathburn victimmurder spreetime loopbutcheryplant in titlehead ripped offreturning character with different actorwater fountainfedoralifting female in airbandanaglovetroubled teendeja vufalling through the floorman dressed as womanpayphonereanimationcrushed by a cardaydreamingrepeated eventfalling asleepchild killersleeping pillsbitten on the armchild murdererhand through chestdisturbingtorturerafrican american mandemonicoverprotective fatherstreet in titleboiler roomsadisticsequel to cult filmreference to aristotledrive in classicserial child killerwaterbedlucid dreamdead body in waterthrown through a wallburn scarpin upsandcastlefreddy kruegerreflection in watertumbleweeddart boardserial teen killerbitten by a doghand through headnunchuckreflection in car mirrordog urinationtheatre marqueeasleep at the wheelloss of best friendhole through torsoserial child murderelm streetspringwood ohiofilm starts with a quotepin up girlserial child murdererfemale stuck in sticky substanceproducer cameofalling asleep in classscar tissuevolkswagen cargrumpy father (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Grindhouse (2007) is one of the best movies like Bloody Summer Camp (2021)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Grindhouse (2007)

A double-bill of thrillers that recall both filmmakers' favorite exploitation films. "Grindhouse" (a downtown movie theater in disrepair since its glory days as a movie palace known for "grinding out" non-stop double-bill programs of B-movies) is presented as one full-length feature comprised of two β€¦ individual films helmed separately by each director. "Death Proof," is a rip-roaring slasher flick where the killer pursues his victims with a car rather than a knife, while "Planet Terror" shows us a view of the world in the midst of a zombie outbreak. The films are joined together by clever faux trailers that recall the '50s exploitation drive-in classics. (Read More)

Subgenre:
cult filmblack comedyb movieslasher flickholiday horror
Themes:
murderdeathfriendshiprevengeghostjealousylesbianismescapeextramarital affairpsychopathsupernatural powersadismexploitationcannibalismmurder of a police officer
Mood:
slashergorecar chaseblood and gore
Locations:
hospitalbarbeachrestauranthelicoptermotorcycleelevatorstrip clubmexicokiller car
Characters:
killermother son relationshipfather daughter relationshipdoctortattoobrother brother relationshipteenage girlteenage boyzombiesoldierserial killernursepriestactresssingle mother β€¦sherifftruck driver (See All)
Period:
year 2007
Story:
castrationbloodf ratedviolenceone word titlefemale frontal nuditysex sceneinterracial sextitle spoken by characterfireshootoutshot to deathunderwear β€¦testiclesmachine guncar accidentshot in the headfalling from heightmarijuanadecapitationgood versus evilstabbingbridgestabbed to deathdinerstabbed in the chestexploding carapologysevered headman with glassesassassinationhit by a cardouble crossshot in the legmarriage proposalshot in the foreheadracial slurbeaten to deathstabbed in the backperson on fireringattempted rapescarcheerleaderfilm within a filmexploding bodybasementpremarital sexsevered armshot in the armdismembermentmaniacwerewolfsyringekilling an animalmachetewoman with glassesbabysittercookmad scientistmorguedrug abuseexploding buildingassaultgrindhouseparadeend of the worldinterracial friendshipeaten alivetensionsevered fingerloss of sonstabbed in the neckshot in the faceexploding headassault rifleinfectiondisfigurementsiegestabbed in the eyebarbecuesevered leggatling gungrenade launcherthanksgivingtext messagingserial murdercar troublestabbed in the handhomagehead blown offexotic dancerhuman monsterjukeboxhomicidal maniacold flamecameo appearancetennesseehit by a truckmilitary basesaxophoneretrotrampolinedirector also cinematographerflesh eating zombiedisc jockeywalking deadstuntmandeformitybroken neckchild with gunaustin texasunwed pregnancyfake commercialmakeup artistbroken handfake trailerdirected by several directorsmultiple cameosanthropophaguswooden legthermometercinephiliachemical weaponsripped in halfaccidental suicidenazi experimentintentional goofmelting manreal twins playing twinsfilm breakon hood of moving car (See All)

Rubber (2010)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Rubber (2010)

As film spectators watch, a killer car tire comes to life in a desert dump site. Flexing its... rubber... and ready to roll, it soon discovers its telekinetic ability to make small animals and people's heads explode. Lt. Chad hopes to end this movie by fatally poisoning every last spectators, but fa β€¦iling that, the show must go on, and the tire goes on a three-day rampage. With few left alive, a lure is constructed to draw the tire from its motel room, where hopes are to end it and this movie once and for all. (Read More)

