Best popular movies like Misery:

Do you need specific genre & keyword selection to find films similar to Misery?
<< FIND THEM HERE! >>

Misery (1990)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Misery (1990)

Best-selling novelist Paul Sheldon is on his way home from his Colorado hideaway after completing his latest book, when he crashes his car in a freak blizzard. Paul is critically injured, but is rescued by former nurse Annie Wilkes, Paul's "number one fan", who takes Paul back to her remote house in … the mountains (without bothering to tell anybody). Unfortunately for Paul, Annie is also a headcase. When she discovers that Paul has killed off the heroine in her favorite novels, her reaction leaves Paul shattered (literally)... (Read More)

Subgenre:
psycho thrilleramerican horrorsurvival horrorsuspense
Themes:
claustrophobiamurder of a police officermadnesswritingabductionevilsadismmental illnessinsanityobsessionpsychopathlonelinessangerinvestigationescape …torturekidnappingrevengedeathmurder (See All)
Mood:
darknessneo noir
Locations:
snow stormwheelchairwoodssmall townsnowhelicopter
Characters:
serial murdererbaby killermysterious killerslasher killerserial killershooting a police officerterrorvillainkillerhostagewriternurse
Story:
sadistic psychopathpsycho killerevil womanobsessed fanvictim invited to dinnermale victimvillainess played by lead actressserial child murdererchild murdererhomicidal maniacstruggling authorvillain not really dead clichefemale villainserial child killermad woman …female serial killerchild killerpsychopathic killerfemale killerfemale psychopathhomecare nurseattempted escapepsychological torturefight scenefemale emasculating a malebludgeoned to deathpicking lockgrande dame guignoldislocated shoulderromance novelistreference to liberaceceramicbased on the works of stephen kingbrutaldruggingpolice officer shot in the backmeltingbad girldark and stormy nightgruesomedrive in classicmarshalborderline personality disordersadistictorturerbloody violencebipolar disordercreepyweirdodeeply disturbed personmysterious strangertauntingscrapbookcreeppsychotronic filmbutcherysledgehammerreclusemurderessidolmatchbased on novelblizzardserial murderslashinghuman monsterold dark housenovelmurder of a childphysical abuseintimidationnewspaper clippingfight to the deathpsychoticdark pasthighwaymedicationbutcherfanthundertensionrampagebroken legvictimpsychodesperationpsychologyvillainesscaptivemutilationragesociopathmaniackillingobscene finger gesturetypewritermurdererbasementisolationpigcharacter's point of view camera shotattempted murderauthorduelsearchwomanstabbingsubjective cameracar crashslow motion scenerescueshotgunshot in the chestcar accidentshot to deathbeatingsurprise endingknifetitle spoken by characterone word titleviolencegunbloodfight (See All)

Kalifornia (1993)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Kalifornia (1993)

Brian Kessler, a journalist researching serial killers, and his photographer girlfriend Carrie set out on a cross-country tour of the sites of the killings. Sharing the ride and their expenses are Early Grayce, a paroled white trash criminal, and his girlfriend Adele. As the trip progresses, Early b …egins to appear more and more unstable, and Brian and Carrie begin to fear that they may have a real-life killer in the back seat of their car. (Read More)

Subgenre:
psycho thrilleramerican horrorindependent filmcult film
Themes:
murder of a police officerwritingevilsadisminsanitypsychopathtorturekidnappingdeathmurderrapetheftphotographyrape and murder
Mood:
neo noirgoreslasher
Locations:
helicopterbardesertroad tripmotelgas stationtexasroad moviesex in a car
Characters:
serial murdererslasher killershooting a police officerterrorvillainkillerhostagewriterpoliceboyfriend girlfriend relationshipwaitresschinese food
Story:
sadistic psychopathhomicidal maniacpsychopathic killerbrutalpolice officer shot in the backgruesomebloody violencecreepbutcheryserial murderhuman monsterphysical abusepsychoticbutchertension …rampagevictimpsychomutilationragemaniackillingmurderershotgunshot in the chestcar accidentshot to deathtitle spoken by characterone word titlegunviolencebloodfightsexfemale nuditynuditymale nuditymale rear nuditybare chested malecigarette smokingphotographpistolblood splatterurinationshot in the headbare buttbeerdead bodysex standing upgay slurjournalistcaliforniastabbed to deathnarrationjourneyblack pantiesstabbed in the backon the roadevil manautomobilearsontape recorderstabbed in the stomachrape victimrapistmale underwearredneckstabbed in the throatgash in the facedark humorblack brabilliardsperversionrainstormbody countsexual assaultkilling spreeblack bra and pantiespervertbad guymadmankillpistol whippolice officer shot in the chestsexual violenceknocked unconscioushillbillyyuppietrailer parkwhite trashcactusgraphic violencehit with a shovelintentionally misspelled titlecross countryabusive boyfriendlunaticmass murdererbreaking a bottle over someone's headcrime spreepittsburgh pennsylvaniasouthernpolicewoman killingserial rapistpsycho terrorexposed breastdisturbingparole officerfemale photographeryo yogory violencepolice officer shot through the heartmurder of a policewomandead policewomanpsycho filmheavy pettinghicksports brapolice officer shot in the leghair stylemale with earringserial rapepolicewoman shottwisted mind (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Friday The 13th Part 2 (1981)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th Part 2 (1981)

Months after Alice beheaded psycho killer/mother Pamela Voorhees at Camp Crystal Lake, survivor Alice is still traumatized because of the murders. But there is one problem. Mrs. Voorhee's son Jason never drowned and died.So he saw Alice behead Mrs. Voorhees. Jason finds Alice soon and murders her. F …ive years later a camp counselor in training program begins at Campanack Lodge. Right near Jason's home.Camp Crystal Lake. As teenagers in the program start snooping around Camp Crystal Lake, they start getting killed violently one by one. (Read More)

