Please wait - finding best movies...
The day before Halloween, five carnival employees are kidnapped & held hostage in an isolated compound known as "Murderworld". On Halloween, they are thrown into a sadistic game called "31" where they must survive 12 hours against a gang of maniacs dressed like clowns. It's time to play 31.
| Subgenre: | survival horror |
| Themes: | madnesscannibalismcrueltyevilsadismbrutalitypsychopathangertorturekidnappingdeathmurder |
| Mood: | slashernightmaregore |
| Locations: | gas station |
| Characters: | death of killerterrorvillainhitmantough guypriestserial killertattoo |
| Period: | year 19761970s |
| Story: | predator becomes preypredator turns victimcrime victimgame of deathchainsaw murdermost dangerous gamethreat to killhomicidal maniacpuppet showkiller clowncigar smokingevil manfinal showdowndeath spasmenglish aristocracy …gladiatorial sportdie in a horrible waybell bottomsslow clapfinal girlwoman as objecthedonistrvdisembodied voiceobjectificationcaptive womanlittle personwoman in perilscreaming manlasciviousnesspreyscreaming in painsatanicviolent deathmarionettecassette tapecigardying wordscaptivityhedonismgladiatorbettingheld captivescarecrowcarnageurinalhired killerpredatorblack manpsychopathic killerswastikabad guymadmanpsycho killerfight to the deathnude woman murdereddressing roombody countchaindead manslaughterescape attemptlaughterpsychotronicmercilessnessface paintwoman in jeopardynicknametrappedswitchbladeredneckcarnivalvictimragewoundblood spattergamechainsawmaniacmurdererthreatwigbaseball battough girllocker roomstabbed in the backpuppetclownold womanscantily clad femalestabbed to deathdeath of friendthroat slittingeatingmassacreaxestrangulationold mansurvivalhalloweendecapitationbathroomdead bodyshowdownwritten by directorslow motion sceneblood splattercorpseknifetitle spoken by characterfemale frontal nuditybare chested malesex scenebloodfightviolence (See All) |
In Ruggsville, Texas, the police under the command of Sheriff John Quincy Wydell attack the house of the sadistic serial killers Firefly family (a.k.a. The Devil's Reject) and they arrest mother Firefly, but Otis B. Driftwood and Baby Firefly escape from the siege. Tiny is wandering nearby the house … and also escapes. Otis and Baby call their patriarch, the mad clown Captain Spaulding and they schedule to reunite at an isolated motel in the desert. When Otis and Baby arrive, they kidnap two families of singers, using sadism and violence against the harmless persons. Meanwhile, Sheriff Wydell promises to capture and kill the runaways, seeking revenge for the death of his brother, the Deputy George Wydell. (Read More)
| Subgenre: | independent filmcult filmblack comedypsycho thrillersadistic horror |
| Themes: | madnesscannibalismcrueltyevilsadismbrutalitypsychopathangertorturekidnappingdeathmurderfriendshiprevengesuicide …rapebetrayalfearescapedeceptionseductiondeath of fatherdeath of motherparanoiainsanityhumiliationexploitationvengeanceself sacrificepolice brutalitymurder of a police officernear death experiencemurder of family (See All) |
| Mood: | nightmaregoreambiguous ending |
| Locations: | gas stationbarbathtubpolice stationfarmroad tripmoteltexasbrothel |
| Characters: | terrorvillaintough guyserial killertattoofamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipbrother brother relationshipbrother sister relationship …prostitutepolice officernursehostagemaidsheriffpolice shootoutpimpaunt niece relationshipsuicide by copmurder of a prostitute (See All) |
| Period: | 1970syear 1978 |
| Story: | homicidal maniackiller clowncigar smokingevil mansatanicpsychopathic killerbad guymadmanbody countslaughterescape attemptmercilessnessredneckragemaniac …murdererstabbed in the backclownstabbed to deathdeath of friendthroat slittingaxestrangulationsurvivaldead bodyshowdownwritten by directorslow motion sceneblood splattercorpseknifetitle spoken by characterbare chested malesex sceneviolencebloodsequelflashbackmale rear nuditydogfemale rear nudityfemale full frontal nuditycigarette smokingphotographexplosionchasepantiespistolshowerfireshootoutwoman on topbeatingdreamshot to deathmachine gunhorseshot in the chestface slapshot in the headshotgunrescuepunched in the facearrestgunfightsex in bedbare buttvomitingrifleheld at gunpointbeersecond partlow budget filminterrogationmarijuanajailhandcuffsrevolvercriminalshot in the backf wordfoot chasegay slurbound and gaggedambushdrug dealerimpalementcocainestabbed in the chestfemale pubic hairtied to a chairwhite pantiescultdream sequenceanti herochild in perildouble crosspolice officer killednews reportshot in the legshot in the foreheadracial sluron the runbeaten to deathscreamingelectrocutionpay phonefugitiveknocked outopening action sceneattempted rapefarmershot in the shouldermanipulationdeath of brothersplit screendeath of sonpigbasementneck breakingthreatened with a knifechickenprofanityshot in the armobscene finger gesturewhippingcult directorcowfreeze framestylized violencehead buttmass murderlooking at oneself in a mirrorscene during opening creditscowboy hatstabbed in the stomachkicked in the stomachphone boothcovered in bloodgrindhouserapistfemale killerinterracial friendshipmasked mangas maskwatching televisionrampagecrime scenestealing a carstabbed in the throathatredhit in the crotchcannibalstabbed in the neckbutcherreference to satancigarette lighterstabbed in the legdeath of protagonistpunched in the chestjumping through a windowthrown through a windowwisecrack humorblood on shirtone daybounty hunterhighwaybulletproof vesttough copdisfigurementknife throwinggasolinebarbecueaxe murderranchsexual assaultsevered legkilling spreedeath of loved onefemale in showernewspaper clippingmedia coveragesouthern accentclose up of eyesnews reportershot through a windowgothmarijuana jointpervertserial murderreference to elvis presleyprayingface maskreturning character killed offstabbed in the handnecrophiliaforced to stripshot in the neckspit in the facehomagepistol whipmisogynisthuman monstersexual violencestandoffvulgarityfemale psychopathtrailer homefilm starts with texthit by a truckdeputyman kills a womantrailer parkman punching a womanfemale villainsole black character dies clichemacabreshot in the throatcarjackinggraphic violenceexploding housedeath of familyreference to star warsknife murderbutt slappsychological torturecross countryfilm criticfemale victimcocaine snortinghouse on firemurder spreemass murdererbutcherygrindhouse filmevil clownbilingualisminnocent person killedcrime spreereturning character with different actorknife in the chestserial rapistslow motion action sceneno survivorssouthdutch anglemodern westernsuit of armorcult figurerunning out of gaswriting in bloodred light districtmultiple homicidecmnffemale serial killersexual torturepossebody armorman punches a womantrailer trashpolice vigilantismblockadegas grenaderoadkillreference to jack the rippersevered faceclown makeupentrailsroadiereference to mark twainviolence against a womannail through handoral rapecattle prodmutilated bodynecrophiliacpig maskderanged womanreference to groucho marxderanged manblood bathforced nudityrape with a gun barrel (See All) |
When the Chase family moves to an isolated house in the middle of nowhere in Detroit, Arkin is hired to fix the windows and the doors. Later he meets his daughter and his wife that has a debt with dangerous sharks and needs money, but his week payment is not enough to pay her debts. Arkin plots to h …eist the safe of Michael Chase during the night to raise the necessary money. However, when he arrives in the house, he finds that a sadistic criminal has imprisoned the family and planted traps everywhere. Arkin seeks a way out of the deadly house to save his life. (Read More)
| Subgenre: | independent filmsuspenseamerican horrorindependent horrorsadistic horrorslasher horrorhorror b movie |
| Themes: | crueltyevilsadismbrutalitypsychopathtorturemurderdeathescapeinsanityhome invasionexploitationmurder of a police officer |
| Mood: | slashergorenightblood and gore |
| Locations: | strip clubtrying to escape |
| Characters: | terrorvillainserial killerhusband wife relationshipfather daughter relationshipteenagermother daughter relationshipteenage girlhostagethiefkillerself mutilationtalking to oneself in a mirrormysterious villainthe family …mysterious killerkiller dogdirector of photography (See All) |
| Story: | homicidal maniacevil mancaptive womanobjectificationlasciviousnesspreyviolent deathcaptivityheld captivecarnagepredatorpsychopathic killerbad guypsycho killerbody count …slaughterescape attemptpsychotronicmercilessnesswoman in jeopardytrappedvictimblood spattermaniacscantily clad femalestabbed to deathsurvivaldead bodyshowdownslow motion sceneblood splattercorpseknifefemale frontal nuditybloodviolencefightfemale nuditycharacter name in titlebare breastsflashbacktwo word titlecigarette smokingnippleslesbian kisssurprise endingpistolbeatingmirrorshotgunpunched in the faceheld at gunpointcar crashhandcuffsgood versus evilfoot chasegay slurflashlightstabbingimpalementstabbed in the chesthousetied to a chairchild in perilhit by a cardangerscreamingelectrocutiondebtscreamactor shares first name with characterisolationneck breakingtrapfirst partthreatened with a knifeex convictcrime bossfalling down stairskilling an animallooking at oneself in a mirrortape recordermutilationhammerhidingspiderdesperationpsychocovered in bloodteddy bearhomeanimal attackhomicidemasked maneaten aliverampageburglarsevered fingermobile phoneburglarygash in the facebutcherscissorsscene after end creditsdisembowelmentperversiontitle at the endknife throwinggasolinestabbed in the eyeboxcharacters killed one by onebloodbathpsychoticmasked killerdead dogfemale female kissinterrupted sexblood on camera lensintestinesserial murderbarbed wiremysterious manwifestabbed in the handset upconstruction workerpistol whiphuman monsterlightervery little dialogueacidclimbing through a windowslashingself defensehead bashed incigarettebowling alleyman kills a womanchandelierfinger cut offretroex conmacabrebloodshedmasked villaindead cattrickcut into piecesjewelsadistic psychopathpsychotronic filmcut handhouse on firemurder spreedragging a bodybutcherygrindhouse filmex wifeexploitation filmcrime spreedeeply disturbed personclothes rippingbear traphung upside downthroat rippingmystery killersliced in twobandaged handmultiple homicideblack glovesgutsexterminatordeadlineheld hostagewaspgiallo esquetea partydark and stormy nightburnt hand911 calllock pickcold blooded killerear bleedingteeth knocked outtrip wiremutilated bodydead body in a bathtubman murders a womanmouth sewn shutstabbed in the earbotoxtrapped in a houseblouse rippingpolice officer neck brokenblack gloved killerevil doginsane manslashed to deathdisturbed personcut to piecesfalling through a staircaseisolatedhome intruderfemale in perilfish hookhidden safelaundry chuteboarded up windowburned handknife through handhung by a hookpick lockduct tape over eyeskept in a boxruthless killer (See All) |
Alexia travels with her friend Marie to spend a couple of days with her family in their farm in the country. They arrive late and they are welcomed by Alexia's father. Late in the night, a sadistic and sick killer breaks into the farmhouse, slaughters Alexia's family--including their dog--and kidnap …s Alexia. Marie hides from the criminal and tries to help the hysterical and frightened Alexia, chase the maniac, and disclose his identity in the end. (Read More)
| Subgenre: | independent filmsuspenseb movieb horrorindependent horrorsadistic horrorpsychological horrorfrench horrorhorror b movie |
| Themes: | madnessevilsadismbrutalitypsychopathtorturekidnappingdeathmurderfriendshipsurrealismrapefeardeath of fatherdeath of mother …insanityunrequited lovehome invasionexploitationdeath of wifemurder of fathermurder of husbandmurder of mothermurder of brothermurder of son (See All) |
| Mood: | slashernightmaregorecar chasenightdarknessblood and gore |
| Locations: | gas stationhospitalforestbathtubwoodsrural settingroad tripfrancetrucksinging in a carbackwoodsback country |
| Characters: | terrorvillainserial killerfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipfriendboybrother sister relationshipteenage girlfemale protagonist …studentbest friendkillerfrenchslasher killerbest friendsmysterious villainserial murderermysterious killerdeath of boy (See All) |
| Story: | homicidal maniacevil manpreyurinalpsychopathic killerbad guymadmanpsycho killerbody countslaughterredneckblood spatterchainsawmaniacmurderer …scantily clad femalethroat slittingmassacreaxesurvivaldecapitationbathroomdead bodyslow motion sceneblood splattercorpseknifefemale frontal nudityviolencebloodfemale nudityf ratedbare breastsflashbackmasturbationdogguncigarette smokingphotographlesbian kisschasesurprise endingshowertelephone calldreamcar accidentmirrorurinationshot in the headshotgunshootingriflesunglassesbedcar crashlow budget filmneighborvoyeurtelephoneshot in the backsubjective cameraflashlightbound and gaggedstabbingimpalementstabbed in the chesthousesevered headvanon the rundolldeath of childdeath of brotherpursuitstalkingdeath of sondeath of husbandsleepingeuropekillingsplatterchild murderfireplacekilling an animalmass murderlistening to musicsurvivormutilationstabbed in the stomachpsychosevered handgrindhousestrangerrape victimfollowing someonerapistfemale killerrampagetensionsurveillance cameramobile phonegash in the facebroken glassmental hospitalplot twistbutcherperversionmurder of a childswingclassmateaxe murdersexual assaultcharacters killed one by onekilling spreeparrotdead dogbeing followedpervertblood on camera lensserial murdersuffocationtaking a showerbarbed wirevideo surveillanceearphonesclosetnecrophiliaminimal castkillkilling a doghuman monsterfarmhousefemale psychopathslashinglistening to a radiocornfieldpiercinggreenhouserazor bladeexamfemale villainevil womanextreme violencemurder of wifefilling stationgraphic violencemurderessstabbed in the facecar radiohiding under a beddeath of familyfeetcut into pieceslesbian subtextbloody violencebutcher knifefemale victimsadistic psychopathmurder spreevineyardchainsdriving at nightdisturbed individualbutcherygrindhouse filmbludgeoningwalkmanexploitation filmcrime spreestraight razorcreepbloody body of a childdeeply disturbed personserial rapistsexual predatorgas station attendantfemale serial killerplastic bagweirdocircular sawpadlockbreaking a car windowdoor bellmultiple personality disordergiallo esquepolice vanpsychiatric wardgory violencesickoaxe murdererbad girlambient musicunreliable narratorfemale murdererjumpsuitshower curtainnecrophiliacvision of the futureaxe in the cheststabhead in a toiletstabbed with glasskeychainsex with the deadfrench shock cinemapierced belly buttonsadistic killersouthern francefemale victimsfrench cinemalesbian lead charactergas pumpslashed to deathearplugsrear ending a carpsychotic killerserial rapesolarisationfrench manserial killing (See All) |
Thought to be killed by the sole survivor of the last massacre at Camp Crystal Lake, Jason Voorhees kills his way back to the camp to once again murder its inhabitants. This time, has Jason met his match in the little boy Tommy Jarvis?