Subgenre:
black comedyb movieabsurdismcreature featurehorror spoofabsurd comedyhorror b movie
Themes:
murderdeathmonster
Mood:
gorespoofbreaking the fourth wall
Locations:
wheelchairswimming poolcardesertbicyclemotelgas stationtowndesert town
Characters:
killerboy
Period:
1990s
Story:
tirenudityone word titlefemale rear nuditytitle spoken by charactershowermirrorwatching tvbomblow budget filmf wordcaliforniavideo cameralooking at the cameratalking to the camera β€¦binocularspoisonrabbitconvertiblestalkingkillingpizzamass murderexploding buildingblack humorhitchhikerdead womanwatching televisionrampagehungerexploding headdead childfilm setfemale in showercrowdcrowshowhit and runpickpocketscene before opening creditsbottlescorpionhollywood signcleaning ladymysterious womanbloody violencepsychotronic filmgrindhouse filmlive showblond boytarantulaturkey the birdspectatortricyclesouthern californiamidnight movieabsurd violencefake bloodmass deathpublic telephonegiving the fingermojave desertdumptin caninanimate object comes to lifestomachachedead bodiespoisoned foodgreek chorushula dancerinanimate object in cast creditsfeeding frenzyburning tire (See All)

28 Days Later... (2002)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

28 Days Later... (2002)

Animal activists invade a laboratory with the intention of releasing chimpanzees that are undergoing experimentation, infected by a virus -a virus that causes rage. The naive activists ignore the pleas of a scientist to keep the cages locked, with disastrous results. Twenty-eight days later, our pro β€¦tagonist, Jim, wakes up from a coma, alone, in an abandoned hospital. He begins to seek out anyone else to find London is deserted, apparently without a living soul. After finding a church, which had become inhabited by zombie like humans intent on his demise, he runs for his life. Selena and Mark rescue him from the horde and bring him up to date on the mass carnage and horror as all of London tore itself apart. This is a tale of survival and ultimately, heroics, with nice subtext about mankind's savage nature. (Read More)

Subgenre:
cult filmpost apocalypseallegoryzombie apocalypsezombie survivalbritish horrorzombie outbreak
Themes:
murderdeathsuicidebetrayalfearescapemilitarylonelinessdeath of fatherbrutalityparanoiainsanityapocalypsecouragestarvation β€¦ghost town (See All)
Mood:
goremurder of a boy
Locations:
hospitalchurchforestlondon englandtaxilakerooftopgas stationtaxi driverstormlaboratorytunnelcar explosionchurch of england
Characters:
father daughter relationshipteenage girlteenage boyzombiesoldierhostageinterracial relationshipsingle fathermilitary officerdeath of a boy
Story:
tire ironruinpervertbloodfemale nuditynuditynumber in titlemale nudityviolencemale frontal nuditymale rear nuditybare chested malegunexplosion β€¦showerfiredreamcorpseshot to deathblood splatterfoodmachine gunhorsecar accidentmirrorshot in the headundressingbare buttvomitingcar crashlow budget filmmale pubic hairalcoholscientistshot in the backsurvivalmansionarmyimpalementno opening creditsbeaten to deathwidowerperson on firefantasy sequenceproduct placementevil manbaseball batattempted rapeexploding bodyisolationloss of fatherratfirst partsevered armgraffitidismembermentriotsupermarketdressmacheteshot in the stomachsurvivorcomadiseaseragevirussergeantend of the worldrapistanimal attackpicnicapartment buildingdrug overdoseinterracial romancegrocery storebutcherdespairthunderstorminfectionmurder of a childeye gouginggasolinesexual assaultchainflat tireblood on camera lenscar troublegroupepidemicoverdosemajorplaguefortresscredit cardinterracial kissroadblockbritish armybullet woundwindmillchimpanzeesewingdeath of parentsretributionkiss on the cheekbutcheryloss of parentsoutbreakzombie attackradio broadcaststairwelllandminebloody body of a childdoomsdaymanchester englandbig ben londonzombie childsafe housedead parentsdeath of a childanimal liberationblood vomitingchild driving a carzombificationlondon undergroundvaliumhell on earthaccident victimlondon eyechild knocked unconsciousanimal researchdeadly diseasebicycle messengertankersoft drinkcontamination suitcoming out of a comaregaining consciousnesssneak attackbicycle courierchocolatesgas siphoningplunderingimplied happy ending (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Texas Chainsaw Massacre (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Texas Chainsaw Massacre (2003)

Driving through the backwoods of Texas, five youths pick up a traumatized hitchhiker, who shoots herself in their van. Shaken by the suicide, the group seeks help from the locals, but their situation becomes even more surreal when they knock on the door of a remote homestead. It's quickly apparent t β€¦he residents are a family of inbred psychopaths, and the unlucky youths suddenly find themselves running for their lives. In hot pursuit is a disfigured, chainsaw-wielding cannibal known as Leatherface. (Read More)