Subgenre:
psycho thrilleramerican horrorsuspensecult filmb horrorindependent horror
Themes:
evilinsanitypsychopathmurderdeathfearbrutalityexploitation
Mood:
darknessgoreslasher
Locations:
wheelchairwoodspolice carlakecampfirebackwoodsrunning through the woodschase in the woods
Characters:
serial murderermysterious killerslasher killerserial killerterrorvillainkillerteenagerboyfriend girlfriend relationshipmysterious villain
Period:
1980ssummeryear 1984
Story:
sadistic psychopathpsycho killerhomicidal maniacvillain not really dead clichepsychopathic killerbrutalgruesomedrive in classicsadistictorturerbloody violenceweirdocreeppsychotronic filmbutchery …serial murderslashinghuman monsterpsychoticbutcherrampagevictimpsychovillainessmutilationragemaniackillingobscene finger gesturemurderercharacter's point of view camera shotsubjective cameraslow motion scenesurprise endingfightviolencebloodsexfemale nuditynumber in titlesequelfemale frontal nudityflashbackkissnipplespantiestelephone callcorpsedigit in titleblood splatterblondecatbikinimasksecond partdead bodynumbered sequelswimmingdecapitationbrastrangulationmassacrethroat slittingimpalementjokesevered headcontroversyskinny dippingstalkerprologueevil manopening action sceneconvertiblestalkinglove interestkissing while having sexsplatterchesschainsawfireplacespearnipples visible through clothingmass murdergothicmachetelifting someone into the airphone boothgrindhousemasked manredneckbra and pantiesnew jerseyhit in the crotchpsychotronicstabbed in the headslaughterbetrefrigeratorbody countlens flarecharacters killed one by onekilling spreemasked killernude swimmingbad guycar troublemadmanmysterious manreturning character killed offsummer campfreakskirtsexual violencewetting pantshillbillyday in titletow truckparaplegicorchestral music scoremultiple murdermasked villainknife murderpitchforksole survivorlunaticmurder of a nude womanmurder spreedying during sexgrindhouse filmcrime spreekilled during sexmystery killershackmultiple homicidepsycho terrordisturbinglifting a female into the airtrailhanged boygiallo esquesequel to cult filmboogeymaneast coasthorror movie remadesickolost dogice pickcampfire storyjason voorheesdouble impalementbad jokefriday the thirteenthatonal music scoreurinating in fearmachete mutilationtea kettleviolenttrailer narrated by don lafontainegarrottingtoasting marshmallowssymphonic music scorewessex county new jerseycrystal lake new jerseychild psychologyfade to whitesack maskscare involving catserial teen murdererkilled by machetemenstrual cycledefy authorityfalse scarehand on shoulder scarelatex mask (See All)

Freddy's Dead: The Final Nightmare (1991)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Freddy's Dead: The Final Nightmare (1991)

In part six of the Nightmare on Elm Street series, dream monster Freddy Krueger has finally killed all the children of his hometown, and seeks to escape its confines to hunt fresh prey. To this end, he recruits the aid of his (previously unmentioned) daughter. However, she discovers the demonic orig …in of her father's powers and meets Dad head-on in a final showdown (originally presented in 3-D). (Read More)

Subgenre:
psycho thrilleramerican horrorindependent filmcult filmblack comedysupernaturaldark comedyparanormalindependent horror
Themes:
evilsadisminsanitypsychopathescapetorturemurderdeathsurrealismdrugsghostsupernatural powerdeath of motheramnesia
Mood:
darknessgorerainhigh schoolnightmareslasher
Locations:
small townairplaneroad trip
Characters:
serial murdererslasher killerserial killerterrorvillainkillerfamily relationshipsfather son relationshipfather daughter relationshipteenagerteacherself mutilationyounger version of characterdeafnessgerman american …evil father (See All)
Period:
1990s1970s1960s1940s1950s
Story:
sadistic psychopathpsycho killerserial child murdererchild murdererhomicidal maniacserial child killerchild killerpsychopathic killergruesomedrive in classicsadistictorturerbloody violencecreepycreep …butcheryserial murderhuman monstermurder of a childnewspaper clippingpsychoticdark pastbutcherrampagevictimpsychomutilationragemaniackillingmurderersubjective cameraslow motion scenerescueknifetitle spoken by characterviolencebloodf ratedcharacter name in titlesequelflashbackbare chested malefirepunctuation in titletitle directed by femaledreamblood splatterfalling from heightapostrophe in titledemoncriminalgood versus evilstrangulationimpalementstabbed in the chestboxingmapchild abusedrawingchild in perilshot in the legcharacter repeating someone else's dialoguebeaten to deathstatueevil manknocked outkicked in the facescene during end creditsexploding bodyundeadchild murderfalling down stairsburned alivekilling an animalhead buttgothicscene during opening creditssexual abusekicked in the stomachtherapistphone boothorphanagerapistback from the deadcameosevered fingercrossbowkicked in the crotch3dexploding headthrown through a windowparachuteslaughterdisfigurementknife throwingraised middle fingerabusive fatherbody countkilling spreeposterhit with a baseball batmarijuana jointvillain played by lead actorbad guymadmanstabbed in the handmolotov cocktailkillohiochild molestationevil spiritstonerburnt facecameo appearancekidnapperplaying a video gamefinger cut offchild kidnappingpunching bagsleeping in a carkiller childsixth partclawfamily mandeath of title characterlunaticmurder spreeanimal killinghusband murders wifefairghoulsleepwalkingshelterglovefalling through the floorchild killedpsycho terrormidwestbroken handrepressed memorywater towerman punches a womanadopted childdisturbingreference to friedrich nietzschehit by a busboiler roomsequel to cult filmabusive stepfatherboogeymanburnt handhearing aidhit with a frying pangreen bloodfear of heightsdream worldgory violencesleep deprivationfilm starts with quotethrown through a wallfalling down a hilldream within a dreamear bleedingshared dreamdisturbed childhoodfreddy kruegernightmare becomes reality3d glasseschoked to deathserial teen killerstabbed in the ear3d sequel to 2d filmtrailer narrated by don lafontainetroubled childhoodpipe bombanimal mutilationdaughter murders fatherflashback sequenceloud noiseserial child murderelm streetspringwood ohioabusive childhoodspikesreference to nintendoteenage murdererhit with a beltthrown from an airplanefingernails on chalkboardchild as murderer (See All)

High Tension (2003) is one of the best movies like Misery (1990)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

High Tension (2003)

Alexia travels with her friend Marie to spend a couple of days with her family in their farm in the country. They arrive late and they are welcomed by Alexia's father. Late in the night, a sadistic and sick killer breaks into the farmhouse, slaughters Alexia's family--including their dog--and kidnap …s Alexia. Marie hides from the criminal and tries to help the hysterical and frightened Alexia, chase the maniac, and disclose his identity in the end. (Read More)