| Subgenre: | cult filmpsycho thrillerbody horroramerican horrorindependent horrorsadistic horror |
| Themes: | evilsadismbrutalitypsychopathtorturedeathmurdersupernatural powerinsanity |
| Mood: | slashergorebreaking the fourth wallblood and gore |
| Locations: | hospitalsex in showersex in a bathroom |
| Characters: | terrorvillainserial killerbrother sister relationshipteenage girlteenage boykillerslasher killermysterious villainserial murderermysterious killer |
| Period: | 1980s |
| Story: | homicidal maniacevil manpsychopathic killerbad guymadmanpsycho killerbody countslaughterredneckragemaniacmurdererstabbed in the backstabbed to deathmassacre …strangulationdecapitationblood splattercorpsefemale frontal nuditybloodviolencesexfemale nuditynumber in titlemale nuditybare breastssequelmasturbationmale rear nudityfemale rear nuditysurprise endingpantiesunderwearmasklow budget filmsubjective cameraimpalementsevered headchild in perillooking at the cameraskinny dippingcharacter's point of view camera shotstalkingpremarital sexcabinloss of motherobscene finger gesturekillingsexual attractionlifting someone into the airmutilationmorguefourth partpsychogrindhousetowelback from the deadmasked manrampagenew jerseyhit in the crotchstabbed in the neckbutcherstabbed in the headdisembowelmentdisfigurementbody landing on a carcharacters killed one by onekilling spreemasked killerserial murdercar troublemysterious manstabbed in the handkillhuman monstersummer campslashingshot in the eyehillbillymeat cleavernaked dead womanextreme violencegraphic violencestabbed in the facemasked villainknife murderbloody violencedeformitylunaticsadistic psychopathmurder of a nude womanmurder spreevillain not really dead clichedisturbed individualbutcherygrindhouse filmcrime spreedeeply disturbed personpsycho terrordisturbinghockey masklifting a female into the airruraltorturergiallo esquesequel to cult filmstabbedboogeymandrive in classicskull crushinggory violenceeast coastgruesomejason voorheeshead shavingcorkscrewmutilated bodyfriday the thirteenthaxe in the chestmachete mutilationknife through the neckserial teen killertrailer narrated by don lafontainesadistic killerdeformedtwin actresses for twin sisterswessex county new jerseycrystal lake new jerseynose pushed into brainserial teen murdererslaughteredmurder in a shower (See All) |
The residents of Haddonfield don't know it yet... but death is coming to their small sleepy town. Sixteen years ago, a ten year old boy called Michael Myers brutally kills his step father, his elder sister and her boyfriend. Sixteen years later, he escapes from the mental institution and makes his w …ay back to his hometown intent on a murderous rampage pursued by Dr Sam Loomis who is Michael's doctor and the only one who knows Michael's true evil. Elsewhere a shy teenager by the name of Laurie Strode is babysitting on the night Michael comes home... is it pure coincidence that she and her friends are being stalked by him? (Read More)
| Subgenre: | tragedypsycho thrillerslasher flickamerican horror |
| Themes: | evilsadismbrutalitypsychopathtorturekidnappingmurderdeathsuiciderapedysfunctional familyinsanityhome invasionpolice investigationmurder of a police officer …mysterious death (See All) |
| Mood: | slashergoredarknessblood and gore |
| Locations: | small townstrip club |
| Characters: | terrorvillainserial killerteenagerafrican americanboyfriend girlfriend relationshipboyhostagekillerpsychiatristsheriffslasher killerserial murderer |
| Period: | 1970s |
| Story: | evil mansatanicdying wordscarnagepsychopathic killerbad guymadmanpsycho killerbody countvictimrageblood spattermaniacmurdererbaseball bat …stabbed in the backstabbed to deaththroat slittingmassacrestrangulationhalloweendead bodyblood splattercorpseknifetitle spoken by characterfemale frontal nuditybloodviolencesexfemale nuditymale nudityfemale rear nudityfemale full frontal nudityphotographchasepistolwoman on topbeatingremakeshot in the headfalling from heightmasktelevisionstrippershot in the backf wordsubjective camerastabbingimpalementstabbed in the chestjokechild in perilcontroversygraveyarddrowningauthorbeaten to deathattackuniformcharacter's point of view camera shothangingshot in the shoulderstalkingpremarital sexloss of motherprofanitykillingteenage sexsplatterkilling an animalelectronic music scoremass murderlifting someone into the airloss of friendpsychopsychologisthome moviebroken legmasked manrampagecrime scenetensionmanhuntshot in the facemental hospitalbutcherheadphonesperversionmurder of a childdark pastbroken armduct tapecharacters killed one by onekilling spreepumpkinbloodbathpsychoticswearingmasked killerhit with a baseball batpervertmexican americanserial murderporn magazinedead animalhuman monstertrick or treatingabandoned housesexual violencetombstoneslashingschool principalautumnstrong languagewhite trashdripping bloodbloody body of childpalm treenaked dead womanloss of sisterkiller childpsychiatric hospitalextreme violencedisfigured facegraphic violencemultiple murdermasked villainmatricideknife murderbloody violencebutcher knifeloss of familyfemale victimsadistic psychopathmurder spreedying during sexanimal killingmass murderervillain not really dead clichebutcheryjack o'lanterncrime spreecreepescaped mental patientdeeply disturbed personchild killedthroat rippinghigh school friendmental asylumforkmultiple homicidepsycho terrormidwestweirdocreepymichael myersdisturbingdeath of petlifting a female into the airloss of boyfriendtorturerchild murders a childhanged boysadisticboogeymanreference to charles mansongun storepsychiatric wardskull crushinggory violencesickocontroversialcarrying a dead bodymurder of a policewomanjumpsuitclosing credits sequencesororicidebritish manmutilated bodychoked to deathempty swimming poolpsycho filmmultiple versionsviolentbathroom stallbrutalteen sexdisturbed childinsanekilled with a forkmonster as victimsadistic killeranimal mutilationslashed to deathwhite maskabusive childhoodthroat slitinstitutionalizationaluminum baseball batslaughteredinstitutionalizedchild as murdererfake skeleton (See All) |
The film follows Jennifer, a writer who is working on a new novel and needs to get out of the city to finish it. She rents a riverside cabin in upstate New York to work on her novel, attracting the attention of a number of rowdy male locals. They catch Jennifer one day and strip her naked for the vi …llage idiot (Matthew) and rape her. Jennifer is later attacked and raped a further two times by the four degenerates, and her novel is also destroyed. But Jennifer recovers, and in her now-twisted, psychotic state, she begins to seek revenge on the men. (Read More)
| Subgenre: | independent filmcult filmb movievideoamerican horrorsadistic horrorhorror b movie |
| Themes: | crueltyevilsadismbrutalitypsychopathangertorturekidnappingdeathmurderrevengerapefearvoyeurismseduction …humiliationexploitationvengeancerape and revengerevenge murder (See All) |
| Mood: | slashergore |
| Locations: | gas stationnew york citychurchforestcarsmall townbathtubbicyclewaterlakecountry |
| Characters: | villainserial killerfemale protagonistgirlwriterkillerlustserial murdererself justicesex with a stranger |
| Period: | 1970s |
| Story: | predator becomes preypredator turns victimevil manlasciviousnessviolent deathheld captivecarnagepsychopathic killerpsycho killerbody countmercilessnesswoman in jeopardyredneckvictimrage …murdererthreatscantily clad femaleaxeknifefemale frontal nuditybare chested maleviolencebloodfemale nuditymale nuditybare breastsmale frontal nuditygunfemale rear nudityfemale full frontal nuditycigarette smokingnipplesmale full frontal nudityleg spreadingpantiesfondlingcryingbeatingmirrorbikinilow budget filmvoyeurmale pubic hairriveralcoholtelephonecleavagenewspapergangnew yorkfemale pubic hairwhite pantiesdrivingman with glassescontroversydrowningjeanspublic nudityone against manysmokinggraveauthorscreamingunderground filmhangingfemale removes her clothesglassescabinhandgunvigilantekillingrecord playereyeglassesclaim in titlenipples visible through clothinginjurysexual abusemutilationdesperationgrindhouserape victimrapistfemale killerlow budgetdeath threatdark herosexploitationpanties pulled downgang rapeperversioncastrationaxe murderbruisecharacters killed one by onekilling spreemisogynywoman in bathtubpervertserial murderkillviolence against womenvigilantismmisogynisthuman monstercanoefemale removes her dressmental retardationsexual perversionsexual violencefemale psychopathloserharmonicadegradationanal rapebubble bathwhite trashwrathmotorboatfemale villainatrocitywoman wearing only a man's shirtbleeding to deathhammockextreme violencegraphic violencemurderesssmall breastsfemale prisonerfemale victimshared bathsadistic psychopathone woman armymurder spreedelivery boygrindhouse filmnoisesexual humiliationsuspendersfemale writersex on the floorgenital mutilationdeath by hangingmultiple homicidemistreatmentconnecticutdebaucheryfemale serial killersexual sadismcreepysexual crueltybanned filmdisturbinghanged boysadisticdrive in classiceye candyinfamygory violenceeast coastmisandryvideo nastyfemale murderergruesomereference to coca colawoman murders a manoral rapefemale vigilantereading in bedrevenge killingextreme filmman forced to stripturning the tableswriter as protagonistmaking lovewoman hatercut off penisderanged manrapist comeuppancetorture threatjean jacketsexy legsunpunished crimeforced fellatiopucciniloss of peniswoman's revengewoman on all foursbag of groceriesbottle rapemale genital mutilationrepetitive rape victimdisgusting (See All) |
Months after Alice beheaded psycho killer/mother Pamela Voorhees at Camp Crystal Lake, survivor Alice is still traumatized because of the murders. But there is one problem. Mrs. Voorhee's son Jason never drowned and died.So he saw Alice behead Mrs. Voorhees. Jason finds Alice soon and murders her. F …ive years later a camp counselor in training program begins at Campanack Lodge. Right near Jason's home.Camp Crystal Lake. As teenagers in the program start snooping around Camp Crystal Lake, they start getting killed violently one by one. (Read More)
| Subgenre: | cult filmsuspenseb horrorpsycho thrilleramerican horrorindependent horror |
| Themes: | evilbrutalitypsychopathdeathmurderfearinsanityexploitation |
| Mood: | slashergoredarkness |
| Locations: | woodswheelchairpolice carlakecampfirebackwoodsrunning through the woodschase in the woods |
| Characters: | terrorvillainserial killerteenagerboyfriend girlfriend relationshipkillerslasher killermysterious villainserial murderermysterious killer |
| Period: | 1980ssummeryear 1984 |
| Story: | homicidal maniacevil manpsychopathic killerbad guymadmanpsycho killerbody countslaughterpsychotronicredneckvictimragechainsawmaniacmurderer …throat slittingmassacrestrangulationdecapitationdead bodyslow motion sceneblood splattercorpsefemale frontal nudityfightbloodviolencesexfemale nuditynumber in titlesequelflashbackkissnipplessurprise endingpantiestelephone calldigit in titleblondecatbikinimasksecond partnumbered sequelsubjective cameraswimmingbraimpalementjokesevered headcontroversyskinny dippingstalkerprologuecharacter's point of view camera shotopening action sceneconvertiblestalkingobscene finger gesturelove interestkissing while having sexkillingsplatterchessfireplacespearnipples visible through clothingmass murdergothicmachetelifting someone into the airmutilationvillainessphone boothgrindhousemasked manrampagebra and pantiesnew jerseyhit in the crotchbutcherstabbed in the headbetrefrigeratorlens flarecharacters killed one by onekilling spreepsychoticmasked killernude swimmingserial murdercar troublemysterious manreturning character killed offhuman monstersummer campfreakskirtsexual violenceslashingwetting pantshillbillyday in titletow truckparaplegicorchestral music scoremultiple murdermasked villainknife murderpitchforkbloody violencesole survivorlunaticsadistic psychopathpsychotronic filmmurder of a nude womanmurder spreedying during sexvillain not really dead clichebutcherygrindhouse filmcrime spreecreepkilled during sexmystery killershackmultiple homicidepsycho terrorweirdodisturbinglifting a female into the airtrailtorturerhanged boygiallo esquesadisticsequel to cult filmboogeymandrive in classiceast coasthorror movie remadesickolost dogice pickcampfire storygruesomejason voorheesdouble impalementbad jokefriday the thirteenthatonal music scoreurinating in fearmachete mutilationtea kettleviolentbrutaltrailer narrated by don lafontainegarrottingtoasting marshmallowssymphonic music scorewessex county new jerseycrystal lake new jerseychild psychologyfade to whitesack maskscare involving catserial teen murdererkilled by machetemenstrual cycledefy authorityfalse scarehand on shoulder scarelatex mask (See All) |
40 years ago, five youths on a weekend getaway in the Texas countryside fell prey to a butcher in a mask made of human skin and his cannibalistic family, and horror cinema would never be the same. Violent, confrontational, and shockingly realistic, director Tobe Hooper's THE TEXAS CHAIN SAW MASSACRE … terrified audiences in a way never thought possible when it was unleashed on a politically and socially tumultuous America in 1974. Facing a storm of controversy, censorship, and outcry throughout its troubled release, this masterpiece of horror has stood the test of time to become a landmark motion picture and cultural milestone. To celebrate the film's 40th anniversary and its enduring ability to scare audiences both new and old, Dark Sky Films proudly presents THE TEXAS CHAIN SAW MASSACRE in an all-new 4k digital transfer and with a newly created 7.1 surround sound mix supervised by Tobe Hooper. Get ready to experience fear in a whole new way. (Read More)
| Subgenre: | survival horrorindependent filmcult filmblack comedysuspensetragedypsycho thrillerslasher flickteen horroramerican horrorindependent horror |
| Themes: | madnesscannibalismevilsadismbrutalitypsychopathtorturekidnappingmurderdeathfriendshipfearescapeparanoiadysfunctional family …insanityexploitationpanicinheritancenear death experience (See All) |
| Mood: | slasheravant gardedarknessambiguous ending |
| Locations: | gas stationcarcemeterykitchenwheelchairfarmroad triptrucktexascountryback country |
| Characters: | terrorvillainserial killerfamily relationshipsteenagerboyfriend girlfriend relationshipbrother brother relationshipbrother sister relationshipteenage girlteenage boyhostagekillerself mutilationtruck driverslasher killer …serial murdererself inflicted injury (See All) |
| Period: | 1970syear 1973 |
| Story: | chainsaw murderhomicidal maniacevil manbell bottomspreyheld captivepsychopathic killerbad guymadmanbody countchainescape attemptpsychotronicmercilessnesswoman in jeopardy …redneckvictimchainsawmaniacmurdererdeath of friendmassacresurvivaldecapitationwritten by directorblood splattercorpseknifeviolencebloodphotographchasesurprise endingvoice over narrationbeatingurinationblondecamerafalling from heightvomitingsunglassesrunninglow budget filmcollegefoot chaseflashlightbound and gaggedambushimpalementstabbed in the chesttied to a chairdinnerman with glassesradiodouble crosscontroversyvangraveyardnews reportfive word titlegravebeaten to deathdangerscreamingattackfirst of seriesproduct placementknocked outskeletonscardeath of brotherhairy chestcountrysidetragic eventstalkingglassespigtied upfirst partthreatened with a knifechickendirectorial debutgrandmothercult directorcross dressingcowkillingsplatterfreeze framepickup truckropegothiclifting someone into the airgroup of friendsmutilationbarnloss of friendcookvandalismbeardhammerspiderblockbusterpsychocovered in bloodgrindhouseproduced by directorskullhitchhikerhitchhikingmasked manfull moonrampagedamsel in distresstensionlow budgetgrandfatherhippiecannibaldark humormutebutchercigarette lighterhit on the headjumping through a windowone dayvegetarianswingbarbecuelens flarelaughingcharacters killed one by onekilling spreetank toploss of brotherbloodbathmasked killersouthern accentclose up of eyesserial murdercar troublehysteriayellingface maskminimal castvomithead woundold dark houseurban legendscene before opening creditshuman monstermeatestatetexanabandoned housefarmhouseanimal crueltyslashingcar washfilm starts with texthit by a truckhillbillyoffscreen killingeyeballsummer vacationdeath of boyfriendwheelchair boundwindmillmacabrefacial scarmasked villainslaughterhousepsychological tortureshrineradio newsbloody violencehit with a hammersole survivorpolaroid camerafemale victimpsychotronic filmsledgehammercut handmurder spreeclose up of eyeastrologyfurniturebonedisturbed individuallifting person in airbutcherygrindhouse filmsocial decaybludgeoningextreme close upwoman in dangerleg injuryscreaming womansinisterstraight razorcryptcreepman in a wheelchairbroomno endingtoothcaged animalwrenchstate name in titlejumping out a windowsouthbird cagegas station attendantdecomposing bodyrunning out of gaswriting in bloodcut armscreaming in feardinner tablefrozen bodypocket knifeskinweirdocreepybanned filmdead teenagerdisturbinggeneratorstate in titleboneslifting a female into the airruralhuman skulltorturergrave diggermidnight moviehenremadesadisticscreaming in horrordrive in classicfinger cutbirdcagetroubled productionanthropophagushand woundsouthern gothicreference to draculagrave robbinghoroscopemalletevil laughterhorror movie remadehypothermiascream queenyelling for helpsickoburning a photographeating human fleshcontroversialpolaroid photographinbreedinggruesomehell on earthman eatermeat hookrotting corpsesummertimeporch swingarmadillodreadatonal music scoredesecrationmeat grindermisdirectionpsycho filmfrozen alivedisorientationpower toolbrutalleatherfacebased on ed gein18 wheelervictim invited to dinnercontemporary settingfarmlandrolling down a hillheadlightspower generatorshot in sequencehuman bonemad familycut fingerpenknifewearing human skinbroomstickhead traumahouse of horrorsreference to zorroevil smilehaving picture takengroup of fivehit on the head with a hammerdesolateeighteen wheelersoda machinesucking bloodflashbulbfood trayforeshadowstrapped to a tablecutting the palm of one's handhit with a broomrolling downhillscreen doorblowing a raspberrycannibal familycut legevil familytool in title (See All) |
Three backpackers travel into the Australian Outback, only to find themselves stranded at Wolf Creek crater. Once there they are encountered by a bushman, Mick Taylor, who offers them a ride back to his place. Little do the three know that their adventure into the Outback, would be a complete nightm …are after the backpackers find a way to escape. (Read More)
| Subgenre: | independent filmcult filmsuspenseslasher flickaustralian horrorsadistic horror |
| Themes: | crueltyevilsadismbrutalitypsychopathtorturekidnappingdeathmurderrapedrinkingfeardrunkennessescapeinsanity …abductionexploitation (See All) |
| Mood: | slashernightmaregorecar chasenightdarknessblood and gore |
| Locations: | gas stationbarbeachrestaurantswimming poolcarhelicopterairplanedesertaustraliaroad triptruckcavecampfireroad movie …australian outbackcar on fireshed (See All) |
| Characters: | terrorvillainserial killerhusband wife relationshipdoctorsingerhostagekilleraustralianself mutilationslasher killermysterious villainserial murderermysterious killer |
| Period: | year 1999 |
| Story: | homicidal maniacevil mancaptivitypsychopathic killerbad guymadmanpsycho killerbody countslaughtermercilessnessredneckvictimwoundmaniacmurderer …stabbed in the backstabbed to deathmassacrebathroomdead bodyslow motion sceneblood splattercorpseknifetitle spoken by characterviolenceblooddogtwo word titlegunkisscigarette smokingphotographexplosionsingingpartychasebased on true storysongshot to deathcar accidentmirrorshot in the chesturinationshot in the headshotgundrinkvomitingrifleheld at gunpointsunglasseslow budget filmcafevoyeurguitarshot in the backf wordswimminggay slurflashlightbound and gaggedvideo camerastabbingimpalementfalse accusationcontroversyvanpainflash forwardattempted murderdangerprologueumbrellaon the roadstorytellingtentattempted rapepursuitcountrysidetragic eventautomobileisolationpigfirst partobscene finger gesturedismembermentufokillinggaragepickup truckwolftouristscene during opening creditsmutilationloss of friendcaptivedesperationflatulencepsychostrangerhome movierapisthomiciderampagesufferingsevered fingergunshot woundbroken glassbutcherfallblood on shirtperversionrainstormcapturecliffminetied feetopening a doorsexual assaultcharacters killed one by onekilling spreebloodbathdrugged drinkreflectionpervertserial murderbarking dogcar troublemysterious mancrucifixionparalysisjunkyardshot in the neckhead woundpostcardscene before opening creditsfirearmhuman monstersydney australiastrandedhikingoutbackvery little dialoguefemale friendshipsexual violenceslashingplaying guitarmind gamefilm starts with textnihilismepiloguesunrisefinger cut offsurfboardlying on bedauto mechanicstation wagoncar set on fireextreme violencemeteorcamcorderfilling stationgraphic violenceoverturning carbriton abroadcaravantied up while barefootknife murderwaking upbloody violencesole survivorfemale victimsadistic psychopathkangaroocar rollovermurder spreemass murdererdriving at nightvillain not really dead clichedisturbed individualbutcherygrindhouse filmexploitation filmsoutherncreepguard dogends with texttauntingdeeply disturbed personcaged animalcamperserial rapisteclipsedecomposing bodyscreaming in feardesolationpsycho terrorwatching someoneoxygen maskbeing watchedwoman driverextreme closeupsolar eclipsespiked drinkabandoned minemobile homeburning carbackpackingmutilated corpsebackpackergory violencetrackingburpsickocratervolkswagen busbritish womancampfire storyrotting corpsehunting knifesavagerybroken down carhelplessnessvandalizing a carsex maniacviolentbrutalshooting a horsegas canhikerpit bullremote locationsadistic killersleeping on a beachemuregaining consciousnessbloody knifebuying a carslashed to deathgun sightunidentified flying objectbushmanmale victimpsychotic killerroad mapserial rapemining campused car lottire blow outsevered spinespree killerbegging to be killedboogie boardclimbing down a cliffmad dogstripped cardesert roadfriendly strangermurder by a knifeserial killingtorturerertowing (See All) |
Five years after killing the goalie hockey-masked killer Jason Voorhees, Tommy Jarvis has grown up in various mental hospitals unable to get over the nightmares about Jason's return. When Tommy is sent to a rural halfway house in New Jersey for mentally disturbed teenagers, a series of grisly murder …s begin anew as another hockey-masked killer begins killing off all people at and around the residence. Has Jason returned from the dead to re-start his killing spree? Has Tommy decided to take over the reign of Jason, or has someone else? (Read More)
| Subgenre: | independent filmcult filmpsycho thrilleramerican horror |
| Themes: | evilsadismbrutalitypsychopathdeathmurderrevengefearinsanityexploitationpolice investigation |
| Mood: | slashernightmaregorerainnightdarkness |
| Locations: | cemeterysmall townwoodsamericabackwoods |
| Characters: | terrorvillainserial killerpolicemother son relationshipteenagerbrother brother relationshipkillersheriffslasher killermysterious villainserial murderermysterious killercountry boy |
| Period: | 1980s |
| Story: | homicidal maniacevil manpsychopathic killerbad guymadmanpsycho killerbody countslaughterpsychotronicredneckvictimchainsawmaniacmurdererthroat slitting …massacreaxedecapitationdead bodyblood splatterfemale frontal nudityviolencebloodsexfemale nuditynumber in titlebare breastssequelkissdancingchasesurprise endingpantiesdigit in titlelow budget filmnumbered sequelsubjective camerasword fightimpalementchild in perilgravestalkercharacter's point of view camera shotdeath of brotherstalkingdeath of sonobscene finger gesturekissing while having sexmachetelifting someone into the airmutilationbarnstabbed in the stomachpsychogrindhousemasked manmental institutionrampagenew jerseyitalian americanbutchereye gougingstabbed in the eyeaxe murdercharacters killed one by onefifth partsequel to cult favoritepsychoticmasked killerserial murdercar troublemysterious manlaundrydefecationhuman monstersummer campcomic relieftombstoneslashinghillbillyeyeballmeat cleavercrushed headextreme violencegraphic violenceorchestral music scorestabbed in the facemasked villainknife murdercut into piecesbloody violencefemale victimlunaticsadistic psychopathpsychotronic filmmurder of a nude womanmurder spreedisturbed individualbutcherygrindhouse filmdeath of grandfathercrime spreereturning character with different actorstabbed with scissorsfatchopping woodaxe in the headmultiple homicidepsycho terrorweirdosmall town sheriffbreakdancingdate in titlehockey masksequel to cult filmdark and stormy nightdrive in classiccandy barclotheslinegory violencesource musiceast coastgarden shearsjason voorheesimposterjumpsuitpopular musicfriday the thirteenthgrave robbermachete mutilationserial teen killercopycattrailer narrated by don lafontaineattempted child murdermale victimwessex county new jerseycrystal lake new jerseycopycat killervertigo shotserial teen murdererlifting a woman into the airspike in the head (See All) |
In part six of the Nightmare on Elm Street series, dream monster Freddy Krueger has finally killed all the children of his hometown, and seeks to escape its confines to hunt fresh prey. To this end, he recruits the aid of his (previously unmentioned) daughter. However, she discovers the demonic orig …in of her father's powers and meets Dad head-on in a final showdown (originally presented in 3-D). (Read More)
| Subgenre: | independent filmcult filmblack comedysupernaturaldark comedyparanormalpsycho thrilleramerican horrorindependent horror |
| Themes: | evilsadismpsychopathtorturedeathmurdersurrealismdrugsghostsupernatural powerdeath of motherinsanityamnesia |
| Mood: | slashernightmaregorerainhigh schooldarkness |