Subgenre:
independent filmsadistic horror
Themes:
murderdeathsuicidekidnappingtorturepsychopathbrutalityinsanitysadismpolice brutality
Mood:
slashergorehorror movie remake
Locations:
wheelchairbarbathtubpolice carroad tripgas station
Characters:
policemother son relationshipboyfriend girlfriend relationshippolice officerserial killercrying babyevil sheriff
Period:
1970s
Story:
axerunningbloodviolenceknifesurprise endingvoice over narrationblood splatterremakeshot in the headinterrogationpianotelephoneimpalementsevered head β€¦no opening creditshit by a carpolice officer killedlocker roomevil manpigbasementchickendirectorial debutsevered armobscene finger gesturecowdismembermentmoonmaniacchainsawfalling down stairspot smokingnipples visible through clothingheavy rainlifting someone into the airgroup of friendscowboy hatmutilationhomicidefull moonsevered fingerthrown through a windowdisfigurementbody countalienationtank topmasked killernewspaper clippingbarbed wirecar troublecrucifixionhuman monstersexual perversionterritory name in titletrailer homehillbillymercy killingwhite trashmeat cleaversewing machineshot through the mouthwet t shirtmasked villainslaughterhousesole survivorsaltsevered footstupid victimtruckersevered eargas station attendantclothes linesmall town sheriffbodily dismembermentobese womanpinatasevered faceforensic evidenceanthropophagusone armed manremake of cult filmbody in trunkvolkswagen buslock pickmeat hookchainsaw murderteeth knocked outhole in the wallhung from a hookrotten teethleatherfacebased on ed geinsevered nosechewing tobaccogroup of fiveharbinger of deathabandoned millmeat processing factoryobject made of body partobject made of human skintool in title (See All)

John Dies At The End (2012) is one of the best movies like Bloody Summer Camp (2021)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

John Dies At The End (2012)

It's a drug that promises an out-of-body experience with each hit. On the street they call it Soy Sauce, and users drift across time and dimensions. But some who come back are no longer human. Suddenly a silent otherworldly invasion is underway, and mankind needs a hero. What it gets instead is John β€¦ and David, a pair of college dropouts who can barely hold down jobs. Can these two stop the oncoming horror in time to save humanity? No. No, they can't. (Read More)

Subgenre:
cult film
Themes:
ghostmonster
Mood:
gore
Locations:
restaurantchinese restaurant
Characters:
police
Story:
invasionaxebloodfemale nuditycharacter name in titledogcell phonef wordjournalistsnakepsychicclaim in titledrug β€¦friendship between menspidermale underwearalternate realityslackerwilhelm screambullet timebeheadingmeatmale friendshipportalbugmale in underwearpsychic powerable to see the deadalternate universeout of body experienceprosthetic handhelping a friendmultiple dimensions (See All)

A Nightmare On Elm Street (1984)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street (1984)

On Elm Street, Nancy Thompson and a group of her friends (comprising Tina Gray, Rod Lane and Glen Lantz) are being tormented by a clawed killer in their dreams named Fred Krueger. Nancy must think quickly, as Fred tries to pick them off one by one. When he has you in your sleep, who is there to save β€¦ you? (Read More)

Subgenre:
independent filmcult filmslasher flickteen movieteen horroramerican horrorindependent horror
Themes:
evilmurderrevengesurrealismfuneralpsychopathsupernatural power
Mood:
slashergorehigh schoolnightmareavant garde
Locations:
cemeterybathtubpolice station
Characters:
killerhusband wife relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipteenage girlserial killeralcoholicvillainterrorpolice chaseself mutilationslasher killermysterious villain β€¦serial murdererpolice lieutenant (See All)
Period:
1980s
Story:
bloodviolencebare chested malecigarette smokingsurprise endingdreamcorpseblood splattermirrorface slapslow motion scenearrestfalling from heightbeddemon β€¦jailclassroomtelephonesubjective cameragood versus evilfoot chasestrangulationdeath of friendstabbed in the chesthousecoffeeperson on firefirst of seriescharacter's point of view camera shotevil manhangingstalkingdeath of sonpremarital sexcharacter says i love youfirst partreference to william shakespearecult directorstrong female charactermaniacfalling down stairsburned aliveelectronic music scoregothiclifting someone into the airhatcrucifixpsychogrindhousevictimstrong female leadseriesswitchbladesevered fingerbutcherheadphonesbooby trapdisfigurementbody countcharacters killed one by onecellaralarm clockserial murderpsychopathic killerbad guymadmanvigilantismhomicidal maniacloud sexclimbing through a windowburnt face15 year olddripping bloodfinger cut offbody bagdeath of boyfriendgraphic violencemaggotopen endedclawreference to shakespeare's hamletpillowsadistic psychopathsledgehammerbreaking through a doorfamous linevillain not really dead clichebutcherygrindhouse filmplant in titlecreepglovetrail of bloodhit with a chairface ripped offpsycho terrorchild killerchild murdererdead teenagerdisturbinghanged boydemonicsevered facestreet in titleboiler roomremadeevil deaddrive in classicserial child killerbroken backfurnacehorror movie remadelucid dreamsatanicsleep deprivationburn scarshared dreamfreddy kruegernightmare becomes realitysleep overserial teen killerserial child murderbarred windowelm streetspringwood ohioreference to shakespeare's julius caesarserial child murdererunplugged electronic worksfemale stuck in sticky substancefalling asleep in classscar tissuecult male character (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Showing Top 50 Matches Above.
Do you need specific genre & keyword selection to find films similar to Bloody Summer Camp?
<< FIND THEM HERE! >>