Subgenre:
suspenseindependent filmb movieb horrorindependent horrorsadistic horrorpsychological horrorfrench horrorhorror b movie
Themes:
madnessevilsadisminsanitypsychopathtorturekidnappingdeathmurderfriendshipsurrealismrapefeardeath of fatherbrutality …death of motherunrequited lovehome invasionexploitationdeath of wifemurder of fathermurder of husbandmurder of mothermurder of brothermurder of son (See All)
Mood:
darknessgorenightmarecar chasenightslasherblood and gore
Locations:
woodshospitalforestbathtubrural settingroad tripfrancetruckgas stationsinging in a carbackwoodsback country
Characters:
serial murderermysterious killerslasher killerserial killerterrorvillainkillerfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipfriend …boybrother sister relationshipteenage girlfemale protagoniststudentbest friendfrenchbest friendsmysterious villaindeath of boy (See All)
Story:
sadistic psychopathpsycho killerevil womanhomicidal maniacfemale villainfemale serial killerpsychopathic killerfemale killerfemale psychopathbad girlsadisticbloody violenceweirdodeeply disturbed personcreep …butcherymurderessserial murderslashinghuman monstermurder of a childbutchertensionrampagepsychomutilationmaniackillingmurdererstabbingsubjective cameracar crashslow motion sceneshotguncar accidentsurprise endingknifeviolencebloodgunfemale nudityf ratedbare breastsfemale frontal nudityflashbackmasturbationdogcigarette smokingphotographlesbian kisschaseshowertelephone calldreamcorpseblood splattermirrorurinationshot in the headshootingriflesunglassesbeddead bodylow budget filmbathroomneighborvoyeurtelephoneshot in the backdecapitationsurvivalflashlightbound and gaggedaxemassacrethroat slittingimpalementstabbed in the chesthousesevered headscantily clad femalevanon the rundollevil mandeath of childdeath of brotherpursuitstalkingdeath of sondeath of husbandsleepingeuropeblood spattersplatterchild murderchainsawfireplacekilling an animalmass murderlistening to musicsurvivorstabbed in the stomachsevered handgrindhousestrangerrape victimfollowing someonerapistrednecksurveillance cameramobile phonegash in the facebroken glassmental hospitalplot twistperversionslaughterswingclassmatebody countaxe murdersexual assaultcharacters killed one by onekilling spreeparrotdead dogbeing followedpervertblood on camera lenssuffocationtaking a showerbarbed wirevideo surveillancebad guyearphonesmadmanclosetnecrophiliaminimal castkillkilling a dogfarmhouselistening to a radiocornfieldpiercinggreenhouserazor bladeurinalexamextreme violencemurder of wifefilling stationgraphic violencestabbed in the facecar radiohiding under a beddeath of familyfeetcut into pieceslesbian subtextbutcher knifefemale victimmurder spreevineyardchainsdriving at nightdisturbed individualgrindhouse filmbludgeoningwalkmanexploitation filmcrime spreestraight razorbloody body of a childserial rapistsexual predatorgas station attendantplastic bagcircular sawpadlockbreaking a car windowdoor bellmultiple personality disordergiallo esquepolice vanpsychiatric wardgory violencesickoaxe murdererpreyambient musicunreliable narratorfemale murdererjumpsuitshower curtainnecrophiliacvision of the futureaxe in the cheststabhead in a toiletstabbed with glasskeychainsex with the deadfrench shock cinemapierced belly buttonsadistic killersouthern francefemale victimsfrench cinemalesbian lead charactergas pumpslashed to deathearplugsrear ending a carpsychotic killerserial rapesolarisationfrench manserial killing (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Friday The 13th: The Final Chapter (1984)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th: The Final Chapter (1984)

Thought to be killed by the sole survivor of the last massacre at Camp Crystal Lake, Jason Voorhees kills his way back to the camp to once again murder its inhabitants. This time, has Jason met his match in the little boy Tommy Jarvis?

Subgenre:
psycho thrilleramerican horrorcult filmbody horrorindependent horrorsadistic horror
Themes:
evilsadisminsanitypsychopathtorturedeathmurderbrutalitysupernatural power
Mood:
goreslasherbreaking the fourth wallblood and gore
Locations:
hospitalsex in showersex in a bathroom
Characters:
serial murderermysterious killerslasher killerserial killerterrorvillainkillerbrother sister relationshipteenage girlteenage boymysterious villain
Period:
1980s
Story:
sadistic psychopathpsycho killerhomicidal maniacvillain not really dead clichepsychopathic killergruesomedrive in classictorturerbloody violencedeeply disturbed personbutcherymatchserial murderslashinghuman monster …butcherrampagepsychomutilationragemaniackillingobscene finger gesturemurderercharacter's point of view camera shotsubjective camerasurprise endingbloodviolencesexfemale nuditynumber in titlemale nuditybare breastssequelfemale frontal nuditymasturbationmale rear nudityfemale rear nuditypantiescorpseunderwearblood splattermasklow budget filmdecapitationstrangulationimpalementstabbed to deathsevered headchild in perillooking at the cameraskinny dippingstabbed in the backevil manstalkingpremarital sexcabinloss of mothersexual attractionlifting someone into the airmorguefourth partgrindhousetowelback from the deadmasked manrednecknew jerseyhit in the crotchstabbed in the neckstabbed in the headdisembowelmentslaughterdisfigurementbody landing on a carbody countcharacters killed one by onekilling spreemasked killerbad guycar troublemadmanmysterious manstabbed in the handkillsummer campshot in the eyehillbillymeat cleavernaked dead womanextreme violencegraphic violencestabbed in the facemasked villainknife murderdeformitylunaticmurder of a nude womanmurder spreedisturbed individualgrindhouse filmcrime spreepsycho terrordisturbinghockey masklifting a female into the airruralgiallo esquesequel to cult filmstabbedboogeymanskull crushinggory violenceeast coastjason voorheeshead shavingcorkscrewmutilated bodyfriday the thirteenthaxe in the chestmachete mutilationknife through the neckserial teen killertrailer narrated by don lafontainesadistic killerdeformedtwin actresses for twin sisterswessex county new jerseycrystal lake new jerseynose pushed into brainserial teen murdererslaughteredmurder in a shower (See All)

Friday The 13th (1980)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th (1980)

One summer at Camp Crystal Lake, a group of young counselors begin to get ready to lead campers. Unfortunately for the former, someone isn't happy about what's going on in the camp and enjoys playing kill the counselor. As bodies fall to the ground in the camp, no one is safe.