| Locations: | small townairplaneroad trip |
| Characters: | terrorvillainserial killerfamily relationshipsfather son relationshipfather daughter relationshipteenagerteacherkillerself mutilationyounger version of characterdeafnessslasher killerserial murderergerman american …evil father (See All) |
| Period: | 1970s1990s1960s1940s1950s |
| Story: | homicidal maniacevil manfinal showdownpreypsychopathic killerbad guymadmanpsycho killerbody countslaughtervictimragemaniacmurdererstrangulation …showdownslow motion sceneblood splatterknifetitle spoken by characterbare chested maleviolencebloodf ratedcharacter name in titlesequelflashbackfirepunctuation in titletitle directed by femaledreamrescuefalling from heightapostrophe in titledemoncriminalsubjective cameragood versus evilimpalementstabbed in the chestboxingmapchild abusedrawingchild in perilshot in the legcharacter repeating someone else's dialoguebeaten to deathstatueknocked outkicked in the facescene during end creditsexploding bodykillingundeadchild murderfalling down stairsburned alivekilling an animalhead buttgothicscene during opening creditssexual abusemutilationkicked in the stomachtherapistphone boothpsychoorphanagerapistback from the deadrampagecameosevered fingercrossbowkicked in the crotchbutcher3dexploding headthrown through a windowparachutemurder of a childdisfigurementknife throwingraised middle fingerdark pastabusive fatherkilling spreepsychoticnewspaper clippingposterhit with a baseball batmarijuana jointserial murdervillain played by lead actorstabbed in the handmolotov cocktailkillohiohuman monsterchild molestationevil spiritstonerburnt facecameo appearancekidnapperplaying a video gamefinger cut offchild kidnappingpunching bagsleeping in a carkiller childsixth partclawfamily mandeath of title characterbloody violencelunaticsadistic psychopathmurder spreeanimal killinghusband murders wifefairghoulbutcherysleepwalkingsheltercreepglovefalling through the floorchild killedpsycho terrormidwestbroken handchild killerrepressed memorycreepywater towerchild murdererman punches a womanadopted childdisturbingreference to friedrich nietzschehit by a bustorturerboiler roomsadisticsequel to cult filmabusive stepfatherboogeymandrive in classicburnt handhearing aidhit with a frying panserial child killergreen bloodfear of heightsdream worldgory violencesleep deprivationfilm starts with quotethrown through a wallfalling down a hillgruesomedream within a dreamear bleedingshared dreamdisturbed childhoodfreddy kruegernightmare becomes reality3d glasseschoked to deathserial teen killerstabbed in the ear3d sequel to 2d filmtrailer narrated by don lafontainetroubled childhoodpipe bombanimal mutilationdaughter murders fatherflashback sequenceloud noiseserial child murderelm streetspringwood ohioabusive childhoodserial child murdererspikesreference to nintendoteenage murdererhit with a beltthrown from an airplanefingernails on chalkboardchild as murderer (See All) |
While celebrating their 50th wedding anniversary, a couple are caravanning through the desert with their 3 children, son in law and their baby granddaughter. While the rest of the family agrees there are plenty of better and more appropriate things to do to celebrate an anniversary, they make do wit …h what they have, but things take a turn after a sketchy gas station attendant informs them about a "short cut" that will take them in between a series of hills in the desert. It doesn't take too long before they realise they're not alone and the hills indeed do have eyes. (Read More)
| Subgenre: | tragedypsycho thriller |
| Themes: | madnesscannibalismevilsadismbrutalitypsychopathtorturekidnappingdeathmurderrevengesuiciderapedeath of fatherdeath of mother …death of wifeself sacrificemurder of familyghost town (See All) |
| Mood: | slashergorehorror movie remake |
| Locations: | gas stationdesertcavesuv |
| Characters: | terrorvillainserial killerfamily relationshipsbrother sister relationshipteenage girlteenage boybabykiller |
| Period: | year 2006 |
| Story: | homicidal maniacevil manpsychopathic killerbad guymadmanbody countvictimragemaniacmurdererbaseball batstabbed in the backaxeblood splatterblood …violencedogsurprise endingpistolcar accidentshot in the chestshot in the headshotgunfalling from heightcar crashrevolverfoot chaseimpalementstabbed in the chestexploding carsevered headcontroversyshot in the foreheadperson on firevacationamerican flagglassesfirst partsevered armdismembermentkillingsplatterclaim in titleburned alivekilling an animalmutantmutilationwalkie talkierapisthomiciderampagesevered fingerstabbed in the throatcannibalgunshot woundstabbed in the headstabbed in the legdeath of sistertrailermineaxe murdermutationsevered legkilling spreedeath of loved onemannequinserial murderhysteriacrucifixionex copkilldead animalkilling a doghead blown offhuman monstergerman shepherdstrandedsexual violenceexploding truckbitten in the neckburnt bodyextreme violenceminersiblinggraphic violencestabbed in the facecut into piecesbloody violencedeformitystupid victimvillain not really dead clicheheart in handwedding anniversaryloss of parentsbrother in lawinfantsevered eargas station attendantaxe in the headpick axestabbed in the footfamily in dangerouthouseanthropophaguskidnapped childinbreedingdrug referencebirth defectgraphic rapenuclear testinggovernment secretwalking through a wallsevered spineradioactive fallout (See All) |
On Halloween in 1963, Michael Myers murdered his sister, Judith. In 1978, he broke out to kill his other sister, Laurie Strode. He killed all of her friends, but she escaped. A few years later, she faked her death so he couldn't find her. But now, in 1998, Michael has returned and found all the pape …rs he needs to find her. He tracks her down to a private school where she has gone under a new name with her son, John. And now, Laurie must do what she should have done a long time ago and finally decided to hunt down the evil one last time. (Read More)
| Subgenre: | independent filmcult filmpsycho thrillerslasher flickteen horroramerican horror |
| Themes: | evilpsychopathmurderdeathdrugsparanoiainsanityabductionalcoholism |
| Mood: | slashernightmarehigh school |
| Locations: | schoolsmall townelevatorkitchentruck |
| Characters: | terrorvillainserial killerfamily relationshipspolicemother son relationshipteenagerboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boygirlnursepolicemansecurity guard …alcoholicsecretaryslasher killermysterious villain (See All) |
| Period: | 1990syear 1998 |
| Story: | homicidal maniacevil manpsychopathic killerbad guymadmanpsycho killerbody counttrappedvictimragemaniacstabbed in the backstabbed to deathdeath of friendthroat slitting …axehalloweendecapitationdead bodyknifeviolencebloodnumber in titlesequelchasepistolcar accidentfalling from heightmaskbirthdayneighborhallucinationtelephonesubjective cameragood versus evilflashlightwinecandlecaliforniaambulancestabbingtoiletstabbed in the chestweaponsevered headattempted murderstalkerprologuekeyuniformcharacter's point of view camera shotmistaken identityactor shares first name with characterstalkingreunionflowersplatterbreaking and enteringheroinesurvivorlifting someone into the airloss of friendhidingpsychofaked deathmasked manrampageunderage drinkingdelusionstabbed in the legboarding schoolknife throwingaxe murdercharacters killed one by onedivorceesecret identitypumpkinmasked killernewspaper clippinghockeyreflectionstolen carserial murderanniversarybeheadingcar troublemysterious manfire extinguisherreturning character killed offhiding in a closetgateslashingbody baggraphic violencestabbed in the facehiding placemasked villainknife murderbloody violencebutcher knifefemale victimsadistic psychopathmurder spreevillain not really dead clichesittingseventh partpsycho terrormichael myersdead teenagerdoor belllifting an adult into the airsadisticboogeymanlifting a male into the airjumpsuitsequel with unusual numberaxe in the chestcult favoritehead chopped offgarbage disposalserial teen killertrailer narrated by don lafontainewhite maskhome intruderevil uncleschool counselor (See All) |
Loosely based on serial killer 'Henry Lee Lucas' (qv), the film follows Henry and his roommate Otis who Henry introduces to murdering randomly selected people. The killing spree depicted in the film starts after Otis' sister Becky comes to stay with them. The people they kill are strangers and in on …e particularly gruesome attack, kill all three members of a family during a home invasion. Henry lacks compassion in everything he does and isn't the kind to leave behind witnesses - of any kind. (Read More)
| Subgenre: | independent filmcult filmpsycho thrilleramerican horrorindependent horror |
| Themes: | evilbrutalitypsychopathtorturedeathmurderdrugsrapeincestinsanityexploitationmurder of family |
| Mood: | slashergore |
| Locations: | chicago illinois |
| Characters: | terrorvillainserial killerbrother sister relationshipprostitutekillerslasher killermysterious villainserial murderermurder of a prostitute |
| Period: | 1980s |
| Story: | homicidal maniacevil manpsychopathic killerbad guymadmanpsycho killerbody countslaughterpsychotronicragemaniacstabbed to deathstrangulationdecapitationblood splatter …bloodviolencefemale nuditycharacter name in titlenuditybare breastsgunsurprise endingshot to deathshot in the chestlow budget filmmarijuanacriminalbisexualvideo camerastabbingdrug dealerstabbed in the chestchild abusesevered headcontroversypantyhosestalkerattempted rapestalkingneck breakingdismembermentkillingsplatterfemale stockinged legsmutilationstabbed in the stomachpsychorapistrampagelow budgetdark humorbutcherperversionmurder of a childstabbed in the eyeabusive fatherkilling spreepervertserial murdervillain played by lead actormysterious mankillhuman monstersexual violenceslashingnaked dead womanextreme violencevideo footagematricideknife murdercut into piecessadistic psychopathoff screen murderchild rapemurder of a nude womanmurder spreebroken neckdisturbed individualbutcherygrindhouse filmexploitation filmcrime spreecreepdead woman on floorwoman's neck brokenpsycho terrorbased on supposedly true storydead prostitutesadisticsickofemale hitchhikermurderer duotwo killersmutilated bodygraphic rapesex maniaclead actor's first filmdead woman on toiletdead woman wearing lingerie (See All) |
Picking up where the original Nightmare left off, Nancy has grown up and become a psychiatrist specializing in dream therapy. She meets a group of children at a local hospital facing Freddy Krueger, the same demon she once encountered in her sleep. One of them is Kristen, who has the power to draw o …ther people into her dreams. Working with a male doctor assigned to the case, Nancy helps the kids realize their special abilities within the nightmare world. When Freddy captures one of her charges, she leads a rescue attempt into Krueger's domain, in hopes of putting his spirit to rest once and for all. (Read More)
| Subgenre: | independent filmcult filmsupernaturalpsycho thrillerstop motion animationamerican horror |
| Themes: | evilsadismpsychopathdeathmurderghostfuneralmonstersupernatural powerinsanity |
| Mood: | slashernightmaregore |
| Locations: | barchurchcemeteryschool boy |
| Characters: | terrorvillaintough guyserial killerfather daughter relationshipteenagermother daughter relationshipdoctornurselittle girlsingle motherkillerself mutilationslasher killeralcoholic father …serial murdererevil nurse (See All) |
| Period: | 1980s |
| Story: | homicidal maniacevil manmarionettecarnagepsychopathic killerbad guymadmanpsycho killerbody counttrappedswitchbladevictimragemaniacmurderer …stabbed in the backpuppetstabbed to deathdeath of frienddecapitationbathroomslow motion sceneblood splattercorpsebare chested maleviolencefemale nuditynumber in titlesequelbondagecigarette smokingsurprise endingfiredreamdigit in titlethongfalling from heightbedrock musicnumbered sequeldemonfoot chasenewspaperstabbingimpalementsuicide attemptstabbed in the chestnundream sequenceradiochild in periltonguethird partcharacter repeating someone else's dialoguescreamingpay phonedollskeletonisolationbasementcharacter says i love youkillingundeadsplatterfalling down stairsteen angstelectronic music scorelifting someone into the aircomatied to a bedcrucifixback from the deadclockdrug overdoserampagewindmutefalling to deathbutcherhypnosisstairsstabbed in the legschool uniformdead childjumping through a windowknife fightfogdisfigurementstabbed in the eyecharacters killed one by onekilling spreepajamassmokeserial murderalleyreturning character killed offohioevil spiritabandoned housestabbed in the armslashinggroup therapyboy with glassesburnt facebody in a trunkscalpelone linerdruggedwrist slittingrazor bladedisembodied headwheelchair boundsuper powerpsychiatric hospitalaspiring actresshit with a shovelclawthird in seriesbloody violencetelevision setdigging a gravemattresssadistic psychopathgymnasticsmurder spreevillain not really dead clicheghoulsolitary confinementbreaking a mirrorbutcherysleepwalkingpitholy waterchantingfedoraglovetroubled teensexual innuendopayphonecut armreanimationfalling asleeplifted by the throattricyclechild killerjumping ropecreepyhospital gownorderlychild murdererdead teenagerdisturbingboneslifting a female into the airbad motherhanged boydemonicsedativestreet in titleboiler roomforced suicidesadisticboogeymandrive in classicsexy nursegluereference to edgar allan poeserial child killerfurnacedungeons and dragonsnursery rhymehanged girlbourbonmohawkpunk girljump scarelong tongueolder woman younger manexperimental drugteen smokingburn scardream within a dreamskipping ropescaredshared dreamscratchingfreddy kruegerburned with a cigarettependulumgroup of teenagersstabbed with glassfootstepsserial teen killerdead pigpromiscuous motherbegins with a quotebossy motherinanimate object comes to lifespeaking spanishsleep disordernewton's cradleex drug addictfeathersserial child murderelm streetspringwood ohiofalling leavespapier macheserial child murdererteenager in dangerveinhomemade weaponstabbed with a needleselective mutismbreaking through wallphysical harmbicycle bellchase scenecommitted to asylumdiet cokeisolation cellkids playingscar tissuewidowed motherbathroom sinkminiature modelshoutteenager murderedunfit mothercarrying a childchasing a girlforced drug usenegligent motherteardrop tattoocarrying a girldisabled characterdisabled teenagerinstant coffeeolder woman younger boypopsicle sticktendon (See All) |
When three girls are kidnapped by a man with 23 different personalities, they have to work out which of those personalities will help them escape and which of those personalities will try to stop them.
| Subgenre: | survival horrorblack comedysuspensesuperherotragedypsycho thrillerteen horrorpsychological thrilleramerican horror |
| Themes: | cannibalismbrutalitypsychopathkidnappingmurderdeathfriendshipsurrealismrapebetrayalfearescapefuneralmonsterdeception …voyeurismdeath of fatherparanoiainsanitymental illnesssurveillancepanichuntingcampingnear death experienceobsessive compulsive disorderself harm (See All) |
| Mood: | slashergoreneo noir |
| Locations: | trainforesttaxiwoodskitchenapartmentpolice cartaxi drivermuseumtunneltrain stationart museum |
| Characters: | terrorvillainserial killerfather daughter relationshipteenagerafrican americandoctorteenage girlpolice officerhostagekillersecurity guardpsychiatristuncle niece relationshipslasher killer …serial murdererpolice dog (See All) |
| Period: | 2010s |
| Story: | homicidal maniacevil manpsychopathic killerbad guypsycho killerbody countescape attemptmercilessnesswoman in jeopardyvictimragemaniacmurdererbaseball batold woman …death of friendsurvivalwritten by directorcorpseknifetitle spoken by characterbare chested maleviolencebloodone word titlesequelflashbackdogdancingpartychasesurprise endingpantiescell phoneshot to deathshot in the chestshotgunrescuewatching tvcomputerpaintingrifleheld at gunpointsecond partbirthdayneighborvoyeurriversubjective cameraorphanbedroomflashlightambulancedinernonlinear timelinechild abuseman with glassesanimaldisarming someonedrawingdouble crossbirthday partynews reportnecklacetransformationtrainingattempted murderstalkerdangercharacter's point of view camera shotmissing persontentknocked outflowersscarinjectiontragic eventhigh school studentstalkingbasementlaptoploss of fathersuspicionkillingrevelationhypodermic needleheavy rainlooking at oneself in a mirrorcagesociopathloss of friendsecurity cameracaptivewalkie talkiehuntercaucasiantherapisteccentricpsychopart of trilogyrapistschizophreniainterracial friendshipcrushed to deatheaten alivegas maskrampagepump action shotgundamsel in distresscameohaunted by the paststealing a carcannibalpower outagezooshopping mallsuper villainpedophilee mailcapturedeertigerphiladelphia pennsylvaniafemale doctorlonerdark pastcharacters killed one by onekilling spreechloroformtorso cut in halfhit with a baseball batserial murdervillain played by lead actormental patientdirector cameopedophiliaforced to stripmental breakdownscene before opening creditshuman monsterspiral staircasetwist endingchild molestationjournallockerhuman sacrificeworld dominationmegalomaniacyoung version of charactersuper powersbeastsplit personalitykidnapperpearl necklaceguardiansole black character dies clichemacabreopen endedsuperhuman strengthtragic pastchild molesterbloody violencesole survivorwhite brafemale victimsadistic psychopathschizophreniclocked in a roommolestationchild rapefade to blackdisturbed individualsinistercreepabusive motherboom boxvideo diarysexual predatorhit with a chairbritish actor playing american characterflower shopskypeconferencepower drillpsycho terrorpepper sprayweirdoflesh eatingdead teenagerdisturbingcaged humancrawlingkidnappedmultiple personality disorderman dressed as a womananthropophaguseast coastair venteating human fleshblood on mouthlispvirtualitydissociative identity disorderlocked in a cageclimbing up a walldrawingsstereodreadzookeeperdisturbed childhoodsuperhuman speedcrawlspacereference to skypebookshelfviolentvideo conferencingvideoconferencingcoat hangerfemale victimsvillain escapeswrist cuttinggauzeteleconferencingunder the bedchild rapist (See All) |
A team of trainees of the National Guard brings supply to the New Mexico Desert for a group of soldiers and scientists that are installing a monitoring system in Sector 16. They do not find anybody in the camp, and they receive a blurred distress signal from the hills. Their sergeant gathers a rescu …e team, and they are attacked and trapped by deformed cannibals, having to fight to survive. (Read More)
| Themes: | cannibalismevilpsychopathtorturemurderdeathrevengesuiciderapeinsanityrape and revenge |
| Mood: | slashergore |
| Locations: | desertwaternew mexico |
| Characters: | terrorvillainserial killerslasher killer |
| Period: | year 2007 |
| Story: | homicidal maniacevil manpsychopathic killerbad guymadmanpsycho killernude woman murderedbody counttrappedragemaniacstabbed in the backstabbed to deathsurvivalblood splatter …corpsefightfemale nuditynuditybare breastssequelexplosionsurprise endingpistolfirelickingshot to deathshot in the chestremakeshot in the headfalling from heightriflenumbered sequelf wordgood versus evilgay slurstabbingarmyimpalementstabbed in the chesttrainingbeaten to deathkicked in the faceshot in the shouldertragic eventexploding bodysevered armdismembermentsplatterropeclaim in titlemutantassaultaccidental deathpsychobroken legguardrampagesevered fingerhit in the crotchcannibalgash in the facestabbed in the headdynamiteaccidental killingmineaxe murderkilling spreetorso cut in halffemale soldierblood on camera lensintestinesserial murdergiving birthhuman monsterstrandedsexual violencestabbed in the armanal rapesuicide bomberbayonetmeat cleaverbleeding to deathextreme violencegraphic violencestabbed in the facedrillunwanted pregnancybloody violencedeformitysadistic psychopathpsychotronic filmsledgehammerstupid victimhillgrindhouse filmbody partno endingstabbed in the mouthfalling off a cliffaxe in the headsevered tonguesadisticnational guardshootpregnant woman nudeskull crushingsequel to remakesickolong tongueraped by monstermutilated bodyumbilical cordtwisted anklegraphic rapeport a pottystillbirthtraining exercisesadistic torturedynamite explosionthrown from a cliffsemen in womanlast daywoman murderedfacial deformityfreeclimbing (See All) |
Brian Kessler, a journalist researching serial killers, and his photographer girlfriend Carrie set out on a cross-country tour of the sites of the killings. Sharing the ride and their expenses are Early Grayce, a paroled white trash criminal, and his girlfriend Adele. As the trip progresses, Early b …egins to appear more and more unstable, and Brian and Carrie begin to fear that they may have a real-life killer in the back seat of their car. (Read More)
| Subgenre: | independent filmcult filmpsycho thrilleramerican horror |
| Themes: | evilsadismpsychopathtorturekidnappingmurderdeathrapetheftinsanityphotographywritingmurder of a police officerrape and murder |
| Mood: | slashergoreneo noir |
| Locations: | gas stationbarhelicopterdesertroad tripmoteltexasroad moviesex in a car |
| Characters: | terrorvillainpoliceboyfriend girlfriend relationshipwriterhostagewaitresskillerslasher killerchinese foodserial murderershooting a police officer |
| Story: | homicidal maniacevil manpsychopathic killerbad guymadmanbody countredneckvictimragemaniacmurdererstabbed in the backstabbed to deathdead bodyblood splatter …title spoken by characterbare chested maleviolencebloodfightsexfemale nuditynuditymale nudityone word titlemale rear nudityguncigarette smokingphotographpistolshot to deathcar accidentshot in the chesturinationshot in the headshotgunbare buttbeersex standing upgay slurjournalistcalifornianarrationjourneyblack pantieson the roadautomobilekillingarsontape recordermutilationstabbed in the stomachpsychorape victimrapistmale underwearrampagetensionstabbed in the throatgash in the facedark humorbutcherblack brabilliardsperversionrainstormsexual assaultkilling spreepsychoticblack bra and pantiesphysical abusepervertserial murderkillpistol whiphuman monsterpolice officer shot in the chestsexual violenceknocked unconscioushillbillyyuppietrailer parkwhite trashcactusgraphic violencehit with a shovelintentionally misspelled titlecross countrybloody violenceabusive boyfriendlunaticsadistic psychopathmass murdererbreaking a bottle over someone's headbutcherycrime spreepittsburgh pennsylvaniasoutherncreeppolicewoman killingserial rapistpsycho terrorexposed breastdisturbingparole officerfemale photographerpolice officer shot in the backyo yogory violencepolice officer shot through the heartgruesomemurder of a policewomandead policewomanpsycho filmheavy pettinghickbrutalsports brapolice officer shot in the leghair stylemale with earringserial rapepolicewoman shottwisted mind (See All) |
Michael Myers is still at large and no less dangerous than ever. After a failed reunion to reach his baby sister at their old home, Laurie Strode is immediately taken to a hospital to be treated by the wounds that had been afflicted by her brother a few hours ago. However, Michael isn't too far off …and will continue his murdering 'Halloween' rampage until he gets his sister all to himself. (Read More)
| Themes: | evilbrutalitypsychopathdeathsuicideghostdrunkennessinsanityexploitationhomelessnessmurder of a police officerdeath of daughter |
| Mood: | slashernightmaregoreraindarkness |
| Locations: | hospitalhelicopterstrip club |
| Characters: | serial killertattoomother son relationshipfather daughter relationshipsingerpsychiatristsniper riflecoroner |
| Story: | homicidal maniacevil mansatanicpsychopathic killerbad guybody countvictimmaniacmurdererstabbed in the backclownstabbed to deathdeath of friendthroat slittingstrangulation …halloweendecapitationslow motion sceneblood splattercorpsefemale frontal nuditybloodviolencefemale nuditynumber in titlesequelinterviewflashbackfemale rear nuditysingingpartychasepistolbeatingdreamcar accidentshot in the chesturinationshotguncameramaskbookvomitingheld at gunpointsecond partcar crashcafehallucinationstripperf wordflashlightbandstabbingimpalementstabbed in the chestexploding carhit by a carlatex glovesflash forwardstalkermicrophoneportraitattackhalloween costumescarstalkingglassesneck breakingprofanitypizzasurgerykilling an animalwoman with glasseshidingcovered in bloodsheepschizophreniamental institutiongirl with glassesduct tape over mouthrampagecorsetblood on facehippiegash in the facetaking a picturestabbed in the headtime lapse photographybroken armaxe murdercharacters killed one by onekilling spreeswearinghalloween partymusic bandhit with a baseball batinterrupted sexserial murderbeheadinggroupg stringreturning character killed offmedical masksurgical maskhuman monstersexual violenceslashingdental maskhead bashed infilm starts with textassistantstrong languagebody baghanged manhead cut offcountry houseextreme violencegraphic violenceoverturning carstabbed in the facebloody violencefemale victimsadistic psychopathpentagramschizophrenicbreaking through a doormurder of a nude womanmass murdererbreaking a mirrorpole dancingjack o'lanterncrime spreereturning character with different actorshackbook signingscreaming in fearmirror ballbrandymichael myersshaky camwhite horsethrown through a windshielddemonicsadisticpublic speakingboogeymangory violencesequel to remakeaxe murderertape over mouthwoman wearing glassesjumpsuitstitchesknife in the headbad jokebleeding from eyespigletmultiple versionsserial teen killerclown maskaxe in the backgirl wearing glasseswhite maskthroat slitnitrile glovesstomped to deathdictionary definition in screen textpublic speakertraumatic shockultraviolenceremake of sequel (See All) |
Tommy Jarvis returns to the graveyard to make sure Jason Voorhees is dead and accidentally brings him back to life. Now it's up to Tommy to stop Jason's mindless killing and put him back where he belongs.