Subgenre:
psycho thrilleramerican horrorsuspenseindependent filmcult filmslasher flickteen moviemurder mysteryteen horror
Themes:
evilsadisminsanitypsychopathmurderdeathrevengefearvoyeurismcorruptionbrutalityhumiliationcrueltytraumamysterious death
Mood:
darknessgorenightslasherblood and gore
Locations:
woodscarmotorcycleboatwaterrural settingpolice carlaketruck
Characters:
serial murdererslasher killerserial killerterrorvillainkillerpoliceteenagerfriendteenage boypolice officerpolicemanartistmothersheriff …truck drivermysterious villain (See All)
Period:
1970s1950ssummer
Story:
sadistic psychopathpsycho killerevil womanvillainess played by lead actresshomicidal maniacvillain not really dead clichefemale villainfemale serial killerpsychopathic killerfemale psychopathbad girldark and stormy nightgruesomedrive in classicsadistic …bloody violenceweirdobutcherymurderessserial murderslashinghuman monsterphysical abusepsychoticbutcherrampagevictimpsychovillainessmaniackillingmurdererwomanstabbingsubjective cameraslow motion scenebeatingsurprise endingviolencesexfemale nuditynumber in titlemale nuditybare breastsmale rear nuditybare chested malekissfemale rear nuditynipplesthree word titlepantiescorpsedigit in titleblood splatterfistfightblondebikinithongbeerrunningdead bodylow budget filmmarijuanahallucinationvoyeurguitardecapitationbedroombracandleold manaxemassacrethroat slittingstabbed to deathdineraccidentsnakecultdream sequenceskinny dippingstrippingdangerprologuescreamingfirst of seriesmoaningdeath of childprankinjectionstalkingdeath of sonfirst partcabinkissing while having sexteenage sexfreeze framegirl in pantiesrevelationdesirenipples visible through clothingelectronic music scoredressjeepgothicheavy rainmachetehatstabbed in the stomachhammerswimsuitgrindhousedead womanfull moonbra and pantieslow budgetnew jerseystabbed in the throatobesitymercilessnesspower outagemutepsychotroniclostthunderstormbathingdisembowelmentsurpriseatticperversiondead manslaughterbody countlens flareaxe murderroomcharacters killed one by onekilling spreearrowdeath of loved onetank topt shirtjoysexual awakeningbeheadingcar troublemysterious manshortsdead animalsummer campcanoeadolescencerepressionsexual perversionrestroomjacketdying mandripping bloodrobeactual animal killedday in titlesummer vacationshirtmurder witnessextreme violencefamous scoreanthropologydisfigured facegraphic violenceorchestral music scoresexual repressionmenacemultiple murdergame playingbowboard gameknife murderpillowsole survivortraumatic experiencefemale victimwet clothesgrudgeoff screen murdermurder spreegrindhouse filmmurder victimcrime spreecurtaintroubled teenblond boybitingmystery killersweateraxe in the headmultiple homicidemistreatmentpsycho terrorawakeningdate in titledead teenagerdisturbinglost in the woodsraincoatobese womanblousegiallo esqueremademutilated corpsedeath by impalementeast coastaxe murderercamp counselorcampfire storyjason voorheesunknown killerbody mutilationfriday the thirteenthatonal music scoremachete mutilationmonopoly the board gamepsycho filmknife through the neckserial teen killercanoeingtrailer narrated by don lafontainekilled with an arrowfemale victimsstormy nightscore employs electronic instrumentsnaked bathingwoman taking off pantsemotionally disturbed personwessex county new jerseycrystal lake new jerseyjerseyelectrical generatorkilled with machetevoice impressionistquietcamp vacationunstable teenager (See All)

Henry: Portrait Of A Serial Killer (1986)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Henry: Portrait Of A Serial Killer (1986)

Loosely based on serial killer 'Henry Lee Lucas' (qv), the film follows Henry and his roommate Otis who Henry introduces to murdering randomly selected people. The killing spree depicted in the film starts after Otis' sister Becky comes to stay with them. The people they kill are strangers and in on …e particularly gruesome attack, kill all three members of a family during a home invasion. Henry lacks compassion in everything he does and isn't the kind to leave behind witnesses - of any kind. (Read More)

Subgenre:
psycho thrilleramerican horrorindependent filmcult filmindependent horror
Themes:
evilinsanitypsychopathtorturedeathmurderdrugsrapeincestbrutalityexploitationmurder of family
Mood:
goreslasher
Locations:
chicago illinois
Characters:
serial murdererslasher killerserial killerterrorvillainkillerbrother sister relationshipprostitutemysterious villainmurder of a prostitute
Period:
1980s
Story:
sadistic psychopathpsycho killerhomicidal maniacpsychopathic killergruesomesadisticcreepbutcheryserial murderslashinghuman monstermurder of a childbutcherrampagepsycho …mutilationragemaniackillingstabbingshot in the chestshot to deathsurprise endinggunviolencebloodfemale nuditycharacter name in titlenuditybare breastsblood splatterlow budget filmmarijuanacriminaldecapitationbisexualstrangulationvideo cameradrug dealerstabbed to deathstabbed in the chestchild abusesevered headcontroversypantyhosestalkerevil manattempted rapestalkingneck breakingdismembermentsplatterfemale stockinged legsstabbed in the stomachrapistlow budgetdark humorpsychotronicperversionslaughterstabbed in the eyeabusive fatherbody countkilling spreepervertvillain played by lead actorbad guymadmanmysterious mankillsexual violencenaked dead womanextreme violencevideo footagematricideknife murdercut into piecesoff screen murderchild rapemurder of a nude womanmurder spreebroken neckdisturbed individualgrindhouse filmexploitation filmcrime spreedead woman on floorwoman's neck brokenpsycho terrorbased on supposedly true storydead prostitutesickofemale hitchhikermurderer duotwo killersmutilated bodygraphic rapesex maniaclead actor's first filmdead woman on toiletdead woman wearing lingerie (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Freddy Vs. Jason (2003) is one of the best movies like Misery (1990)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Freddy Vs. Jason (2003)

It's been nearly ten years since Freddy Krueger terrorized people in the dreams, and the towns folk want to keep him erased from their memory. Freddy still has one more plan on getting back to Elm Street. He resurrects Jason Voorhees and sends him off to kill. The more bodies which fall to the groun …d, the stronger in which Freddy becomes. This is until, Freddy realizes that Jason isn't going to step aside easily, and must be taken down himself. (Read More)

Subgenre:
psycho thrilleramerican horrorsuspenseindependent filmcult filmsupernaturalparanormal phenomenaslasher flickcanadian horror
Themes:
abductionevilinsanitypsychopathtorturekidnappingmurderdeathrevengesuicideghostfeardrunkennessdeath of fatherbrutality …supernatural powerdeath of mothertraumafear of water (See All)
Mood:
gorerainhigh schoolnightmareslasherbreaking the fourth wallblood and gore
Locations:
small townforestcemeterypolice stationlakeschool nurse
Characters:
serial murdererslasher killerserial killerterrorvillainkillerfather son relationshipmother son relationshipfather daughter relationshipboyfriend girlfriend relationshipteenage girlteenage boyzombielittle girlsheriff …mysterious villain (See All)
Period:
2000s
Story:
sadistic psychopathpsycho killerserial child murdererchild murdererhomicidal maniacvillain not really dead clicheserial child killerchild killerpsychopathic killerbrutalgruesomesadistictorturerbloody violencepsychotronic film …butcheryserial murderslashingmurder of a childnewspaper clippingmedicationbutcherrampagevictimpsychomutilationragemaniackillingmurderercharacter's point of view camera shotstabbingcar crashslow motion scenesurprise endingbloodviolencecharacter name in titlesequelflashbackphotographexplosionpartypistolshowerfirevoice over narrationdreamcorpseblood splatterbrawlfalling from heightmaskdemondecapitationfoot chaseimpalementsevered headdream sequencechild in perilunderwater scenevandrowningskinny dippinglibrarycharacter repeating someone else's dialoguevirginprologueperson on fireelectrocutioncover upevil mandeath of childdeath of brotherhigh school studentstalkingneck breakingpremarital sexcabinsevered armdismembermentundeadsplatterchild murderburned aliveheroinemass murdermachetelifting someone into the aircomasevered handgoatcrushed to deathmasked mansevered fingernew jerseymisunderstandingpsychotronicalternate realityeye gougingslaughterbody countdemonic possessioncharacters killed one by onekilling spreegeekburned to deathmasked killertorso cut in halfblood on camera lensbad guybeheadingmadmanmysterious manfinal showdownnecrophiliakilldockohiosummer camplockerevil spiritsexual violencestonerdomineering motherflaskhanging upside downburnt facecornfielddeputywrist slittingkidnapperdripping bloodchild kidnappingravedeath of boyfriendcrossoverburnt bodypsychiatric hospitalgraphic violenceclawmasked villaindeformityfemale victimbreaking through a doormurder spreemass murdererghoulchild abductionescaped mental patientfedoracaterpillarglovearm ripped offchild killedsevered earsliced in twoeighth partpsycho terrormidwestobituaryhand through chestdead teenagerhockey maskdemonicboiler roommissing person posterburnt handpassed out drunkbroken backtranquilizergory violenceeast coastlucid dreamsataniccamp counselorjason voorheesdouble impalementhell on earththrown through a glass dooreleventh parttwo killersshared dreamdisbelieving adultfreddy kruegerfriday the thirteenthmonster versus monsternightmare becomes realityreanimated corpsemachete mutilationpsycho filmserial teen killertroubled childhoodreference to the three stoogesmutilated childsevered nosehead spinmonster as victimserial child murderelm streetslashed to deathspringwood ohioabusive childhoodwessex county new jerseycrystal lake new jerseyevil versus evilkilled with machetekiller vs killerdreams vs realityserial teen murdererkilled by machete (See All)

Jason Lives: Friday The 13th Part Vi (1986)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Jason Lives: Friday The 13th Part Vi (1986)

Tommy Jarvis returns to the graveyard to make sure Jason Voorhees is dead and accidentally brings him back to life. Now it's up to Tommy to stop Jason's mindless killing and put him back where he belongs.

Subgenre:
psycho thrilleramerican horrorcult filmsupernaturalparanormal phenomenaslasher flickteen horror
Themes:
murder of a police officerevilinsanitypsychopathmurderdeathprisonmonstersupernatural power
Mood:
darknessgorecar chaseslasherbreaking the fourth wall
Locations:
woodssmall townforestcemeteryboatlakeamerica
Characters:
serial murdererslasher killerserial killerterrorvillainkillerpoliceteenagerzombiesheriff
Period:
1980s
Story:
sadistic psychopathpsycho killerhomicidal maniacvillain not really dead clichepsychopathic killerbrutaldark and stormy nightdrive in classicbloody violencebutcheryserial murderslashingbutcherrampagevictim …psychomutilationmaniackillingmurdererstabbingsurprise endingviolencesexcharacter name in titlenumber in titlesequelflashbackblood splattermasknumbered sequeldemondecapitationflashlightmassacreambulancestabbed to deathsevered headchildlooking at the cameradrowningelectrocutionevil manstalkingneck breakingunderwatersevered armdismembermentundeadblood spattersplattermass murdergothicmachetelifting someone into the airback from the deadmasked mannew jerseyshovelstabbed in the headslaughterbody countsevered legsequel to cult favoritekilling spreebloodbathmasked killerbad guybeheadingmadmankillsummer campactual animal killedsixth partstabbed in the facemasked villainknife murderrecreational vehiclecut into piecesheart ripped outfemale victimoff screen murdermurder spreeghoulpaintballhead ripped offreturning character with different actorreanimationpsycho terrorstruck by lightningdead teenagerhockey masklifting a female into the airdemonicgrave robbinggory violenceeast coastunderwater fightjason voorheesdouble impalementmutilated bodyfriday the thirteenthstabcamaromachete mutilationpsycho filmviolentcomic drunkwessex county new jerseycrystal lake new jerseycut to piecespolice officer crushedstabbing a police officerserial teen murdererkilled by machete (See All)

Wolf Creek (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Wolf Creek (2005)

Three backpackers travel into the Australian Outback, only to find themselves stranded at Wolf Creek crater. Once there they are encountered by a bushman, Mick Taylor, who offers them a ride back to his place. Little do the three know that their adventure into the Outback, would be a complete nightm …are after the backpackers find a way to escape. (Read More)