| Subgenre: | cult filmsupernaturalpsycho thrillerparanormal phenomenaslasher flickteen horroramerican horror |
| Themes: | evilpsychopathdeathmurderprisonmonstersupernatural powerinsanitymurder of a police officer |
| Mood: | slashergorecar chasedarknessbreaking the fourth wall |
| Locations: | forestcemeterysmall townboatwoodslakeamerica |
| Characters: | terrorvillainserial killerpoliceteenagerzombiekillersheriffslasher killerserial murderer |
| Period: | 1980s |
| Story: | homicidal maniacevil manpsychopathic killerbad guymadmanpsycho killerbody countslaughtervictimblood spattermaniacmurdererstabbed to deathmassacredecapitation …blood splatterviolencesexcharacter name in titlenumber in titlesequelflashbacksurprise endingmasknumbered sequeldemonflashlightambulancestabbingsevered headchildlooking at the cameradrowningelectrocutionstalkingneck breakingunderwatersevered armdismembermentkillingundeadsplattermass murdergothicmachetelifting someone into the airmutilationpsychoback from the deadmasked manrampagenew jerseybutchershovelstabbed in the headsevered legsequel to cult favoritekilling spreebloodbathmasked killerserial murderbeheadingkillsummer campslashingactual animal killedsixth partstabbed in the facemasked villainknife murderrecreational vehiclecut into piecesbloody violenceheart ripped outfemale victimsadistic psychopathoff screen murdermurder spreevillain not really dead clicheghoulbutcherypaintballhead ripped offreturning character with different actorreanimationpsycho terrorstruck by lightningdead teenagerhockey masklifting a female into the airdemonicdark and stormy nightdrive in classicgrave robbinggory violenceeast coastunderwater fightjason voorheesdouble impalementmutilated bodyfriday the thirteenthstabcamaromachete mutilationpsycho filmviolentbrutalcomic drunkwessex county new jerseycrystal lake new jerseycut to piecespolice officer crushedstabbing a police officerserial teen murdererkilled by machete (See All) |
In a continuation of the plot of Halloween, Michael Myers shows off his indestructability by resuming his murder spree despite being gunned down with six bullets in the original movie. Laurie Strode is once more his intended victim, with Dr. Sam Loomis again in hot pursuit.
| Subgenre: | cult filmsuspensepsycho thrillerslasher flickamerican horrorholiday horror |
| Themes: | madnessbrutalitypsychopathtorturedeathmurderjealousyfearvoyeurismmemoryseductionobsessionparanoiainsanityblindness …traumamurder investigationmurder of a police officerpsychological trauma (See All) |
| Mood: | slashergorenightdarkness |
| Locations: | hospitalcarsmall townwheelchairpolice carhospital fire |
| Characters: | terrorvillainserial killerpoliceteenagerboyfriend girlfriend relationshipteenage girlpolice officernursedetectivepolicemankillersheriffslasher killerserial murderer |
| Period: | 1970syear 1978 |
| Story: | homicidal maniacdying wordspsychopathic killerbad guymadmanpsycho killernude woman murderedbody countdead manslaughtermercilessnessvictimmaniacmurdererstabbed in the back …old womanstabbed to deaththroat slittingstrangulationold manhalloweenblood splatterknifeviolencebloodsexfemale nuditynuditynumber in titlemale nuditybare breastssequelmale rear nuditytwo word titlekissfemale rear nuditycigarette smokingnipplesexplosionchasetelephone callfirecryingcar accidentshot in the chestblondewatching tvkissingbrawlsecretmaskshootingsecond partneighborvoyeurrevolversubjective cameragood versus evilflashlightambulancestabbingaccidentbrunettepart of serieshit by a carbathsearchpantyhosenews reportnecklaceattempted murderstalkerstrippingbeaten to deathprologuescreamingperson on fireuniformpoisoncharacter's point of view camera shotproduct placementcollege studentscreaminjectionstalkingglasseswitnesstrapsplattertv newssyringedestructionelectronic music scorehypodermic needlesexual attractionlifting someone into the aircowboy hatmutilationwalkie talkiestabbed in the stomachhammerhidingbuttockscaucasianpoolpsychogrindhousepsychologistbuttdriving a cardead womantowelback from the deadhomicidemasked manpresumed deadcamera shot of feetrampagestabbed in the throatmanhuntmutebroken glassbutchercigarette lighterhit on the headfrustrationautopsyaccidental killinghot tubshadoweye gougingdisfigurementstabbed in the eyedark pastcharacters killed one by onedead woman with eyes openlightneighborhoodbloodbathsmokemasked killerflat tirefemale stockinged feetdead girlserial murderconfusioncar troublemysterious manstoreneedlemedical masksurgical maskdark secretbandagehuman monsterlighteralonesuit17 year oldearringnurse uniformslashingdental maskblood stainclinicburnt faceparamedicshot in the eyestethoscopeadult actress playing teenage girlscalpelcigarettehand over mouthkiss on the lipsglassdripping bloodrobebleedingmurder witnessextreme violenceflamegraphic violencelighting a cigarettenurse outfitmurder attemptmultiple murdermasked villainroman numbered sequelknife murderbloody violencebutcher knifeman on firepool of bloodfemale victimsadistic psychopathscaremurder spreenude bathingsilhouettevillain not really dead clichebutcherygrindhouse filmzippo lightersinisterescaped mental patientburningdeeply disturbed personcutearringsboom boxpassing outnurse hatcuriosityset on firemultiple homicidepsycho terrormidwestsmall town sheriffsearchingmichael myersdisturbingcalling someone an idiotfragments of glasstorturerdemonicsequel to cult filmboogeymandrive in classic21 year oldfienddeath by strangulationdouble murderyelling for helpcar won't startchildhood flashbackmelting facewoman stabbedjumpsuitlocked upsecurity guard killedsmoking a cigarettemultiple stabbingstore roomsleeping womanclosing eyes of dead personboiling waterdark killerpsycho filmserial teen killertemperaturepolice officer throat slitpush buttonbath towelhidelighting a cigarette for a womanlighting someone's cigaretteblood draininghittingscaldinghospital patienthot waterneedle in eyeoctoberslipping and fallingstalking victimsliphomicidalteenager in dangerhit on the head with a hammeropening creditsexsanguinationlighting cigarette for womanserial teen murderervulnerablehead dunked in watermurdered with a hammerlighting a cigarette for someonerecap segmentscalding waterdead nursescalded faceself survivalcharred bodyhand on shoulder scaresleeping girlstabbed with a scalpelstalking by nightdead doctorwalking through a glass door (See All) |
One summer at Camp Crystal Lake, a group of young counselors begin to get ready to lead campers. Unfortunately for the former, someone isn't happy about what's going on in the camp and enjoys playing kill the counselor. As bodies fall to the ground in the camp, no one is safe.
| Subgenre: | independent filmcult filmsuspensepsycho thrillerslasher flickteen moviemurder mysteryteen horroramerican horror |
| Themes: | crueltyevilsadismbrutalitypsychopathdeathmurderrevengefearvoyeurismcorruptioninsanityhumiliationtraumamysterious death |
| Mood: | slashergorenightdarknessblood and gore |
| Locations: | carmotorcycleboatwaterwoodsrural settingpolice carlaketruck |
| Characters: | terrorvillainserial killerpoliceteenagerfriendteenage boypolice officerpolicemanartistkillermothersherifftruck driverslasher killer …mysterious villainserial murderer (See All) |
| Period: | 1970s1950ssummer |
| Story: | homicidal maniacpsychopathic killerpsycho killerbody countdead manslaughterpsychotronicmercilessnessvictimmaniacmurdererstabbed to deaththroat slittingmassacreaxe …old mandecapitationdead bodyslow motion sceneblood splattercorpsebare chested maleviolencesexfemale nuditynumber in titlemale nuditybare breastsmale rear nuditykissfemale rear nuditynipplesthree word titlesurprise endingpantiesbeatingdigit in titlefistfightblondebikinithongbeerrunninglow budget filmmarijuanahallucinationvoyeurguitarsubjective camerabedroombracandlestabbingwomandineraccidentsnakecultdream sequenceskinny dippingstrippingdangerprologuescreamingfirst of seriesmoaningdeath of childprankinjectionstalkingdeath of sonfirst partcabinkissing while having sexkillingteenage sexfreeze framegirl in pantiesrevelationdesirenipples visible through clothingelectronic music scoredressjeepgothicheavy rainmachetehatstabbed in the stomachhammervillainesspsychoswimsuitgrindhousedead womanfull moonrampagebra and pantieslow budgetnew jerseystabbed in the throatobesitypower outagemutebutcherlostthunderstormbathingdisembowelmentsurpriseatticperversionlens flareaxe murderroomcharacters killed one by onekilling spreearrowdeath of loved onetank toppsychoticphysical abuset shirtjoyserial murdersexual awakeningbeheadingcar troublemysterious manshortsdead animalhuman monstersummer campcanoeadolescencerepressionsexual perversionrestroomfemale psychopathslashingjacketdying mandripping bloodrobeactual animal killedday in titlesummer vacationfemale villainshirtmurder witnessevil womanextreme violencefamous scoreanthropologydisfigured facegraphic violenceorchestral music scoresexual repressionmenacemurderessmultiple murdergame playingbowboard gameknife murderpillowbloody violencesole survivortraumatic experiencefemale victimsadistic psychopathwet clothesgrudgeoff screen murdermurder spreevillain not really dead clichebutcherygrindhouse filmmurder victimcrime spreecurtaintroubled teenblond boybitingmystery killersweateraxe in the headmultiple homicidemistreatmentpsycho terrorfemale serial killerweirdoawakeningdate in titledead teenagerdisturbinglost in the woodsraincoatobese womanvillainess played by lead actressblousegiallo esqueremadesadisticdark and stormy nightdrive in classicmutilated corpsedeath by impalementeast coastaxe murdererbad girlcamp counselorcampfire storygruesomejason voorheesunknown killerbody mutilationfriday the thirteenthatonal music scoremachete mutilationmonopoly the board gamepsycho filmknife through the neckserial teen killercanoeingtrailer narrated by don lafontainekilled with an arrowfemale victimsstormy nightscore employs electronic instrumentsnaked bathingwoman taking off pantsemotionally disturbed personwessex county new jerseycrystal lake new jerseyjerseyelectrical generatorkilled with machetevoice impressionistquietcamp vacationunstable teenager (See All) |
On the eve of her seventeenth birthday, Mari Collingwood tells her parents that she is going to the concert of underground band Bloodlust in New York with her friend Phyllis Stone. She borrows the family's car and heads with her friend to a dangerous neighborhood in the city. Meanwhile, the sadistic … and cruel escapees Krug Stillo and Fred 'Weasel' Podowski are hidden in a hideout with their partners Sadie (Jeramie Rain) and Krug's addicted son Junior Stillo (Marc Sheffler) after killing two guards and one shepherd in their runaway. The two girls seek marijuana near the theater and meet Junior that offers some Colombian grass to them. They go to his apartment and are subdued by the criminals that rape Phyllis. On the next morning, they hide the girls in the trunk of their convertible and head to Canada. However, they have a problem with the car's rod and they stop on the road close to Mari's house. When Phyllis tries to escape, the gang stabs her to death and shots Mari after humiliating and raping them. They seek shelter in Mari's home, but during the night, her mother overhears a conversation of the criminals telling that they have killed her daughter. She tells her husband and they plot a scheme to revenge the death of their princess. (Read More)
| Subgenre: | independent filmcult filmamerican horrorsadistic horror |
| Themes: | madnesscrueltyevilsadismbrutalitypsychopathtorturekidnappingdeathmurderrevengesuiciderapeescapeinvestigation …voyeurismseductioninsanityhumiliationabductionvengeancerape and revengerape and murder (See All) |
| Mood: | slashernightmaregorehigh school |
| Locations: | swimming poolforestcemeterylakerunning through the woods |
| Characters: | terrorvillainserial killerfamily relationshipsfather son relationshippoliceteenage girlreference to godkillersheriffslasher killerserial murdererself justice |
| Period: | 1970s |
| Story: | homicidal maniaccigar smokingevil manheld captivecarnagepsychopathic killerbad guymadmanwoman in jeopardyswitchbladevictimchainsawmaniacmurdererstabbed in the back …scantily clad femalestabbed to deaththroat slittingblood splatterknifefemale frontal nudityviolencefightbloodfemale nuditydoggunfemale rear nudityfemale full frontal nuditypantiesshowershot to deathurinationremakeshootingbeerbirthdaymarijuanavoyeurfoot chasebound and gaggedgangconcertstabbingtoiletfemale pubic hairwhite pantiesbathcontroversynecklacelatex glovespublic nuditydrug addictscreamingsuburbelectrocutionringconvertiblefemale removes her clotheschickendirectorial debutsevered armhandgunbased on filmcult directordismembermentbralessnipples visible through clothingbeer drinkingmachetesexual abuseice creammutilationgrindhouserape victimrapistpeeping tomfemale killerhitchhikingrock concertsufferingcynicismhippiepet dogjunkiepedophiledisembowelmentperversionmurder of a childcastrationducksexual assaultfemale in showerbloodbathshot multiple timesdead girlpervertserial murderprayingcannabisforced to striprunning awayspit in the facemisogynisthuman monsterphysiciansexual perversionsexual violenceelectronic musicfemale psychopathdegradationdouble barreled shotgunescaped convictwetting pantsfilm starts with textparentrazor bladefemale villainatrocitystation wagonshot through the mouthgraphic violencereading a newspaperchild molesterbloody violencesadistic psychopathbakingdisturbed individualstreamlong haired maleserial rapistbitingpaybacksexual predatorstabbed multiple timesrunning out of gasrunning for your lifemistreatmentescaped prisonerfemale serial killerperson in a car trunkpocket knifebased on supposedly true storysexual crueltypokiesbanned filmdisturbingsex offenderforced suicidesadisticstabbed in the bellydrive in classichands tied behind backrefugeserial child killerinfamybloody handmutilated corpsecheckershorror movie remadevideo nastysickocandlelight dinnerbad girlpsychological tormentcaged birdreference to j. edgar hoovertrip wiregraphic raperotten teethserial teen killerlocked in a car trunkescaped killerlive chickenhair curlersfemale victimsengine troublereference to the grand canyonserial child murdererplaying checkersstuffed in a car trunkbaking a cakeprison escapeewoman smoking a cigarmedical gownserial teen murdererice cream barsmoking in bathtubwoman in a trunkremake of swedish film (See All) |
It's been nearly ten years since Freddy Krueger terrorized people in the dreams, and the towns folk want to keep him erased from their memory. Freddy still has one more plan on getting back to Elm Street. He resurrects Jason Voorhees and sends him off to kill. The more bodies which fall to the groun …d, the stronger in which Freddy becomes. This is until, Freddy realizes that Jason isn't going to step aside easily, and must be taken down himself. (Read More)
| Subgenre: | independent filmcult filmsuspensesupernaturalpsycho thrillerparanormal phenomenaslasher flickamerican horrorcanadian horror |
| Themes: | evilbrutalitypsychopathtorturekidnappingmurderdeathrevengesuicideghostfeardrunkennessdeath of fathersupernatural powerdeath of mother …insanityabductiontraumafear of water (See All) |
| Mood: | slashernightmaregorerainhigh schoolbreaking the fourth wallblood and gore |
| Locations: | forestcemeterysmall townpolice stationlakeschool nurse |
| Characters: | terrorvillainserial killerfather son relationshipmother son relationshipfather daughter relationshipboyfriend girlfriend relationshipteenage girlteenage boyzombielittle girlkillersheriffslasher killermysterious villain …serial murderer (See All) |
| Period: | 2000s |
| Story: | homicidal maniacevil manfinal showdownsatanicpsychopathic killerbad guymadmanpsycho killerbody countslaughterpsychotronicvictimragemaniacmurderer …decapitationslow motion sceneblood splattercorpseviolencebloodcharacter name in titlesequelflashbackphotographexplosionpartysurprise endingpistolshowerfirevoice over narrationdreambrawlfalling from heightmaskcar crashdemonfoot chasestabbingimpalementsevered headdream sequencechild in perilunderwater scenevandrowningskinny dippinglibrarycharacter repeating someone else's dialoguevirginprologueperson on fireelectrocutioncharacter's point of view camera shotcover updeath of childdeath of brotherhigh school studentstalkingneck breakingpremarital sexcabinsevered armdismembermentkillingundeadsplatterchild murderburned aliveheroinemass murdermachetelifting someone into the aircomamutilationpsychosevered handgoatcrushed to deathmasked manrampagesevered fingernew jerseymisunderstandingbutchermedicationmurder of a childalternate realityeye gougingdemonic possessioncharacters killed one by onekilling spreegeekburned to deathmasked killernewspaper clippingtorso cut in halfblood on camera lensserial murderbeheadingmysterious mannecrophiliakilldockohiosummer camplockerevil spiritsexual violencestonerslashingdomineering motherflaskhanging upside downburnt facecornfielddeputywrist slittingkidnapperdripping bloodchild kidnappingravedeath of boyfriendcrossoverburnt bodypsychiatric hospitalgraphic violenceclawmasked villainbloody violencedeformityfemale victimsadistic psychopathpsychotronic filmbreaking through a doormurder spreemass murderervillain not really dead clicheghoulbutcherychild abductionescaped mental patientfedoracaterpillarglovearm ripped offchild killedsevered earsliced in twoeighth partpsycho terrormidwestchild killerobituarychild murdererhand through chestdead teenagerhockey masktorturerdemonicboiler roomsadisticmissing person posterburnt handpassed out drunkserial child killerbroken backtranquilizergory violenceeast coastlucid dreamcamp counselorgruesomejason voorheesdouble impalementhell on earththrown through a glass dooreleventh parttwo killersshared dreamdisbelieving adultfreddy kruegerfriday the thirteenthmonster versus monsternightmare becomes realityreanimated corpsemachete mutilationpsycho filmserial teen killerbrutaltroubled childhoodreference to the three stoogesmutilated childsevered nosehead spinmonster as victimserial child murderelm streetslashed to deathspringwood ohioabusive childhoodserial child murdererwessex county new jerseycrystal lake new jerseyevil versus evilkilled with machetekiller vs killerdreams vs realityserial teen murdererkilled by machete (See All) |
Fifteen years after a horrifying experience of abduction and prolonged torture, Lucie embarks on a bloody quest for revenge against her oppressors. Along with her childhood friend, Anna, who also suffered abuse, she quickly descends, without hope, into madness and her own delusions. Anna, left on he …r own begins to re-experience what Lucie did when she was only twelve years old. (Read More)
| Subgenre: | sadistic horrorfrench horror |
| Themes: | madnesscrueltysadismbrutalityangertorturemurderdeathrevengesuicidefearescapesupernatural powerinsanityafterlife …murder of familystarvationlesbian love (See All) |
| Mood: | nightmaregorebleakness |
| Characters: | husband wife relationshipmother daughter relationshipbrother sister relationshipgirlself mutilationyounger version of charactersuicide by gunshot |
| Period: | year 1971 |
| Story: | evil manwoman as objectobjectificationviolent deathcaptivityheld captivevictimwoundmurdererthroat slittingbathroomdead bodyblood splattercorpsetitle spoken by character …bare chested maleviolencebloodfemale nudityf ratedone word titlefemale rear nudityphotographlesbian kisssurprise endingshowercryingbeatingshot to deathshot in the chesturinationface slapshot in the headshotgunpunched in the facevomitinghallucinationhandcuffsshot in the backprisonertied to a chairchild abusecultchild in perilpaingravebeaten to deathwitnesshatemutilationcaptivehammerphone boothgrindhouseladderorphanagepresumed deadhaunted by the pastsufferingpunched in the stomachplot twistdead boychloroformatheistbrainwashingmysticismtestimonygun in mouthsuccessfriendship between womendisposing of a dead bodyhead bashed inecstasywrist slittingmercedes benzshot through the mouthevil womanchainedextreme violencegraphic violencemartyrmurderesshit with a hammertrapdoorfemale victimmurder of a nude womandragging a bodynew ageeyesstraight razorbloody body of a childshacklestorture chamberlife after deathemaciationexposed breastfanaticismhandcuffed womanincarcerationskinned aliveperversitysingle locationsuperficialitytranscendencemartyrdomforce feedinghell on earthabuse against womenfrench shock cinemapretensionsurvivor guiltnail in the headpseudo intellectualshroudvindicationhandcuffed behind backsecret entrancequest for knowledgelong sufferingsmashing through a windowhidden staircasehistorical referencefalling through a glass doorunderground complex (See All) |
The year is 1963, the night: Halloween. Police are called to 43 Lampkin Ln. only to discover that 15 year old Judith Myers has been stabbed to death, by her 6 year-old brother, Michael. After being institutionalized for 15 years, Myers breaks out on the night before Halloween. No one knows, nor want …s to find out, what will happen on October 31st 1978 besides Myers' psychiatrist, Dr. Loomis. He knows Michael is coming back to Haddonfield, but by the time the town realizes it, it'll be too late for many people. (Read More)
| Subgenre: | independent filmcult filmpsycho thrillerslasher flickteen movieteen horroramerican horrorholiday horror |
| Themes: | evilpsychopathmurderdeathfearcorruptionparanoiamurder of family |
| Mood: | slasherhigh schoolnight |
| Locations: | carsmall towncar theftkitchen knife |