Subgenre:
suspenseindependent filmcult filmslasher flickaustralian horrorsadistic horror
Themes:
abductionevilsadisminsanitypsychopathescapetorturekidnappingmurderdeathrapedrinkingfeardrunkennessbrutality …exploitationcruelty (See All)
Mood:
darknessgorecar chasenightslasherblood and gore
Locations:
helicopterbarbeachrestaurantswimming poolcarairplanedesertaustraliaroad triptruckcavegas stationcampfireroad movie …australian outbackcar on fireshed (See All)
Characters:
serial murderermysterious killerslasher killerserial killerterrorvillainkillerhostagehusband wife relationshipdoctorsingeraustralianself mutilationmysterious villain
Period:
year 1999
Story:
sadistic psychopathpsycho killermale victimhomicidal maniacvillain not really dead clichepsychopathic killerbrutalbloody violencedeeply disturbed persontauntingcreepbutcheryserial murderslashinghuman monster …butcherrampagevictimpsychodesperationcaptivemutilationmaniackillingobscene finger gesturemurdererisolationpigattempted murderstabbingslow motion sceneshotgunshot in the chestcar accidentshot to deathknifetitle spoken by charactergunviolenceblooddogtwo word titlekisscigarette smokingphotographexplosionsingingpartychasebased on true storysongcorpseblood splattermirrorurinationshot in the headdrinkvomitingrifleheld at gunpointsunglassesdead bodylow budget filmcafebathroomvoyeurguitarshot in the backf wordswimminggay slurflashlightbound and gaggedmassacrevideo cameraimpalementstabbed to deathfalse accusationcontroversyvanpainflash forwarddangerstabbed in the backprologueumbrellaon the roadstorytellingtentevil manattempted rapepursuitcountrysidetragic eventautomobilefirst partdismembermentufogaragepickup truckwolfwoundtouristscene during opening creditsloss of friendflatulencestrangerhome movierapisthomiciderednecksufferingsevered fingermercilessnessgunshot woundbroken glassfallblood on shirtperversionrainstormslaughtercapturecliffminetied feetbody countopening a doorsexual assaultcharacters killed one by onekilling spreebloodbathdrugged drinkreflectionpervertbad guybarking dogcar troublemadmanmysterious mancrucifixionparalysisjunkyardshot in the neckhead woundpostcardscene before opening creditsfirearmsydney australiastrandedhikingoutbackvery little dialoguefemale friendshipsexual violenceplaying guitarmind gamefilm starts with textnihilismepiloguesunrisefinger cut offsurfboardlying on bedauto mechanicstation wagoncar set on fireextreme violencemeteorcamcorderfilling stationgraphic violenceoverturning carbriton abroadcaravantied up while barefootknife murderwaking upsole survivorfemale victimkangaroocar rollovermurder spreemass murdererdriving at nightdisturbed individualgrindhouse filmexploitation filmsoutherncaptivityguard dogends with textcaged animalcamperserial rapisteclipsedecomposing bodyscreaming in feardesolationpsycho terrorwatching someoneoxygen maskbeing watchedwoman driverextreme closeupsolar eclipsespiked drinkabandoned minemobile homeburning carbackpackingmutilated corpsebackpackergory violencetrackingburpsickocratervolkswagen busbritish womancampfire storyrotting corpsehunting knifesavagerybroken down carhelplessnessvandalizing a carsex maniacviolentshooting a horsegas canhikerpit bullremote locationsadistic killersleeping on a beachemuregaining consciousnessbloody knifebuying a carslashed to deathgun sightunidentified flying objectbushmanpsychotic killerroad mapserial rapemining campused car lottire blow outsevered spinespree killerbegging to be killedboogie boardclimbing down a cliffmad dogstripped cardesert roadfriendly strangermurder by a knifeserial killingtorturerertowing (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Friday The 13th: A New Beginning (1985)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th: A New Beginning (1985)

Five years after killing the goalie hockey-masked killer Jason Voorhees, Tommy Jarvis has grown up in various mental hospitals unable to get over the nightmares about Jason's return. When Tommy is sent to a rural halfway house in New Jersey for mentally disturbed teenagers, a series of grisly murder …s begin anew as another hockey-masked killer begins killing off all people at and around the residence. Has Jason returned from the dead to re-start his killing spree? Has Tommy decided to take over the reign of Jason, or has someone else? (Read More)

Subgenre:
psycho thrilleramerican horrorindependent filmcult film
Themes:
evilsadisminsanitypsychopathdeathrevengemurderfearbrutalityexploitationpolice investigation
Mood:
darknessgorerainnightmarenightslasher
Locations:
woodssmall towncemeteryamericabackwoods
Characters:
serial murderermysterious killerslasher killerserial killerterrorvillainkillerpolicemother son relationshipteenagerbrother brother relationshipsheriffmysterious villaincountry boy
Period:
1980s
Story:
sadistic psychopathpsycho killermale victimhomicidal maniacpsychopathic killerdark and stormy nightdrive in classicbloody violenceweirdopsychotronic filmbutcheryserial murderslashinghuman monsterpsychotic …butcherrampagevictimpsychomutilationmaniackillingobscene finger gesturemurderercharacter's point of view camera shotsubjective camerasurprise endingbloodviolencesexfemale nuditynumber in titlebare breastssequelfemale frontal nuditykissdancingchasepantiesdigit in titleblood splatterdead bodylow budget filmnumbered sequeldecapitationsword fightaxemassacrethroat slittingimpalementchild in perilgravestalkerevil mandeath of brotherstalkingdeath of sonkissing while having sexchainsawmachetelifting someone into the airbarnstabbed in the stomachgrindhousemasked manmental institutionrednecknew jerseyitalian americanpsychotroniceye gougingslaughterstabbed in the eyebody countaxe murdercharacters killed one by onefifth partsequel to cult favoritemasked killerbad guycar troublemadmanmysterious manlaundrydefecationsummer campcomic relieftombstonehillbillyeyeballmeat cleavercrushed headextreme violencegraphic violenceorchestral music scorestabbed in the facemasked villainknife murdercut into piecesfemale victimlunaticmurder of a nude womanmurder spreedisturbed individualgrindhouse filmdeath of grandfathercrime spreereturning character with different actorstabbed with scissorsfatchopping woodaxe in the headmultiple homicidepsycho terrorsmall town sheriffbreakdancingdate in titlehockey masksequel to cult filmcandy barclotheslinegory violencesource musiceast coastgarden shearsjason voorheesimposterjumpsuitpopular musicfriday the thirteenthgrave robbermachete mutilationserial teen killercopycattrailer narrated by don lafontaineattempted child murderwessex county new jerseycrystal lake new jerseycopycat killervertigo shotserial teen murdererlifting a woman into the airspike in the head (See All)

Split (2016) is one of the best movies like Misery (1990)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Split (2016)

When three girls are kidnapped by a man with 23 different personalities, they have to work out which of those personalities will help them escape and which of those personalities will try to stop them.