| Characters: | terrorvillainserial killerhusband wife relationshipteenagerboyteenage girlteenage boyfemale protagonistgirllittle girlkillerlittle boypsychiatristdoctor patient relationship …slasher killerserial murderer (See All) |
| Period: | 1970s1960syear 1963year 1978 |
| Story: | homicidal maniacevil manpsychopathic killerbad guymadmanpsycho killernude woman murderedbody countmercilessnesswoman in jeopardymaniacmurdererstabbed to deaththroat slittingstrangulation …halloweenblood splatterknifetitle spoken by characterviolencefemale nuditynudityone word titledogguncigarette smokingsurprise endingshot to deathshot in the chestwatching tvfalling from heightmaskrunninglow budget filmmarijuananeighbortelevisiontelephonesubjective cameragood versus evilstabbingchildgunshotattempted murderprologuesuburbfirst of seriespay phonecharacter's point of view camera shothalloween costumelong takestalkingfirst parthandgunkillingpot smokingteen angstbulletelectronic music scorebabysitterlifting someone into the airmutilationstabbed in the stomachblockbusterpsychogrindhousedead womanmasked manwatching televisioncouchunderage drinkingburglarymanhunttvtitle at the enddead woman with eyes openkilling spreepumpkinphonemasked killerdead doggothserial murdermental patientyellingclosethiding in a closetkillhuman monstersuit and tiefence17 year oldcigaretteautumnwoman wearing only a man's shirtkiller childfamous scorebabysittingcarpentermasked villainknife murderknittingbutcher knifefemale victimsadistic psychopathoff screen murderwetnessmurder spreevillain not really dead clichegrindhouse filmescaped mental patientno endingpayphonelight bulbpsycho terrormidwestghost costumeweirdowoman smoking cigarettecreepysmall town sheriffmichael myerstrick or treattalking on phonedead teenagerheadstonemusic score composed by directorwoman strangled to deathfalling out a windowchild murders a childdemonicphone conversationcuttingboogeymandrive in classic21 year oldpumpkin carvinghorror movie remadelifting a male into the airwoman stabbedlaundry roomcarrying a dead bodyjumpsuitsmoking a cigarettesororicidepsycho filmescaped killerreturn to hometownindestructibilitysmashed pumpkinurban gothicautumn leavesknitting needleoctoberhouse of horrorsteenager in dangergiant pumpkinteenager murdered (See All) |
The People Under the Stairs is the story of a young boy (Fool) from the ghetto and takes place on his 13th birthday. In an attempted burglary (along with two others) of the home of his family's evil landlords, he becomes trapped inside their large suburban house and discovers the secret of the "chil …dren" that the insane brother and sister have been "rearing" under the stairs. (Read More)
| Subgenre: | survival horrorindependent filmcult filmblack comedydark comedypsycho thrilleramerican horror |
| Themes: | cannibalismevilsadismpsychopathkidnappingmurderdeathdeceptionincestinsanitymental illnesshome invasiongreedwealthstarvation …claustrophobia (See All) |
| Mood: | slashergoresatiredarknesssocial satire |
| Locations: | los angeles californiaslum |
| Characters: | terrorvillainpolicefather daughter relationshipmother daughter relationshipafrican americanbrother sister relationshipkiller dog |
| Period: | 1990s |
| Story: | homicidal maniacevil manpsychopathic killerbad guymadmanpsycho killerbody counttrappedragemaniacblood splattercorpseknifetitle spoken by characterviolence …blooddogcigarette smokingpistolshot to deathshot in the chestface slapshotgunbirthdayflashlightmansionimpalementhousechild abusechild in perilvanracial slurcharacter repeating someone else's dialoguesuburbelectrocutiondolldeath of childskeletonbasementcharacter says i love youcult directorterminal illnessfalling down stairsfireplacekilling an animalbreaking and enteringgothicscene during opening creditsmutilationstabbed in the stomachspiderpsychosevered handgrindhouseskullsadomasochismmasked manrampagesevered fingerstabbed in the throathit in the crotchcannibalchild protagonistdynamiteghettobooby trapatticperversionmurder of a childsouldead boycellarlasersightlandlordgothpervertserial murderhiding in a closetold dark houseschemeevictionhuman monsterlighterfemale psychopathclimbing through a windowslashinganimal abusebayonetslingshotpondfuneral homemurderessroofexploding housecrowbardeformitytrapdoorwhite dresswoman slaps a mansadistic psychopathmurder spreedisturbed individualgrindhouse filmstarvingdeeply disturbed personmissing girltarot cardchild with a gunfalling off a roofmoney falling through the airgold coinbitten handpsycho terrorfemale serial killershot through a wallsecret passagewayhidden doorrobbery gone awryrottweilersevered tonguesick motherhidden treasureanthropophaguschild murderessnameless characterfurnacedragging a dead bodysickoabused childbad girlpitbullmute childtenementmutilated bodyhung by wristsbreaking through a wallfire pokerbible belttrapped in a housecrawling through an air shafthit with a brickscared to deathstepping on someone's footeyes gougedhouse of horrorscrawl spacebondage equipmenthuman eaten by a dogscalding waterskull ring (See All) |
Serial Killer Michael Myers is not finished with Laurie Strode, and their rivalry finally comes to an end. But is this the last we see of Myers? Freddie Harris and Nora Winston are reality programmers at DangerTainment, and are planning to send a group of 6 thrill-seeking teenagers into the childhoo …d home of Myers. Cameras are placed all over the house and no one can get out of the house... and then Michael arrives home! (Read More)
| Subgenre: | independent filmcult filmslasher flickteen horroramerican horror |
| Themes: | evilpsychopathmurderdeathrevengefeardeceptionsurveillancemurder of a police officer |
| Mood: | slashergoresatire |
| Locations: | forestwoodskitchenwheelchairrooftopfire truck |
| Characters: | villainserial killerteenage girlteenage boynursekillersecurity guardpsychiatristslasher killercoroner |
| Period: | 2000s |
| Story: | homicidal maniacevil manpsychopathic killerbad guybody countchainsawmaniacmurdererstabbed in the backstabbed to deaththroat slittingaxestrangulationhalloweendecapitation …showdownblood splattercorpseknifefightviolencebloodfemale nuditysequelflashbacktwo word titlechasesurprise endingfirecell phonefistfightmirrorwatching tvcomputercameraundressingbrawlfalling from heightmaskf wordsubjective cameragood versus evilfoot chaseflashlightambulancemontageimpalementstabbed in the chestinternetsevered headpolice officer killednews reportelectrocutioncharacter's point of view camera shotproduct placementkicked in the facecollege studentlightningskeletondisappearanceneck breakingthreatened with a knifesevered armobscene finger gesturekillingheavy rainlifting someone into the airsecurity cameraloss of loved onemorgueskullfatebroken legmasked manmental institutionrampagestabbed in the throatstabbed in the headblack brae mailrainstormraised middle fingergasolineaxe murdercasual sexcharacters killed one by onesequel to cult favoritekilling spreemasked killernewspaper clippinghalloween partytext messaginginterrupted sexserial murdervideo surveillancereturning character killed offhiding in a closetold dark househuman monsterabandoned housewebcamclimbing through a windowwhodunithanging upside downlocked doorbreaking a windowjockbody baghanged manhead cut offfilmed killingmurder attemptbutcher knifeman on firesadistic psychopathlocked in a roombreaking through a doorpeep holestupid victimbreaking a mirrorx rayed skeletonsecret roomcrime spreeleg woundcamera focus on female buttimpersonatoreighth partmichael myersdead teenagerlifting a female into the airboogeymandeath by electrocutionskull crushingjumpsuitsee you in hellcult film referencedecomposed bodybutt grabserial teen killerclown maskpolice officer throat slitovernight in a haunted housereality tv productioneyes wide openwhite maskair hornreal movie shown in fictional situationcord (See All) |
On Elm Street, Nancy Thompson and a group of her friends (comprising Tina Gray, Rod Lane and Glen Lantz) are being tormented by a clawed killer in their dreams named Fred Krueger. Nancy must think quickly, as Fred tries to pick them off one by one. When he has you in your sleep, who is there to save … you? (Read More)
| Subgenre: | independent filmcult filmslasher flickteen movieteen horroramerican horrorindependent horror |
| Themes: | evilpsychopathmurderrevengesurrealismfuneralsupernatural power |
| Mood: | slashernightmaregorehigh schoolavant garde |
| Locations: | cemeterybathtubpolice station |
| Characters: | terrorvillainserial killerhusband wife relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipteenage girlkilleralcoholicpolice chaseself mutilationslasher killermysterious villain …serial murdererpolice lieutenant (See All) |
| Period: | 1980s |
| Story: | homicidal maniacevil mansatanicpsychopathic killerbad guymadmanbody countswitchbladevictimmaniacdeath of friendstrangulationslow motion sceneblood splattercorpse …bare chested maleviolencebloodcigarette smokingsurprise endingdreammirrorface slaparrestfalling from heightbeddemonjailclassroomtelephonesubjective cameragood versus evilfoot chasestabbed in the chesthousecoffeeperson on firefirst of seriescharacter's point of view camera shothangingstalkingdeath of sonpremarital sexcharacter says i love youfirst partreference to william shakespearecult directorstrong female characterfalling down stairsburned aliveelectronic music scoregothiclifting someone into the airhatcrucifixpsychogrindhousestrong female leadseriessevered fingerbutcherheadphonesbooby trapdisfigurementcharacters killed one by onecellaralarm clockserial murdervigilantismloud sexclimbing through a windowburnt face15 year olddripping bloodfinger cut offbody bagdeath of boyfriendgraphic violencemaggotopen endedclawreference to shakespeare's hamletpillowsadistic psychopathsledgehammerbreaking through a doorfamous linevillain not really dead clichebutcherygrindhouse filmplant in titlecreepglovetrail of bloodhit with a chairface ripped offpsycho terrorchild killerchild murdererdead teenagerdisturbinghanged boydemonicsevered facestreet in titleboiler roomremadeevil deaddrive in classicserial child killerbroken backfurnacehorror movie remadelucid dreamsleep deprivationburn scarshared dreamfreddy kruegernightmare becomes realitysleep overserial teen killerserial child murderbarred windowelm streetspringwood ohioreference to shakespeare's julius caesarserial child murdererunplugged electronic worksfemale stuck in sticky substancefalling asleep in classscar tissuecult male character (See All) |
In the year 2017, the world economy has collapsed. The great freedoms of the United States are no longer, as the once great nation has sealed off its borders and become a militarized police state, censoring all film, art, literature, and communications. Even so, a small resistance force led by two r …evolutionaries manages to fight the oppression. With full control over the media, the government attempts to quell the nation's yearning for freedom by broadcasting a number of game shows on which convicted criminals fight for their lives. The most popular and sadistic of these programs is "The Running Man," hosted by Damon Killian. When a peaceful protest of starving citizens gathers in Bakersfield, California, a police officer named Ben Richards is ordered to fire on the crowd, which he refuses to do. Subdued by the other officers, the attack is carried out, and Richards is framed for the murder of almost a hundred unarmed civilians. Following a daring jail break months later, Richards is captured once again and forced to appear on "The Running Man" with three other convicts. With their help, he fights his way through a cadre of sadistic gladiators hunting them down through the ruins of a Los Angeles earthquake, but not promising Killian that he'll return to settle the score when the show's host double-crosses him. In the meantime, the contestants must search through the ruins for the resistance in the hopes of finally broadcasting the truth about the government. (Read More)
| Subgenre: | martial artscult filmblack comedyconspiracyabsurdismdystopiacyberpunkfuture noir |
| Themes: | sadismbrutalitykidnappingdeathmurderfriendshiprevengebetrayalprisonescapeherodeceptioncorruptiongamblingsurveillance …exploitationcourageself sacrificepolice brutalitymurder of a police officerprison escape (See All) |
| Mood: | goresatirepoetic justice |
| Locations: | helicoptermotorcyclelos angeles californiaairport |
| Characters: | tough guypolicehostagewarrioraction herosecurity guardshooting a police officer |
| Period: | 1980sfuture2010s20th centurynear future |
| Story: | game of deathchainsaw murdermost dangerous gamegladiatorial sporthedonismgladiatorbettingfight to the deathdressing roomescape attemptpsychotronicmercilessnessgamechainsawtough girl …locker roomstabbed in the backold womanscantily clad femaledeath of friendthroat slittingmassacrestrangulationsurvivalshowdownblood splattercorpsetitle spoken by characterfightviolencebloodbased on novelcigarette smokingdancingexplosionchasethree word titlepistolshootoutshot to deathfistfightmachine gunshot in the chestrescuepunched in the facearrestgunfightbrawlfalling from heightheld at gunpointhand to hand combatlingeriecar crashtelevisioncombatshot in the backgood versus evilambushwomanimpalementprisonerexploding carfalse accusationanti heronews reportcoffeeon the runcharacter repeating someone else's dialoguekarateprotestelectrocutionfugitiverace against timecover upkicked in the faceopening action sceneactor shares first name with characterexploding bodyneck breakingmercenaryclass differencesriotsabotageathleterevelationhead buttelectronic music scorepropagandasecurity cameraexerciseexploding buildingmediafaked deathhonorcompassionsocial commentaryfemale warriorcamera shot of feetcensorshipjanitorprison guardbraveryresistancehit in the crotchmanhuntpunched in the stomachkicked in the crotchframe upexploding headwisecrack humorconvictcastrationgadgetflamethrowerburned to deathframed for murdergatling gunhockeymedia coveragecontractabandoned buildingbarbed wireoppressionlatinaex copfemale fighterhead blown offcomputer crackerflareurban decaycomputer hackerfilm starts with textreluctant herocorrupt policefight the systemsole black character dies clichefilmed killingfictional reality showwrongful imprisonmentresistance fighterknocked out with a gun buttsocial decaymiscarriage of justicegovernment conspiracymaterialismtotalitarianismice rinkwoman's neck brokenhelicopter pilotmercyfictional game showgovernment corruptionmedia manipulationescaped prisonerlifted by the throatsnorricampunched in the crotchhidden truthblack lingeriehawaiian shirtcaught in a netbased on the works of stephen kingresistance movementhockey stickpolice statejet packyear 2017game show hosttwentieth centuryagainst the oddsminiguntotalitarianautomationpirate broadcastingsexy costumevideo conferencinghispanic womanbody suitdisinformationrefusing to obey ordersbuzzsawnecklace bombyear 2019reference to mr. spockcorrupt governmentexplosive collarpirate televisionvoice activationwhite villain (See All) |
The graduating class of the local high school is going on a luxury cruise with Jason Voorhees as a stowaway. The heroine Rennie Wickham believes she was almost drowned by Jason as a child. Jason eventually sinks the boat and kills many of the students on it, but many of them escape to Manhattan. A l …ong battle with Jason ensues until Jason is washed away in the New York sewers by a midnight flooding of toxic waste. (Read More)
| Subgenre: | independent filmcult filmpsycho thrillerparanormal phenomenaslasher flickteen horroramerican horror |
| Themes: | evilpsychopathdeathmurderrevengemonstersupernatural powerdrug addictionmurder of a police officer |
| Mood: | slashergorerainhigh school |
| Locations: | new york cityboatwoodsseacityamericasewer |
| Characters: | terrorvillainserial killerteenage girlteenage boyzombiepolice officerkillerteacher student relationshipslasher killermysterious villainserial murderer |
| Period: | 1980s |
| Story: | homicidal maniacevil manpsychopathic killerbad guymadmanpsycho killerbody countslaughtermaniacstabbed to deaththroat slittingaxestrangulationdecapitationblood splatter …bare chested maleviolencebloodfemale nuditycharacter name in titlenumber in titlesequelexplosionpantiesmirrornumbered sequeldemonhallucinationguitarmanhattan new york cityflashlightgangnew yorkvideo camerastabbingimpalementsubwaywhite pantiesexploding carnecklacedrowningon the runblack pantieselectrocutioncharacter's point of view camera shotattempted rapeunderwaterundeadhypodermic needlelifting someone into the airmutilationpsychoback from the deadmasked manmale underwearrampagenew jerseybutcherblack bradead childdisembowelmentstabbed in the eyecharacters killed one by onesequel to cult favoritemasked killerserial murderbeheadingsummer campaccidental shootingstatue of liberty new york citycrushed headdisembodied headcruise shipmasked villainknife murdertoxic wastedeformitylunaticsadistic psychopathmetrooff screen murdermurder of a nude womanmurder spreemass murdererghoulbutcherybody paintblond boyeighth partpolice officer knocked unconsciouspsycho terrorstruck by lightningharpoondead teenagerhockey masklifting a female into the airtwin towerstrailer narrated by percy rodriguezlifeboatspear guneast coastjason voorheesmutilated bodyfriday the thirteenthkilled with a forkhit with a guitarwessex county new jerseycrystal lake new jerseyjerseyserial teen murdererbig applegirl strangling (See All) |
In "House of 1000 Corpses", two young couples take a misguided tour onto the back roads of America in search of a local legend known as Dr. Satan. Lost and stranded, they are set upon by a bizarre family of psychotics. Murder, cannibalism and satanic rituals are just a few of the 1000+ horrors that …await. (Read More)
| Subgenre: | independent filmcult filmdark comedyslasher flickcreature featuresadistic horror |
| Themes: | madnesscannibalismsadismtorturekidnappingmurderdeathsurrealismrapejealousyfearfuneralmonsterseductiontheft …death of fatherinsanitymental illnesstheatremurder of a police officer (See All) |
| Mood: | slashernightmaregorerain |
| Locations: | gas stationcemeterypolice carroad tripcavemuseumtunnelshedcave in |
| Characters: | serial killertattoofamily relationshipsfather son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipbrother sister relationshipthiefsheriffslasher killerpolice lieutenantevil doctor |
| Period: | 1970syear 1977 |
| Story: | killer clownevil mansatanicmadmanface paintnicknamemaniacstabbed to deathaxehalloweenslow motion sceneblood splattercorpseknifebare chested male …violencebloodnumber in titleflashbackdancingphotographchasesurprise endingpistolfirebeatingdreamdigit in titleshot to deathcar accidentshot in the headshotgunwatching tvthongmaskrifleheld at gunpointhallucinationrevolvershot in the backsubjective camerabound and gaggedstabbed in the chesthousetied to a chairmapsevered headman with glassescoffinritualgraveyardshot in the foreheadgravecharacter repeating someone else's dialogueperson on firecharacter's point of view camera shotactor playing multiple rolesmissing personlightningskeletonhanginghalloween costumelong takedisappearancecheerleadercrosssplit screenpigtied upcharacter says i love youthreatened with a knifecult directorpoemtv newsundergroundmass murdertape recorderlifting someone into the airtied to a bedcaptivewalkie talkiegiantphone boothflatulencepsychosevered handskullhome movierapistcommercialhitchhikercrushed to deathmasked mangas maskduct tape over mouthgash in the faceshot in the facenewsreel footagemental hospitalbody landing on a carknife throwingraised middle fingerlanterndead woman with eyes openpsychoticmannequintorso cut in halfhit with a baseball batintestinesburied aliveneedleshot in the neckold dark houseurban legendhuman monsterfreakmental retardationnight visionbillboardpsychedelicbody in a trunkdeputyauto mechanicdeath of boyfriendsleeping in a carburnt bodytow truckneck bracereference to john waynebreaking through a doorburn victimghoulevil clownpitattempted robberyjack o'lanternspotlightradio djdepravitycandlelightliquor storeknife in the chesthidden gunserial rapistno survivorstv hostcult figurehand cut offfemale serial killerreference to mickey mousetrick or treatsatanic ritualbreaking a car windowmusic score composed by directorscalpingsevered facemissing person posterbroken windshieldreference to charles mansonclown makeupdumb criminalhiding in a carclown facefried chickendrinking and drivingrabbit costumetourist attractionstocking capstraight edge razorfunhousevictim invited to dinnerreference to donald duckroadside attractionfetus in a jarmounted animal headreference to jayne mansfieldshooting out tirehead bracereference to nancy drewreference to ed geinreverse negativedunce cap (See All) |
The mercenary Royce; the military Isabelle; the Russian soldier Nikolai; the San Quentin criminal Stans; the Sierra Leone militia Mombasa; the drug lord Cuchillo; the Yakuza Hanzo; and the Doctor Edwin awake in free fall but they succeed to open their parachutes landing in a jungle. Soon they find t …hat they are on another planet and they are prey of aliens in a deadly hunting game, and they need to join forces to destroy their predators and survive. (Read More)
| Subgenre: | survival horrormartial artssuspense |
| Themes: | brutalitypsychopathkidnappingdeathmurderrevengesuicidebetrayalfearescapemonsterdeceptionparanoiaredemptioninsanity …panicself sacrificehuntingalien abduction (See All) |
| Mood: | gore |
| Locations: | forestwoodsouter spacejunglespace ship |
| Characters: | hitmantough guyserial killertattoodoctorsoldieralienhostagewarrioraction herokillerjapanesesniperrussiansniper rifle …ex soldierevil doctoralien monster (See All) |
| Story: | game of deathmost dangerous gameevil manpreypredatorfight to the deathmercilessnessswitchbladegametough girlstabbed to deathsurvivaldecapitationslow motion sceneblood splatter …corpseknifetitle spoken by characterbare chested malebloodviolenceone word titlesequelphotographexplosionchasesurprise endingpistolfireshootoutshot to deathmachine gunshot in the chestshot in the headshotgunrescuepunched in the facebattleswordgunfightfalling from heightvomitingheld at gunpointcriminalcombatshot in the backf wordsubjective camerafoot chaseassassinsword fightambushimpalementsevered headman with glassesno opening creditsanti heroone man armydouble crossspaceshipcreaturethird partcharacter repeating someone else's dialoguedangerelectrocutionpoisoncharacter's point of view camera shotkicked in the faceskeletonshot in the shoulderexploding bodytrapthreatened with a knifemercenarywaterfallsevered armsubtitled scenetrustbattlefieldstrong female characterak 47africanuzihand grenadekilling an animalhead buttmachetecagesurvivorlifting someone into the airhunterspacecraftnosebleedplanetskulllaseraction heroineanimal attackfemale warriorsevered fingerdual wieldstabbed in the throatpunched in the stomachshot in the facefalling to deathensemble castspecial forcesdark herobooby trapparachuteconvictyakuzaminedark pastfieldtragic herosevered legcharacters killed one by onelasersightmoral dilemmagatling gunprequeltorso cut in halffemale assassinfemale soldierinvisibilityextraterrestrialkatanaparalysiswhistlefalling into waterimaginary friendflarehanging upside downhuntscalpelcrash landingstabbed in the shoulderteamworkopen endedtragic pastalien planetmasked villainexploding shipone woman armyflare gundragging a bodydreadlocksanti heroinealien creaturehead ripped offmad doctoralien racetalking to oneselfbear trapwoman punching a manfalling off a cliffhuman versus alienreference to ernest hemingwaybody armorhand through chestblack opsbaitskinned aliveenforcerjungle warfaregreen bloodhuman preycontemplating suicideinfra redstabbed through the chestfalling down a hillminigunstabbed through the chinfilm with ambiguous titlecovered in mudelectro magnetic pulsefree fallhole in chestwarrior racemonster versus monstertoxinvoice imitationgrabbed by the throatleg blown offalien hunterinfrared visioninvisibility cloakshivfemale sniperdeath row inmateinvisible monsterstabbed through backhunting peopletied to a stakealien predatoralien weaponalien versus alienpoisonous plantprequel to sequelspine rippingfalling into a pithuman hunted down for sporthunted peoplesnare trapaircraft explosion (See All) |
Just when the streets seemed safe, a serial killer with a fetish for scalps is back and on the hunt. Frank is the withdrawn owner of a mannequin store, but his life changes when young artist Anna appears asking for his help with her new exhibition. As their friendship develops and Frank's obsession …escalates, it becomes clear that she has unleashed a long-repressed compulsion to stalk and kill. (Read More)
| Themes: | sadismbrutalitypsychopathtorturedeathmurderfearlonelinessobsessiondepressiondrug useinsanityunrequited lovephotographychildhood trauma …psychological trauma (See All) |
| Mood: | slashergoreneo noir |
| Locations: | restaurantlos angeles californiasex in public |
| Characters: | terrorvillainserial killertattoohomosexualmother son relationshipprostitutephotographermysterious villain |
| Period: | 1980s2010s |
| Story: | evil manpsychopathic killerbad guyvictimragemaniacstabbed in the backstabbed to deathstrangulationbathroomblood splattercorpseknifeviolenceblood …one word titlethreesomeflashbackfemale rear nudityphotographcell phoneurinationremakecomputercameravomitingcar crashneighborhallucinationvoyeursubjective camerafoot chasebound and gaggedwinecocainestabbed in the chestsubwaychild abusehit by a carbreast fondlingvannews reportlooking at the cameranecklacetalking to the cameracharacter repeating someone else's dialoguekicked in the facetragic eventstalkingthreatened with a knifesevered armdismembermentlooking at oneself in a mirrorscene during opening creditsmovie theaterart galleryschizophreniaapartment buildingrampagepillsrejectiondeath of protagonistdisembowelmentwedding dressdark pasttied feetnervous breakdownsevered legdead woman with eyes openmisogynymannequinwoman in bathtubserial murdervillain played by lead actorsuffocationconfusionstabbed in the handhiding in a closethuman monstersubway stationsexual perversionslashingbroken mirrorwoman in bra and pantiesballerinadripping bloodtattooed womanmeat cleaverextreme violencetied up while barefootknife murderfemale victimstrangled to deathschizophrenicbreaking through a doormurder of a nude womanmurder spreeonline datingdisturbed individualbreaking a mirrorarm ripped offexhibitiondrugstorestabbed in the mouthtalent agentremake of american filmstabbed in the sidegutsdead woman on bedreference to frankensteinwoman strangled to deaththrown through a windshieldscalpingsevered faceoedipus complexstabbed through the chinmigraineleg ripped offpharmaceuticalsachilles tendon cutbased on ed geinbridal gowninner monologuebug spraystabbing a womanreflection in a car mirrorhiding under a carmirror above bedlip piercingnasal spray (See All) |
Driving through the backwoods of Texas, five youths pick up a traumatized hitchhiker, who shoots herself in their van. Shaken by the suicide, the group seeks help from the locals, but their situation becomes even more surreal when they knock on the door of a remote homestead. It's quickly apparent t …he residents are a family of inbred psychopaths, and the unlucky youths suddenly find themselves running for their lives. In hot pursuit is a disfigured, chainsaw-wielding cannibal known as Leatherface. (Read More)
| Subgenre: | independent filmsadistic horror |
| Themes: | sadismbrutalitypsychopathtorturekidnappingdeathmurdersuicideinsanitypolice brutality |
| Mood: | slashergorehorror movie remake |
| Locations: | gas stationbarbathtubwheelchairpolice carroad trip |
| Characters: | serial killerpolicemother son relationshipboyfriend girlfriend relationshippolice officercrying babyevil sheriff |
| Period: | 1970s |
| Story: | chainsaw murderevil manbody countchainsawmaniaclocker roommassacreaxeblood splatterknifeviolencebloodsurprise endingvoice over narrationremake …shot in the headinterrogationpianotelephoneimpalementsevered headno opening creditshit by a carpolice officer killedpigbasementchickendirectorial debutsevered armobscene finger gesturecowdismembermentmoonfalling down stairspot smokingnipples visible through clothingheavy rainlifting someone into the airgroup of friendscowboy hatmutilationhomicidefull moonsevered fingerthrown through a windowdisfigurementalienationtank topmasked killernewspaper clippingbarbed wirecar troublecrucifixionhuman monstersexual perversionterritory name in titletrailer homehillbillymercy killingwhite trashmeat cleaversewing machineshot through the mouthwet t shirtmasked villainslaughterhousesole survivorsaltsevered footstupid victimtruckersevered eargas station attendantclothes linesmall town sheriffbodily dismembermentobese womanpinatasevered faceforensic evidenceanthropophagusone armed manremake of cult filmbody in trunkvolkswagen buslock pickmeat hookteeth knocked outhole in the wallhung from a hookrotten teethleatherfacebased on ed geinsevered nosechewing tobaccogroup of fiveharbinger of deathabandoned millmeat processing factoryobject made of body partobject made of human skintool in title (See All) |
A band straying into a secluded part of the Pacific Northwest stumbles onto a horrific act of violence. Because they are the only witnesses, they become the targets of a terrifying gang of skinheads who want to make sure all the evidence is eliminated.
| Subgenre: | survival horrorindependent filmsuspensepunk |
| Themes: | brutalitykidnappingdeathmurderfriendshiprevengebetrayalfearescapedeceptionracismtheftparanoiapanicnear death experience |
| Mood: | gore |
| Locations: | barrestaurantforestbicyclewoodsrural settingpolice carcampfire |
| Characters: | tough guytattoopoliceboyfriend girlfriend relationshipsingerpolicemanhostagewarriorjewishreference to godcousin cousin relationshipgermanblonde girlkiller dog |
| Period: | 2010s |
| Story: | swastikadressing roomescape attemptmercilessnessface painttrappedbaseball battough girlstabbed in the backstabbed to deathdeath of friendthroat slittingstrangulationsurvivalshowdown …written by directorslow motion sceneblood splattercorpseknifeviolencefightbloodinterviewdogtwo word titlecigarette smokingphotographsurprise endingpistolcell phoneshootoutshot to deathshot in the chestshot in the headshotgungunfightbrawlheld at gunpointbeercollegecolor in titlerevolvershot in the backf wordgay slurflashlightbandambushconcertdrug dealermontagedinerstabbed in the chestman with glassesno opening creditsdisarming someonedrawingvanshot in the legshot in the foreheadbartenderracial slurattempted murdermicrophonedangerrace against timecover upinjectionwitnessisolationpolicewomanstagedie hard scenariothreatened with a knifeheroinrecord playerhenchmantraitorrevelationhypodermic needlemachetetape recordersociopathmutilationguitariststabbed in the stomachdesperationcrying mananimal attackeaten alivefemale warriorthugpromisecrime scenepump action shotguntensionstealing a carcouchstabbed in the throatpower outagestabbed in the neckshot in the faceevacuationdrummerstabbed in the headcigarette lighterframe updisembowelmentaerial shotone daycellphonegasolinebroken armduct tapecharacters killed one by oneethnic slurposterdrumsfire extinguisherstabbed in the handgateshot in the neckremorseblackoutskinheadstandoffdisposing of a dead bodybunkertrailer homestabbed in the armneo naziself defensetape recordingcornfieldshot in the eyeelectric guitarman kills a womann wordwoman kills a manbleeding to deathmurder witnesssleeping in a caroregonbouncerfart jokemusic gigpool of bloodimprovised weapongang leaderanimal killingportland oregonclimbing out a windowreference to madonnavinylthroat rippingpunk musiccut armpacific northwestheld hostagegreen hairmohawk haircutradio hostreference to britney spearsconfederate flagshot in the kneewhite supremacistbar ownerstabbed in the foreheadbassistpep talk911 calldragging a dead bodymulletcleaverpitbullpunk bandbass guitarhuman shieldchoke holdbitten in the facebox cuttermeth labescalationmaulingrock clubbitten on the legkilled by a dogskating rinkreference to princereference to iggy popdrug labgas siphoningreference to simon and garfunkelreference to black sabbathbattle cryreference to ozzie osbournefalling asleep at the wheelgreen roomreference to odinreference to slayer (See All) |
Four tales of crime adapted from Frank Miller's popular comics, focusing around a muscular brute who's looking for the person responsible for the death of his beloved Goldie, a man fed up with Sin City's corrupt law enforcement who takes the law into his own hands after a horrible mistake, a cop who … risks his life to protect a girl from a deformed pedophile, and a hitman looking to make a little cash. (Read More)
| Subgenre: | cult filmtragedy |
| Themes: | cannibalismcrueltyevilsadismbrutalitypsychopathtorturedeathmurderrevengesuiciderapebetrayalescape …gangstercorruptionblackmailinsanityexecutionvengeanceself sacrificepolice brutalitypolice corruption (See All) |
| Mood: | gorerainneo noirvignettenightdarkness |
| Locations: | hospitalhelicoptersnowmotorcycleelevatorcitymotelstrip clubsewer |
| Characters: | hitmantough guyserial killerpoliceprostitutedetectivehostagekillerpolice detectiveolder man younger woman relationshipmysterious killer |
| Period: | 1980s1990swinter |
| Story: | cigar smokingevil manblack manpsychopathic killerpsycho killernude woman murdereddead manmercilessnessswitchbladetough girlscantily clad femalethroat slittingmassacreaxestrangulation …decapitationblood splatterknifetitle spoken by characterfemale frontal nuditysex sceneviolencebloodfemale nuditytwo word titlecigarette smokingexplosionsurprise endingpantiespistolshowertelephone callvoice over narrationcell phonewoman on topbeatingshot to deathcar accidentshot in the chesturinationface slaprescuepunched in the faceswordthongfalling from heightshootingcar crashhandcuffsrevolverstrippershot in the backgood versus evilcleavagegay slurflashlightassassinwomantied to a chairnonlinear timelinesevered headman with glassesanti heroone man armyhit by a carpolice officer killedfemme fataleanthologyshot in the foreheadconfessionorganized crimevirgindangerelectrocutionfirst of seriespay phoneninjakicked in the faceattempted rapehangingshot in the shouldersensualityconvertiblefishnet stockingsinjectiontragic eventdarkpremarital sextied upfirst partmercenarysevered armshot in the armsilencerwhippingvigilantecult directorsacrificedismembermentkillingcorrupt coptraitoruzihand grenadewolfgrenadestreetheroineheavy rainred dressmutilationjail cellmobstercrucifixloss of loved oneasian womansevered handirishblack humorrapistdead womanhomicideblack womaneaten alivethughookerreverse footagetensionsevered fingerkatana swordblood on facecannibaldark humorstabbed in the headensemble casthit on the headexploding headdark heroaerial shotsexy womanshadowperversionundercover copdisfigurementmustachesnowingstabbed in the eyecastrationbroken armpassionate kisstragic herosevered legdead woman with eyes opendeath of loved onesports carwilhelm screamreckless drivingpolitical corruptionframed for murdershot multiple timesfemale assassinactress playing multiple rolesreference to elvis presleynarrated by characterbeheadingmysterious manmultiple storylineg stringkatanaalleymolotov cocktailgang warshot in the neckbandagepistol whipscene before opening creditsexotic dancerspiral staircaseskinheadtemptationthong pantiesshot with an arrowamputeeinformantboy with glasseshospital bedhanging upside downshot in the eyebased on graphic novelamputationwrathidentical twinsnoosesubmachine gunhanged mancorrupt policenaked dead womanwoman in lingerietyrannosaurus rexdirector also cinematographerextreme violencemacabrecop killercadillacfacial scarwoman shotoverhead camera shotchild molesterinformermotorcycle copabusive boyfriendtwin sisterelectric chairoff screen murdershot in the crotchsilhouettesolitary confinementbludgeoninghatchetarm slingstraight razorfictional cityexpressionismserial rapistcityscapereading a lettersevered earlassorunning out of gasred light districtrainy nightshoot outthrowing starmercedesblack and white segues into colortalking headwoman smoking cigarettedirected by several directorsmusic score composed by directornarration from the graveblack & white to colorcaged humandead prostitutehitting a womanrotoscopinggang warfarefiendadaptation directed by original authorhanged by the neckreference to mother teresadriving in the rainkissing in publicmultiple narratorsvirtual setnude with a gunmanholecovered female frontal nuditywoman in pantiesdark horse comicscorrupt priestforced confessionmob enforcerhead in a toilettarhack sawstrip showbroken eyeglassesirish accentbiting someonehead in toiletstreet prostitutionhandcuffed togetherheart failurebreaking windowfemale whippinghearing characters thoughtsstopped by policeford thunderbirdtourniquetshot glassfragmentation grenademan refusing sexmisfiring guntraffic stopdoing the right thingevil preachertar piteaten by an animalcold showerear shot offthunderbirdjaguar e typecolor tinthand shot offhuman eaten by a dogcolor redinjection into one's neckrazor wireblood on screenlighting a cigarette from a cigarettenocturnal murdertalking corpse (See All) |
Jason Voorhees, having barely survived a wound to his shoulder from his own machete, is back to revenge on all that visit "his" woods. A new group of friends come over to party at an area close to the campsite. This time, Jason will be stronger than ever, and getting a hockey mask from one of those …friends. (Read More)
| Subgenre: | cult filmslasher flickamerican horror |
| Themes: | psychopathdeathmurderabductionexploitation |
| Mood: | slashergoredarkness |
| Locations: | lake |
| Characters: | terrorvillainserial killerteenagerboyfriend girlfriend relationshipteenage girlteenage boykillerslasher killerserial murdererlow self esteemmysterious killer |
| Period: | 1980s |
| Story: | homicidal maniacevil manpsychopathic killerbad guymadmanpsycho killerslaughterpsychotronicragewoundmaniacmurdereraxebloodsex …nuditynumber in titlesequelshowerdigit in titlebikinimasknumbered sequelsubjective cameraimpalementthird partcharacter's point of view camera shotcabinsevered armdismembermentsplattermass murdermachetelifting someone into the airbarnroman numeral in titlepsychosevered handgrindhousemasked manstupidityrampagenew jerseystabbed in the throat3 dimensionalconvenience storestabbed in the eyecharacters killed one by onesequel to cult favoritekilling spreemasked killertorso cut in halfserial murdercar troubledefecationhuman monstersexual violenceslashingshot in the eyehillbillyeyeballhammockextreme violencefamous scoremasked villainknittingpitchforksole survivordeformitysadistic psychopathpsychotronic filmbiker gangmurder spreemass murdererdisturbed individualgrindhouse filmcrime spreelifting female in airsliced in twopregnant woman murdered3 ddate in titledisturbinghockey maskgiallo esquesequel to cult filmyo yodrive in classicskull crushinggory violenceeast coastgruesomejason voorheesdorkfriday the thirteenthcult favoriteserial teen killerbrutalhead crushing3d sequel to 2d filmtrailer narrated by don lafontainewessex county new jerseycrystal lake new jerseykilled with machetesack maskpopcorn making (See All) |
When a Yakuza boss named Anjo disappears with 300 million yen, his chief henchman, a sadomasochistic man named Kakihara, and the rest of his mob goons go looking for him. After capturing and torturing a rival Yakuza member looking for answers, they soon realize they have the wrong man and begin look …ing for the man named Jijii who tipped them off in the first place. Soon enough Kakihara and his men encounter Ichi, a psychotic, sexually-repressed young man with amazing martial arts abilities and blades that come out of his shoes. One by one Ichi takes out members of the Yakuza and all the while Kakihara intensifies his pursuit of Ichi and Ichi's controller Jijii. What will happen as the final showdown happens between the tortured and ultra-violent Ichi and the pain-craving Kakihara? (Read More)
| Subgenre: | independent filmmartial artscult filmblack comedyart horror |
| Themes: | crueltysadismbrutalityangertorturedeathmurderrevengesurrealismsuicidedrugsrapegangstercorruptiondeath of father …mafiahumiliationexploitation (See All) |
| Mood: | gorenightdarkness |
| Locations: | bicyclecityrooftopbrothelrooftop fight |
| Characters: | hitmanfather son relationshipbrother brother relationshipprostitutebullypimpself mutilationsuicide by hangingblonde asianjapanese mafia |
| Story: | predator becomes preypredator turns victimcigar smokingevil manfinal showdownviolent deathchaindead manslaughterragemurdererbaseball batthroat slittingmassacredecapitation …showdownblood splatterknifeviolencebloodfemale nuditycharacter name in titlenumber in titlemale nudityflashbackmasturbationbondagetwo word titlegunnipplestelephone callcryingcell phonebeatingdigit in titleunderwearfoodfalling from heightmaskshootingvomitinginterrogationvoyeurcriminalkung fubisexualbedroomassassinbased on comic bookgangstabbingtied to a chairsevered headanti herohit by a cartonguecontroversyshot in the legpainorganized crimebeaten to deathcostumebased on mangakicked in the facescreamhanginglong takemanipulationtragic eventglassessevered armtwincult directordismembermentcorrupt copchild murdercrime bosssyringestreetmass murderdrugsexual abusemutilationmobstermobclubsadomasochismmind controlblack humordead womans&mapartment buildingkickingdark humorkicked in the crotchhypnosisstabbed in the headaquariumdisembowelmentgang rapefallperversionmurder of a childyakuzadead boypunchcrowmob bosstorso cut in halfpervertintestinesbisexualitymysterious manneedleex copbandagemusclemanrepressionsexual perversionmasochismdegradationpiercingsoupman punching a womankickbloody body of childrazor bladehanged manextreme violencemafia bossbladesexual repressionstabbed in the facecleaningjumpingcut into piecesfemale victimchainssevered footbroken necksexual humiliationhookhorror artsolidaritybitedepravityburningjumpshock humorarm ripped offcutbitingdutch anglesliced in twostabbed in the footburnsuspensionbitten handsexual sadismcriminal syndicatebodily dismembermentbroken fingerbanned filmsevered tonguedead prostitutesevered facegangster bossfalse memoryfiendentrailsshrimpmouthboy killeddenturesmisanthropytransgressionstabbed through the chinnumber 1 in titletransgressive filmtongue cut outextreme filmtasting bloodtongue piercingdecapitated childcinema extremewoman hatercredits rolling downneedlesasian mobsexual victimshinjukuchelsea smilepushing the envelopehung by a hookboiling oilface cut offart censorship (See All) |
Chucky hooks up with another murderous doll, the bridal gown-clad Tiffany, for a Route 66 murder spree with their unwitting hosts, two eloping high-school graduates.