Subgenre:
psycho thrilleramerican horrorsurvival horrorsuspenseblack comedysuperherotragedyteen horrorpsychological thriller
Themes:
mental illnessinsanitypsychopathescapekidnappingdeathmurderfriendshipsurrealismrapebetrayalfearfuneralmonsterdeception …voyeurismdeath of fatherbrutalityparanoiasurveillancepaniccannibalismhuntingcampingnear death experienceobsessive compulsive disorderself harm (See All)
Mood:
neo noirgoreslasher
Locations:
woodstrainforesttaxikitchenapartmentpolice cartaxi drivermuseumtunneltrain stationart museum
Characters:
serial murdererslasher killerserial killerterrorvillainkillerhostagefather daughter relationshipteenagerafrican americandoctorteenage girlpolice officersecurity guardpsychiatrist …uncle niece relationshippolice dog (See All)
Period:
2010s
Story:
sadistic psychopathpsycho killerhomicidal maniacpsychopathic killerbloody violenceweirdocreepserial murderhuman monsterdark pastrampagevictimpsychocaptiverage …sociopathmaniackillingmurdererbasementcharacter's point of view camera shotattempted murdersubjective camerarescueshotgunshot in the chestshot to deathsurprise endingknifetitle spoken by characterone word titlebloodviolencesequelflashbackdogbare chested maledancingpartychasepantiescell phonecorpsewatching tvcomputerwritten by directorpaintingrifleheld at gunpointsecond partbirthdayneighborvoyeurriversurvivalorphanbedroomflashlightambulancedeath of frienddinernonlinear timelinechild abuseman with glassesanimaldisarming someonedrawingdouble crossbirthday partynews reportold womannecklacetransformationtrainingstalkerdangermissing persontentevil manknocked outbaseball batflowersscarinjectiontragic eventhigh school studentstalkinglaptoploss of fathersuspicionrevelationhypodermic needleheavy rainlooking at oneself in a mirrorcageloss of friendsecurity camerawalkie talkiehuntercaucasiantherapisteccentricpart of trilogyrapistschizophreniainterracial friendshipcrushed to deatheaten alivegas maskpump action shotgunwoman in jeopardydamsel in distresscameohaunted by the paststealing a carcannibalmercilessnesspower outagezooshopping mallsuper villainescape attemptpedophilee mailcapturedeertigerphiladelphia pennsylvaniafemale doctorlonerbody countcharacters killed one by onekilling spreechloroformtorso cut in halfhit with a baseball batvillain played by lead actorbad guymental patientdirector cameopedophiliaforced to stripmental breakdownscene before opening creditsspiral staircasetwist endingchild molestationjournallockerhuman sacrificeworld dominationmegalomaniacyoung version of charactersuper powersbeastsplit personalitykidnapperpearl necklaceguardiansole black character dies clichemacabreopen endedsuperhuman strengthtragic pastchild molestersole survivorwhite brafemale victimschizophreniclocked in a roommolestationchild rapefade to blackdisturbed individualsinisterabusive motherboom boxvideo diarysexual predatorhit with a chairbritish actor playing american characterflower shopskypeconferencepower drillpsycho terrorpepper sprayflesh eatingdead teenagerdisturbingcaged humancrawlingkidnappedmultiple personality disorderman dressed as a womananthropophaguseast coastair venteating human fleshblood on mouthlispvirtualitydissociative identity disorderlocked in a cageclimbing up a walldrawingsstereodreadzookeeperdisturbed childhoodsuperhuman speedcrawlspacereference to skypebookshelfviolentvideo conferencingvideoconferencingcoat hangerfemale victimsvillain escapeswrist cuttinggauzeteleconferencingunder the bedchild rapist (See All)

Psycho (1960)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Psycho (1960)

Phoenix officeworker Marion Crane is fed up with the way life has treated her. She has to meet her lover Sam in lunch breaks and they cannot get married because Sam has to give most of his money away in alimony. One Friday Marion is trusted to bank $40,000 by her employer. Seeing the opportunity to  …take the money and start a new life, Marion leaves town and heads towards Sam's California store. Tired after the long drive and caught in a storm, she gets off the main highway and pulls into The Bates Motel. The motel is managed by a quiet young man called Norman who seems to be dominated by his mother. (Read More)