| Subgenre: | cult filmblack comedyconspiracysupernatural |
| Themes: | sadismbrutalitypsychopathkidnappingmurderdeathloverevengesurrealismmarriagemoneybetrayalpregnancyfearescape …weddingdeceptionseductionrobberysupernatural powerparanoiaredemptionunrequited lovepanicpolice brutalitymurder of a police officerpolice corruptionnear death experienceregret (See All) |
| Mood: | slashergorecar chasepoetic justice |
| Locations: | hotelcemeterybathtubwaterkitchenpolice stationpolice carroad tripmotel |
| Characters: | priestserial killertattoohomosexualpoliceteenagerboyfriend girlfriend relationshipteenage girlteenage boypolice officerdetectivehostagethiefpolice detective …maidgay teenagerex boyfriend ex girlfriend relationshipuncle niece relationshipgay friendself referentialmurder of girlfriend (See All) |
| Period: | 1990s |
| Story: | homicidal maniacfinal showdownescape attemptlaughterwoman in jeopardynicknameragechainsawmaniacbaseball batlocker roomstabbed in the backthroat slittingstrangulationdead body …showdownslow motion sceneblood splattercorpseknifebare chested maleviolencebloodfightsexcharacter name in titlesequelgunkisscigarette smokingphotographchasesurprise endingpistolfirecryingcell phonebeatingshot to deathcar accidentmirrorshot in the chestrescuewatching tvbare buttletterheld at gunpointrock musiccar crashmarijuanahandcuffsrevolvertelephonef wordorphanflashlightambushmansionmontagebridgeimpalementstabbed in the chesttied to a chairexploding carfalse accusationdisarming someonecoffindrawinghit by a cardouble crossritualpolice officer killedvanfemme fatalegraveyardnews reportmarriage proposalon the runattempted murderargumentstalkercharacter repeating someone else's dialoguedangerscreamingelectrocutionpay phonefugitiveumbrellarace against timedollknocked outlightningskeletonringscarfishnet stockingsstalkingfilm within a filmchildbirthexploding bodypremarital sexratsuspiciontied upobscene finger gesturenewspaper headlinearsoncorrupt copprivate detectiveflirtingpot smokingsabotagefireplacehead buttgothicheavy rainsociopathscene during opening creditsmutilationtoyfourth partspiderphone boothskullbirthblack humormexican standofffemale killerback from the deadmale underwearpresumed deaddamsel in distresssevered fingernew jerseyblood on facemisunderstandingdual wieldgash in the faceresurrectionconvenience storedark humorshot in the facecigarette lighterframe upcon artistthrown through a windowbooby trapwisecrack humortitle at the endrainstormdisfigurementknife throwingraised middle fingertrailertied feetdead woman with eyes opensequel to cult favoritevoodooframed for murderprivate investigatorengagement ringclose up of eyesspellgothmarijuana jointabandoned buildingblood on camera lenssuffocationharassmenthysteriaface maskteenage lovescene before opening creditsabuse of powerpicturelighterpolice chieftelling someone to shut updisposing of a dead bodytrailer homeframedmasturbation referenceburnt facebody in a trunkhit by a truckcookietrailer parkmacguffinwoman kills a mandomestic abusecleaning ladyburnt bodycar set on firechapeldisfigured facehit with a shovelrepeated linemultiple murderamuletknife murderrecreational vehiclepillowhandymantongue in cheekpentagrammurder of a nude womanmass murdererstupid victimvillain not really dead clicheinnocent person killedproposalgrave diggingovenasphyxiationdecomposing bodyabusive relationshipevil dollnail polishfemale serial killernailwine bottlereference to frankensteinchange of heartdead parentshockey maskfragments of glassanti villainfemale thiefstabbed in the heartknife wounddeath of unclewaterbedplanting evidenceevil laughterfalse accusation of murderhandcuffed to a bedkiller dollairbagsoul transferencedumb policereference to martha stewartincantationlovers on the lamsee you in helltwo killersaccused of murdermultiple stabbingrunaway teensmothered with a pillowknife in backchief of policesmothered to deathwoman electrocutedexploding trailerfemale sociopathreference to jerry springerhunkbreaking a plateburnedtalking dollbig nosebiting handpiercing ripped outcleaning up bloodelectrocuted in bathtublegal guardianalpha maleelectrical firereference to bonnie and clydetight dressbreathalyzernose piercinghidden bodycriminal duoerieloss of unclemeatballspushed through a windowshot through the headbindsuitebiting an earelopingtreatcrayon drawinglip piercingreference to christian slatersinister coupleplanting drugswater bed (See All) |
It's been seventeen years since Leo Barnes (Frank Grillo) stopped himself from a regrettable act of revenge on Purge Night. Now serving as head of security for Senator Charlie Roan (Elizabeth Mitchell), his mission is to protect her in a run for president and survive the annual ritual that targets t …he poor and innocent. But when a betrayal forces them onto the streets of D.C. on the one night when no help is available, they must stay alive until dawn...or both be sacrificed for their sins against the state. (Read More)
| Subgenre: | survival horrormartial artsblack comedysuspenseconspiracydystopiapolitical conspiracy |
| Themes: | sadismbrutalitypsychopathkidnappingmurderdeathfriendshiprevengebetrayalpoliticsfearescapedeceptioncorruptionparanoia …insanitysurveillancehome invasionexploitationhopepaniccourageself sacrificenear death experiencemurder of family (See All) |
| Mood: | slashergorenight |
| Locations: | churchhelicopterairporturban settingtruckrooftoptunnel |
| Characters: | tough guypriesttattooafrican americanhostagewarrioraction herosniperrussiansniper rifleself mutilation |
| Period: | near future |
| Story: | evil manfinal showdownmercilessnesschainsawthreatbaseball batstabbed in the backstabbed to deathdeath of friendmassacreaxesurvivaldecapitationshowdownwritten by director …slow motion sceneblood splattercorpseknifebare chested malebloodviolencefightsequelflashbackphotographexplosionchasepistolfirecell phoneshootoutbeatingshot to deathfistfightmachine gunshot in the chestshot in the headshotgunrescuepunched in the faceswordgunfightbrawlrifleheld at gunpointbeerhand to hand combatbombcar crashrevolvercombatshot in the backf wordflashlightbound and gaggedgangambushambulancemontagemixed martial artspoliticianstabbed in the chestimmigranttied to a chairmapsevered headman with glassesno opening creditsanti herodisarming someoneone man armyhit by a carritualvanthird partnews reportshot in the legshot in the foreheadracial sluron the runflash forwardattempted murderdrug addictbinocularscharacter repeating someone else's dialoguedangercostumeprologueperson on fireelectrocutionfugitivemissionproduct placementrace against timeknocked outkicked in the facestreet shootoutshot in the shouldermanipulationamerican flagbodyguardexploding bodylaptoptrapelectionthreatened with a knifemercenaryshot in the armsilencerobscene finger gesturesacrificeclass differenceswashington d.c.ak 47hand grenadeburned aliveassassination attemptmass murdermacheterace relationstouristsociopathhelmetsecurity camerawalkie talkieoverallskicked in the stomachwristwatchpress conferencerebelcovered in bloodrebellionparking garagemexican standoffwhite housegun fuinterracial friendshippreachercrushed to deathsocial commentarymasked manmexicandamsel in distressshopliftingbraverycynicismministerresistancedual wieldstabbed in the throathatredhit in the crotchmanhuntchaosstabbed in the neckconvenience storeshot in the facestabbed in the headspecial forcessenatorpunched in the chestassault rifleghettobooby trapaerial shotknife fightblood on shirtcommandoschoolgirl uniformbulletproof vestbody landing on a carraised middle fingertied feetduct taperescue missionjuvenile delinquentethnic slurburned to deathmoral dilemmapolitical corruptiongatling gunmedia coveragebullet timetracking devicetext messagingshot through a windowhappy endingface maskreturning character killed offbrainwashingtasershot in the neckskinheaddronemilitiayoung version of characterstabbed in the armneo nazicommando unitparamedicanarchyhit by a truckwhistlingstreet fighthanged manbullet woundfight the systempresidential electioncathedralfilmed killingshot in the throatcommando raidstabbed in the facetragic pastdeath of familygarbage truckgang memberresistance fighterassassination plotsocial decayattempted robberyguillotinemaceslow motion action scenedetonatorwriting in bloodcrushed by a carbarricadeipodreference to george washingtonwashington monumentwhite supremacistmasked womanprotectorsouth africansecret tunnelfemale politicianhanged bodyritual sacrificependulumdelineo fascismbutterfly knifehit by a vanlincoln memorialemergency broadcast systemburning bodyhotwiringaid workerarrow through the headfemale senator (See All) |
| Subgenre: | survival horrorindependent filmcult filmblack comedysuspensefish out of waterslasher flickteen movieteen horrorpsychological thriller |
| Themes: | cannibalismbrutalitypsychopathtorturekidnappingdeathmurderfriendshiprevengefearescapeparanoiainsanityhome invasionpanic …couragehuntingmurder of a police officerwildernessnear death experience (See All) |
| Mood: | slashergore |
| Locations: | gas stationforestbathtubwoodspolice cartruckcave |
| Characters: | teenagerboyfriend girlfriend relationshipteenage girlteenage boypolice officerhostageinterracial relationshipself mutilationslasher killer |
| Period: | 2000s |
| Story: | body countmercilessnessredneckstabbed in the backstabbed to deathdeath of friendaxesurvivaldecapitationshowdownslow motion sceneblood splattercorpseknifeviolence …bloodsexcigarette smokingexplosionchasesurprise endingpistolfirecryingcell phonebeatingshot to deathcar accidentshot in the headshotgunrescuefalling from heightriflecar crashmarijuanacollegeshot in the backfoot chaseflashlightbound and gaggedambushmountaintoiletstabbed in the chestmapexploding carsevered headdisarming someonehit by a carpolice officer killedshot in the legtreestalkerdangerprologuescreamingperson on firefirst of seriesdollcollege studentscene during end creditsprankstalkingfirst partthreatened with a knifewaterfallsevered armnewspaper headlinedismembermentarsonpickup truckpot smokingbow and arrowmachetemutantgroup of friendstied to a bedjumping from heighttorchbroken legdamsel in distressstealing a carbraveryjob interviewcannibalpolice officer shotengagementbooby trapaerial shotblood on shirtone daydisfigurementgasolineaxe murdersevered legcharacters killed one by onearrowtank topsmokeflat tiresouthern accenthit with a baseball batbarbed wirecar troublemolotov cocktailjunkyarddead animalold dark househuman monstermental retardationarcheryshot in the eyedeputyhillbillycabin in the woodsroadblockoffscreen killingcdmedical studentdeath of boyfriendstabbed in the shouldertow truckarcherexploding houseslaughterhousepsychological tortureroadpool of bloodrock climbingstupid victimvillain not really dead clicheclimbing out a windowpolice officer shot in the headextreme close upleg woundsinistershot with a bow and arrowbear trapsevered eargas station attendantcar wrecksurprise during end creditsabandoned cardead teenagerwest virginiaham radiostate trooperclichelatin americanwatchtowerdragging a dead bodyhead cut in halfevil laughteraxe murdererdenturesinbreedingmountain mandeath trapdeath of fiancevictimizationamateur radiowoman wearing a tank toprolling down a hillradio towercell phone out of rangeno cell phone signalstabbed through the mouthgas tankpine forestreference to a white picket fenceboiling potwrong turntreating a woundranger tower (See All) |
A psychic who can read minds picks up the thoughts of a murderer in the audience and soon becomes a victim. An English pianist gets involved in solving the murders, but finds many of his avenues of inquiry cut off by new murders, and he begins to wonder how the murderer can track his movements so cl …osely. (Read More)
| Subgenre: | cult filmsuspenseparanormal phenomenaitalian horrorchristmas horrorpsychological horrorcult classic |
| Themes: | sadismbrutalitypsychopathangerdeathmurdersurrealisminfidelityrapechristmasghostjealousydrinkingdrunkennessfuneral …investigationcorruptiondeath of fatherparanoiablackmailinsanityillnesshome invasiontheatrepanicdyingtraumaclaustrophobiachristmas past (See All) |
| Mood: | slashergorenightdarkness |
| Locations: | hospitalbarrestaurantschoolcarcemeterybathtubbicyclewaterelevatorkitchenwheelchairaustraliapolice stationpolice car …cityitalytruck (See All) |
| Characters: | terrorvillainserial killerhomosexualfather son relationshippolicemother son relationshipfather daughter relationshipboyfriend girlfriend relationshipdoctorsingerboygirlpoliceman …musicianactresskillerpsychiatristmaidprofessorjewgermangay friendslasher killermysterious villainserial murdererself pity (See All) |
| Period: | 1970s |
| Story: | homicidal maniacpsychopathic killerbody countdead manslaughtermercilessnessvictimmaniacmurdererthreatstabbed in the backpuppetold womanstabbed to deathaxe …strangulationold mansurvivaldecapitationbathroomdead bodyblood splattercorpseknifebloodviolenceflashbacktwo word titlegunkisscigarette smokingphotographsingingchasesurprise endingtelephone callfiresongshootoutbeatingmirrorface slapwatching tvcameradrinksecretshootingpaintingbookvomitingrunningcafeneighborpianohallucinationcolor in titlerevolvertelevisiontelephonereportersubjective cameragay slurnewspaperbedroomflashlightjournalistbandstabbingimpalementdinerhousejokebrunettedrivingsevered headbirddrawinghit by a carsearchgraveyardnecklacedrowningpainattempted murderlibraryvirgindangerprologuescreamingprotestkeydollstatuechristmas treeskeletonhangingpianiststalkingwitnessdarkbasementtrapsuspicioncult directorpsychiceuropekillingarsonrecord playertv newsfireplacedesirebreaking and enteringstreetdressgothictape recorderrome italymagicianstabbed in the stomachtoyarchitectpsychologycomposerdesperationgrindhousedriving a carhomeviolindead womanfemale killerembarrassmentwatching televisionrampagewhiskeycrime scenecouchpaststabbed in the neckmutebroken glassmental hospitalbutchershoveltheatre audiencestairshit on the headenglishbutterflyfrustrationshadoweye gougingdisfigurementdark pastfemale reportergay stereotypeliving roomcharacters killed one by onedead woman with eyes openkilling spreevoodoolightplaying pianopsychotictelepathycrowclose up of eyesdead girldrumsserial murdermysterious manapparitiondark secretkillgloveslong hairhuman monstermen's bathroomtwist endingfencestaircasejazz musicskirtstreet markettelevision newslizardbitternessfemale psychopathslashingwhodunitblood staintheatre productiontape recordingburnt facemessagemind gamejacketgreenhousehit by a trucksaxophonefallingglassdisappointmentdripping bloodeyeballlocked doormeat cleavercrushed headfemale villainhallwaystabbed in the shouldertrumpetmurder witnessburnt bodyclueevil womanextreme violencefamous scoremacabrepsychic powerbourgeoisiegraphic violencedeskmenacemurderesssilencedead birdarm wrestlingbutcher knifedogfightgiallopool of bloodfemale victimsadistic psychopathpsychotronic filmhouse firehouse on firemurder spreeclose up of eyefingerprintsilhouettebutcherygrindhouse filmhatchetsecret roomcurtainlebanonwater fountainloss of controldead woman on floordeeply disturbed personmystery killerengineeringhidden roompick axepinball machinemistreatmentboomerangblack glovesextrasensory perceptionfemale serial killerchild's drawingexposed breastdisturbingraincoatsteamwife murders husbandfalling out a windowfragments of glassitalian cinemapiano teachertorturercrawlingblowing a kissdead woman on groundclairvoyancejazz bandvoodoo dolldrive in classichearing aidprogressive rockfigurinechildren's musicvideo nastywitness to murderreference to leonardo da vincibad girlcleavercognacmad womanmelting facegruesomenewsroomcarrying a dead bodysplit headfireplace pokertromboneskylightlocked upunknown killermutilated bodyattacked from behindknife in backforeignparapsychologycult favoriteproletarianleather glovesbrutalchildren's songpush buttonscene based on paintingstatuettecanary islandspiano duetwoman murders a womancradlesadistic killerhouse for salesit inanimate dollblack gloved killersweaty faceaxe in the backbloody knifedrawing on a wallhot waterknitting needlemusic conservatorypantingcomposingholding someone's head underwaterblackbirdoverflowing bathtubwater faucetflooded roomhit with a clubseeing father murderedslidingbashing someone's head into a wallbathroom sinkdragged by a truckmummified bodytearing a page from a bookgraveside ceremonyitalian flagwindow screenpsychology professor (See All) |
Groups of people - colonies - are forced underground due to another ice age. Colony 7 goes to check on Colony 5, which they lost contact with. When they get there they find that the colony has fallen and there is a whole new enemy that they have to face on their way back.
| Subgenre: | survival horrorindependent filmmartial artssuspensepost apocalypsedystopiacreature feature |
| Themes: | cannibalismsadismbrutalitydeathmurdersuicidebetrayalfearescapedeceptionnaturesurveillanceexecutionpaniccourage …self sacrificenear death experiencestarvation (See All) |
| Mood: | nightmaregoredarknesssavage |
| Locations: | helicoptersnowwaterfarmtunnel |
| Characters: | tough guyhusband wife relationshipboyfriend girlfriend relationshipteenage boyzombiehostagewarrioraction herointerracial relationshiplittle boysecurity guardengineerex soldier |
| Period: | futurewinternear future |
| Story: | final showdownfight to the deathmercilessnessblood spatterthreattough girlstabbed in the backstabbed to deaththroat slittingaxesurvivaldecapitationdead bodyshowdownwritten by director …slow motion sceneblood splattercorpseknifetitle spoken by characterbloodfightviolenceflashbacktwo word titlegunkissexplosionchasesurprise endingpistolfirevoice over narrationshootoutbeatingdreamshot to deathfistfightfoodshot in the chestshot in the headshotgunrescuepunched in the facebattlegunfightbrawlfalling from heightshootingrifleheld at gunpointhand to hand combathandcuffsrevolvercombatshot in the backf wordgood versus evilfoot chaseorphanflashlightambushbridgeimpalementmixed martial artsstabbed in the chestsevered headdream sequenceanti herodisarming someonecreaturesearchshot in the legshot in the foreheadattempted murderbeaten to deathdangerscreamingkeyfactorymissionrace against timerabbitshot in the shoulderpursuitexploding bodydeath of sonlaptopthreatened with a knifechickenprofanitydismembermentchessiceundergroundhead buttspearmachetesurvivormutantdiseasevirussecurity camerabeardmagazineexploding buildingkicked in the stomachladderbald maneaten alivefemale warriorculturereverse footagehaunted by the pasttensionexplosivebraverystabbed in the throatcannibalmanhuntpower outagestabbed in the neckmutehungerbutcherenvironmentalstabbed in the headcigarette lighterenvironmental issuestabbed in the legdynamiteinfectionknife fightdark pastlens flareaxe murderrescue missionglobal warmingweathermoral dilemmaclimate changeblood on camera lensporn magazinefemale fighterepidemicstrandedblood stainflaresicknesshead bashed incoughingman kills a womanoffscreen killingmeat cleaverleaderski maskmonitorstabbed in the shoulderbullet woundsole black character dies clichequarantinetragic pastintergenerational friendshippsychotronic filmbreaking through a doorcolonybutcherygogglestrenchcoatattempted robberygas explosionpower strugglehands tiedaxe fightcar wreckcloudsfrozen bodycollapsing buildingclimatebonesdark futuredisobeying ordersboiler roombeehivewater bottlecold the temperatureenvironmental disasterice agespear throwingoutpostbridge collapsehuman preyhead cut in halfair ventcorpse with eyes openhandcuffed to a bedshot in the eardismembered bodyfleshsearch and rescueweather manipulationunderground bunkersignalaxe in the chestsurviveabandoned cityexploding bridgetransmissionclimbing a ladderdistress signalhit with a metal pipecanadian science fictionseedscannibal cultpower generatoraxe in the backcollapsing bridgefrozen corpsegas tankopening creditscontrol towerice planetbarricading doordestroyed bridgefemale security guardliving undergroundsharpened teethventweather controldowned helicoptergenetic research (See All) |
While being transported by two detectives in a car, the dangerous criminal Krug is rescued by his brother Francis and his girlfriend Sadie, and they brutally kill the detectives. Meanwhile Emma, her husband John, and their daughter Mari Collingwood head to their summer home near the lake. Mari borro …ws the family car to meet her friend Paige that is working in a store in the town. While in the store, they befriend a teen boy named Justin, who offers some marijuana to Paige in the motel where he is lodged. While they are smoking marijuana in Justin's room, Krug, Francis, and Sadie arrive and abduct the girls. Krug drives Mari's car and she causes them to crash into a tree. Krug stabs Paige and rapes Mari; however Mari manages to escape, swimming in the lake, but Krug shoots her in the back. They walk through the isolated road in the woods and they reach Collingwood's house telling that they have just had a car accident. Emma and John welcome the strangers until they discover what has happened to their beloved daughter. (Read More)
| Subgenre: | american horror |
| Themes: | crueltysadismbrutalitypsychopathtorturekidnappingdeathmurderfriendshiprevengerapeguiltvengeancemurder of a police officer |
| Mood: | slashergorehorror movie remake |
| Locations: | forestboatwoodskitchenlakemotelstorm |
| Characters: | terrorserial killerhusband wife relationshipfather son relationshipfather daughter relationshipmother daughter relationshipdoctorbrother brother relationshipteenage girlhostagekillerserial murderer |
| Story: | homicidal maniacheld captivepsychopathic killermadmanpsycho killerfight to the deathwoman in jeopardyragemaniacmurdererstabbed in the backscantily clad femalestabbed to deathdeath of friendstrangulation …blood splattercorpsefemale frontal nuditybare chested maleviolencebloodfemale nudityfemale rear nuditychasepantiespistolshowercell phonebeatingcar accidentshot in the chestremakeshot in the headpunched in the facemaskheld at gunpointcar crashshot in the backswimmingcleavagefoot chasebound and gaggedwinestabbed in the chestwhite pantiesnecklaceon the runliarfugitiveknocked outkicked in the facedeath of brotherdeath of sonthreatened with a knifegirl in pantiesfalling down stairspot smokingfireplaceno pantiessociopathstabbed in the stomachcoitusrape victimrapistfemale killerstealing a carpunched in the stomachgunshot woundstabbed in the headexploding headjumping through a windowpanties pulled downperversionconvictrainstormabusive fathersexual assaultcopulationmarijuana jointgirl in bra and pantiesparalysisviolence against womenshot in the neckhead woundmisogynisthuman monsterremorsefemale friendshipsexual violence17 year oldescaped convictshot in the eyenihilismsummer vacationunderage smokingnaked dead womancountry housebroken nosegropingfemale criminalbutcher knifehit with a hammercoughing bloodfemale victimmurder of a nude womanbreaking a bottle over someone's headsexual humiliationknife held to throatdepravitymicrowave ovenserial rapistchild with a gunswimming in underwearsexual predatortortured to deathremake of american filmrunning for your lifeescaped prisonerfemale serial killerdelinquentrailroad crossingsexual crueltyhit with a rockhands tied behind backgirl stripped down to bramismatched bra and pantieshit on the head with a fire extinguisherseat beltstitchessummer houseboathousefire pokerfemale sociopathgarbage disposalguest housenihilistrunning out of ammoescaped killerclothes torn offremake of remakecauterizationbegging for liferapist comeuppanceprison escapeeshot through the eyesprayed with fire extinguisherremake of swedish film (See All) |
Andy Barclay has been placed in a foster home after the tragic events of the first film, since his mother was committed. In an attempt to save their reputation, the manufacturers of Chucky reconstruct the killer doll, to prove to the public that nothing was wrong with it in the first place. In doing … so, they also bring the soul of serial killer Charles Lee Ray back to life. As Chucky tries to locate Andy, the body count rises. Will Andy be able to escape, or will Chucky succeed in possessing his body? (Read More)
| Subgenre: | black comedysupernaturalpsycho thrilleramerican horror |
| Themes: | evilpsychopathdeathsupernatural power |
| Mood: | slashergoreraincar chase |
| Locations: | chicago illinoisschool buswater gun |
| Characters: | terrorvillainserial killerhusband wife relationshippoliceboyteacherkillerslasher killerserial murderernew student |
| Period: | 1990s |
| Story: | homicidal maniacevil manpsychopathic killerbad guymadmanpsycho killerbody countmaniacmurdererstabbed to deaththroat slittingstrangulationslow motion scenecorpseblood …sequelcigarette smokingsingingpunctuation in titledigit in titlecar accidentfalling from heightheld at gunpointsecond partapostrophe in titlefoot chasebound and gaggedambulancestabbed in the chesttied to a chairfalse accusationchild in perillimousinebeaten to deathelectrocutionpossessiondolllightningdeath of husbandbasementneck breakingthreatened with a knifeobscene finger gesturefalling down stairsburned alivegothiclifting someone into the airtied to a bedtoynosebleedpsychosevered handblack humorbutchershovelstabbed in the legexploding headthrown through a windoweye gougingswingraised middle fingerstabbed in the eyesocial workersevered legsequel to cult favoritevoodoopajamasframed for murdersuffocationhiding in a closetevil spiritclimbing through a windowelementary schoolhanging upside downburnt facehead bashed inactress shares first name with characteryuppiedripping bloodsewing machineorchestral music scorehiding under a bedbloody violencedigging a gravesadistic psychopathlocked in a roomvillain not really dead clichebutcheryliquor storetrail of bloodbedtime storyfire alarmevil dollfoster homepsycho terrormidwestthrown through a windshieldassembly linechantfoster parentlocked in a closetfalse accusation of murderfoster mothercar phonekiller dollgruesomefoster fatheraccused of murderdisbelieving adultpsycho filmreference to pinocchiohiding under the coverschild smoking a cigarettenewspaper manreference to hansel and gretelscore employs electronic instrumentstoy factoryfoster parentingsuffocated with plastic bagthrown down stairsevil smileelectric knifereflection in a car mirrorxeroxfoster sister (See All) |
| Subgenre: | martial artsblack comedysuspense |
| Themes: | brutalitydeathmurderrevengesuicidebetrayaljealousyfearescapegangsterdeceptionseductionparanoiamafiaexploitation …panic (See All) |
| Mood: | goreneo noircar chase |
| Locations: | new york citybarrestauranttrainhotelmotorcycleelevatoritalyrooftopcavetunnelfire truckcar motorcycle chaseblood in water |
| Characters: | hitmantough guyafrican americanbrother sister relationshippolice officerpolicemanwarrioraction herosniperrussianamerican abroadsniper rifleself mutilationhomeless manrussian mafia |
| Period: | 2010s |
| Story: | cigar smokingfinal showdownhired killerfight to the deathdressing roombody countescape attemptmercilessnesstough girlstabbed in the backstabbed to deaththroat slittingmassacrestrangulationsurvival …showdownslow motion sceneblood splattercorpseknifefemale frontal nudityviolencefightbloodcharacter name in titlenumber in titlesequelflashbackdogguncigarette smokingphotographexplosionpartychasesurprise endingpistolfirecell phoneshootoutdigit in titleshot to deathfistfightmachine guncar accidentmirrorshot in the chestshot in the headshotgunpunched in the faceundressinggunfightbrawlfalling from heightpaintingheld at gunpointhand to hand combatsecond partcar crashmanhattan new york cityshot in the backf wordfoot chaseassassinambushconcertmontagemixed martial artsstabbed in the chestsubwayno opening creditsanti herodisarming someoneone man armyassassinationhit by a cardouble crossshot in the legshot in the foreheadon the runattempted murderlimousineone against manyorganized crimecharacter repeating someone else's dialoguedangerprologuewidowerfugitiveproduct placementsuitcasecover upkicked in the faceopening action sceneshot in the shoulderlong takemanipulationbodyguardbasementneck breakingthreatened with a knifeshot in the armsilencerobscene finger gesturetypewritersubtitled scenearsonstylized violencehenchmancrime bossmachismoitalianfalling down stairsassassination attemptwarehouseheavy rainlooking at oneself in a mirrorrome italymobsterbeardkicked in the stomachpoolart galleryviolinhonorrocket launcherfemale killergun fufemale warriorthugstealing a cartarget practicedual wieldstabbed in the throatmanhuntstabbed in the neckmuteshot in the facestabbed in the headstabbed in the legpunched in the chestdark heroaerial shotknife fightblood on shirtbounty hunterbulletproof vestbody landing on a carraised middle fingerlonercastrationdark pasttragic herobruisesequel to cult favoriterpgsign languagecoingrenade launchermob bossvodkafemale assassinenglishman abroadshot through a windowblood on camera lenshandshakestabbed in the handshot in the neckcentral park manhattan new york cityspiral staircasesubway stationsubtitlessuit and tiearms dealerbrooklyn bridgesecret societystabbed in the armbullet balletman kills a womancrashing through a windowgun dueltimes square manhattan new york citycontract killermafia bossshot in the throatshot in the footopen endedrepeated linerooftragic pastwoman fights a manpool of bloodshooting rangetailorhouse on firefingerprintpencilassassination plotarmorybilingualismsecret roomthrown from a carred winecrime lordwoman's neck brokenhidden gunmedalliongold coincrushed by a carcoming out of retirementman fights a womanhotel managershot through a wallburning househidden doorromahomeless sheltershot in the kneestabbed in the crotchbirdcagehenchwomanchop shopneondragging a dead bodybourbongold barreference to the popeginslide locked backcosa nostrafemale bodyguardsororicideman with a ponytailprofessional assassinstabbed with a pencilstabbed in the earrunning out of ammohall of mirrorsfemale bounty hunterfemale crime bossmasculine womanhall of recordsrave musicgearing uployal dogugly womancobblestonecoliseumreference to applebee's (See All) |
In the Town of Derry, the local kids are disappearing one by one, leaving behind bloody remains. In a place known as 'The Barrens', a group of seven kids are united by their horrifying and strange encounters with an evil clown and their determination to kill It.
| Subgenre: | supernaturalamerican horror |
| Themes: | madnesscannibalismcrueltyevilsadismbrutalitypsychopathmurderdeathfearmonstermemoryracismsupernatural powerbullying …abductionhomophobiachildhoodmissing childunlikely friendshipschool bullyingsupernatural powers (See All) |
| Mood: | gore |
| Locations: | schoolforestsmall townbicyclesewernew boy in town |
| Characters: | villainserial killerpoliceteenagerchildrenzombiebullylittle boyjewchildhood friendbar mitzvahboy in underwearevil father |
| Period: | 1980ssummeryear 1989year 1988 |
| Story: | homicidal maniackiller clownpsychopathic killerbad guypsycho killerswitchblademaniacmurdererclownbathroomblood splattertitle spoken by characterviolencebloodbased on novel …one word titleflashbackkisscatbattlepaintingbookpianodemongay slurnewspaperchild abusechildcoffinchild in perilcreaturelibrarymissing persondeath of brotherbasementbrotherfirst partsevered armkillinggaragesplattersistereyeglassesballoonstreetsexual abusemutilationoverallspsychocovered in bloodinterracial friendshipeaten alivebraverystabbed in the throatbutcherpedophilemurder of a childturtleabusive fatherbroken armcellarkilling spreeloss of brotherheroismunderdogpervertspittinggirl in bra and pantiesoutcastwoodabandoned housebicyclingwellpharmacybare chested boypatricideparentraininggraphic violencejumping into watercleaningchild molesterfourth of julystutteringbloody violenceteenage girl in underwearpool of bloodreference to michael jacksonoverbearing mothersadistic psychopathold houseghoulglowing eyesevil clowncreepsidewalkdeeply disturbed personarm ripped offchild swearingchild killeddutch angleflickering lightscreaming in fearpocket knifechild killercamaraderiemonsterschild murdererdisturbinghypochondriachit with a rockmissing person posterscreaming in horrorsinkserial child killerfamily lifechild smoking cigaretteimplied incestadultererbitten in the facehell on earthinhalertraumatic childhoodviolence against a childeaster eggstorm drainslideshowdark killerheadless corpseleperplaster castreference to metallicaserial teen killerarm in a casthiding in a bathroomprojectortraumatic childhood experienceblood oathson kills fatherred balloonsadistic killerchildhood crushserial child murderevil creaturefear of clownscutting own hairmissing boystuttering characterthrowing stonesserial child murdererserial killerssexual child abuseslut shamingboy wearing glassesclosed doorreference to clark kentbullying victimfloating in the airpainting comes to lifecutting one's own hairdisappearance of a childflooded basementkilling a sheepreference to molly ringwaldthrown down a wellcutting the palm of one's handpaper boatreference to lois lanereference to new kids on the blockarm bitten offcarving into human fleshchild eaterchild rapistclown dollcursessheep farm (See All) |
In the green woods of Silver Falls, Oregon, Aaron Hallam, a trained assassin AWOL from the Special Forces, keeps his own brand of wildlife vigil. After Hallam brutally slew four deer hunters in the area, FBI Special Agent Abby Durrell turns to L.T. Bonham-- the one man who may be able to stop him. A …t first L.T. resists the mission. Snug in retirement, he's closed off to his past, the years he spent in the Special Forces training soldiers to become skilled killers. But when he realizes that these recent slaying is the work of a man he trained, he feels obligated to stop him. Accepting the assignment under the condition that he works alone, L.T. enters the woods, unarmed--plagued by memories of his best student and riddled with guilt for not responding to Aaron's tortured letters to him as he began to slip over the edge of sanity. Furious as he is with his former mentor for ignoring his pleas for help, Aaron knows that he and L.T. share a tragic bond that is unbreakable. And, even as they go into their final combat against each other, neither can say with certainty who is the hunted and who is the hunter. (Read More)
| Subgenre: | martial artssuspensepsycho thrilleramerican horror |
| Themes: | evilpsychopathdeathmurderescapelonelinesshunting |
| Mood: | slashernightmaregorecar chaseblood and gore |
| Locations: | barforesthelicoptersnowbicyclewoodssewer |
| Characters: | terrorvillaintough guyserial killerkillersniperex boyfriend ex girlfriend relationshipsniper riflepolice chaseex soldierolder man younger man relationshipslasher killerserial murderer |
| Period: | 1990s2000s |
| Story: | homicidal maniacevil manpsychopathic killerbad guymadmanpsycho killerbody countslaughtervictimmaniacmurdererdeath of friendthroat slittingmassacrestrangulation …showdownblood splattercorpseknifebloodviolenceflashbackchasepistolshootoutshot to deathfistfightmachine guncar accidentshot in the headcatgunfightbrawlfalling from heightvomitinghand to hand combathandcuffsrivercombatshot in the backf wordswimmingstabbingbridgeimpalementstabbed in the chestone man armypolice officer killedshot in the foreheadduelkaratefbifugitivecabinwaterfallsevered armobscene finger gesturedismembermentsubtitled scenekillingwolfmutilationstabbed in the stomachhunterswat teampsychohonorcrime scenehaunted by the pastu.s. armystabbed in the throatmanhuntbutcherpost traumatic stress disorderspecial forcesstabbed in the legbooby trapknife fightcommandocaptureknife throwingdark pastwar veteransevered legcharacters killed one by onekilling spreeserial murderfountainpostcardhuman monsterstabbed in the armslashingyugoslaviamilitary uniformsole black character dies clicheextreme violenceoregongraphic violencestabbed in the faceknife murdermilitary trainingbloody violencemass gravesadistic psychopathmurder spreeportland oregonsevered footdisturbed individualbutcheryhoodcrime spreedeeply disturbed personauto theftpsycho terrorjumping off a bridgebritish columbiapacific northwestdisturbingkosovobalkanbiblical quoteanimal trapgory violencetrackingsurvivalistbloody spraygruesomebasic trainingbody partsethnic cleansingpsycho filmdart gunskate parkbrutalnaturistrogue soldierwar buddyarrowheadyugoslavian army (See All) |
© 2023 FilmTagger.com
·
New Movies
·
About
·
RSS
·
Conditions
·
Privacy
FilmTagger.com