Subgenre:
psycho thrilleramerican horrorsuspenseindependent filmcult filmpsychological horror
Themes:
madnessmental illnessinsanitypsychopathdeathmurdermarriagemoneyfearfuneraldeceptionvoyeurismdivorcetheftguilt …datingunrequited love (See All)
Mood:
darknessrainslasherbreaking the fourth wall
Locations:
small townchurchhotelbathtubdesertrural settingpolice carmotelcar in water
Characters:
serial murdererslasher killerserial killerterrorvillainkillerfamily relationshipsmother son relationshipfriendpolicemansister sister relationshipthiefpsychiatristsecretarysheriff
Period:
1960syear 1960
Story:
sadistic psychopathpsycho killervictim invited to dinnerhomicidal maniacpsychopathic killerdrive in classicbloody violenceweirdodeeply disturbed personmysterious strangerbutcheryreclusebased on novelserial murderslashing …human monsterold dark housepsychotichighwaybutchervictimpsychomutilationmaniackillingmurdererbasementcharacter's point of view camera shotwomanstabbingsubjective camerasurprise endingone word titlebloodviolenceinterviewflashbackbare chested malephotographshowertelephone callvoice over narrationcorpseunderweararrestundressingsecretbathroomjailhallucinationvoyeurgood versus evilnewspaperbracaliforniadisguisewidowstabbed to deathtoiletstabbed in the chestbirdbathold womanstalkerwidowerfirst of seriesmistaken identitymissing personscreamlong takefemale removes her clothescountrysidewitnesstrapfirst partthreatened with a knifecross dressingprivate detectiveeyeglassesfemale stockinged legsfalling down stairsbreaking and enteringlooking at oneself in a mirrorfaintinglifting someone into the airblockbusterimpersonationphone boothgrindhouseskulldriving a carpeeping tomapartment buildingcamera shot of feetimpostorgash in the facedeath threatblack braswamparizonarainstormbody countextortionnervous breakdowncharacters killed one by onecellardead woman with eyes openmeetingdead motherphonefemale in showerbloodbathfemale stockinged feetimpotencevillain played by lead actorbad guymadmanmysterious mandirector cameofemale removes her dresstwist endingabandoned housestolen moneytemptationdisposing of a dead bodydomineering mothersplit personalityfoot closeuphearing voicesflyrole reversalmurder suspectnaked dead womansleeping in a carloss of sisterbra removingfamous scoreembezzlementoverhead camera shotrealtormatricideknife murderfemale victimmurder of a nude womanmurder spreesilhouettefade to blackpeep holedisturbed individualgrindhouse filmcrime spreeidentity crisiscurtainred herringworking outstairwelldead woman on floorenvelopehardware storesafe sextalking to oneselfwife leaves husbandbroken engagementthreat to killhidden moneyscreaming in fearphoenix arizonawoman in brapsycho terrorloss of girlfriendtaxidermylooking in a windowstabbed with a knifeneon signdisturbingfollowinglifting a female into the airlifting an adult into the airbad mothermissing womanremadescreaming in horrordragging a dead bodydriving in the rainfalse accusation of murderhorror movie remadeslip the undergarmentlicense plateseclusionlooking through a windowcarrying a dead bodydissociative identity disorderrotting corpseshower curtainnight drivinghighway patrolmutilated bodyalimonyjealous manmotel clerkfamous opening themehidden corpsemurder weaponoedipal complexpsycho filmcult favoriteirony of fatejealous womanbased on ed geinspurned womaninsanecleaning upposing as husband and wifestopped by policeslashed to deathmislaid trustfemale in brahouse of horrorsboothused car dealerbloody corpsemotel owneralone in housecovering a dead bodymurdered in a showerarizona desertfamous twistlistening to classical musicpsycho next doorbedridden mothersweeping floor (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The People Under The Stairs (1991)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The People Under The Stairs (1991)

The People Under the Stairs is the story of a young boy (Fool) from the ghetto and takes place on his 13th birthday. In an attempted burglary (along with two others) of the home of his family's evil landlords, he becomes trapped inside their large suburban house and discovers the secret of the "chil …dren" that the insane brother and sister have been "rearing" under the stairs. (Read More)

Subgenre:
psycho thrilleramerican horrorsurvival horrorindependent filmcult filmblack comedydark comedy
Themes:
claustrophobiaevilsadismmental illnessinsanitypsychopathkidnappingmurderdeathdeceptionincesthome invasiongreedcannibalismwealth …starvation (See All)
Mood:
darknessgoresatireslashersocial satire
Locations:
los angeles californiaslum
Characters:
terrorvillainpolicefather daughter relationshipmother daughter relationshipafrican americanbrother sister relationshipkiller dog
Period:
1990s
Story:
sadistic psychopathpsycho killerhomicidal maniacfemale serial killerpsychopathic killerfemale psychopathbad girldeeply disturbed personmurderessserial murderslashinghuman monsterold dark housemurder of a childrampage …psychomutilationragemaniacbasementshotgunshot in the chestshot to deathknifetitle spoken by characterviolenceblooddogcigarette smokingpistolcorpseblood splatterface slapbirthdayflashlightmansionimpalementhousechild abusechild in perilvanracial slurcharacter repeating someone else's dialoguesuburbelectrocutiondollevil mandeath of childskeletoncharacter says i love youcult directorterminal illnessfalling down stairsfireplacekilling an animalbreaking and enteringgothicscene during opening creditsstabbed in the stomachspidersevered handgrindhouseskullsadomasochismmasked mansevered fingerstabbed in the throathit in the crotchcannibalchild protagonistdynamiteghettobooby trapatticperversionsoulbody countdead boycellarlasersightlandlordgothpervertbad guymadmanhiding in a closetschemeevictionlighterclimbing through a windowanimal abusebayonetslingshotpondfuneral homeroofexploding housecrowbardeformitytrapdoorwhite dresswoman slaps a manmurder spreedisturbed individualgrindhouse filmstarvingmissing girltarot cardchild with a gunfalling off a roofmoney falling through the airgold coinbitten handpsycho terrorshot through a wallsecret passagewayhidden doorrobbery gone awryrottweilersevered tonguesick motherhidden treasureanthropophaguschild murderessnameless characterfurnacedragging a dead bodysickoabused childpitbullmute childtenementmutilated bodyhung by wristsbreaking through a wallfire pokerbible belttrapped in a housecrawling through an air shafthit with a brickscared to deathstepping on someone's footeyes gougedhouse of horrorscrawl spacebondage equipmenthuman eaten by a dogscalding waterskull ring (See All)

American Psycho (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

American Psycho (2000)

Patrick Bateman is handsome, well educated and intelligent. He is twenty-seven and living his own American dream. He works by day on Wall Street, earning a fortune to complement the one he was born with. At night he descends into madness, as he experiments with fear and violence.

Subgenre:
psycho thrilleramerican horrorsuspenseindependent filmcult filmblack comedypsychological thriller
Themes:
madnessevilmental illnessinsanitypsychopathangerinvestigationescapetorturemurderrevengedeathfriendshipinfidelitydrugs …rapechristmasmoneyjealousydrinkingfeardrunkennessweddingdeceptionmemorydivorcebrutalityparanoiablackmaildrug userivalryabuseexecutionbreak upgreedpaniccannibalismhomelessnessfashionwealth (See All)
Mood:
neo noirgoresatireslasherambiguous ending
Locations:
helicopternew york citybarrestaurantbathtubnightclubtaxiapartmentpolice caroffice
Characters:
serial murdererslasher killerserial killerterrorvillainkillerhomosexualpoliceboyfriend girlfriend relationshipprostitutepolice officerdetectivepolicemanlawyerlust …security guardsecretarycousin cousin relationshipamericanpolice shootoutpolice chasehomeless manjewish americanself narrationcheating on one's girlfriendsex with prostitutesex killer (See All)
Period:
1980schristmas party
Story:
sadistic psychopathpsycho killerhomicidal maniacpsychopathic killerbrutalgruesomeborderline personality disordersadisticbloody violencecreepydeeply disturbed personbutcherybased on novelserial murderslashing …human monsterbutchertensionrampagevictimpsychoragesociopathmaniackillingmurdererpigattempted murderwomanstabbingcar crashshot in the chestcar accidentshot to deathbeatingsurprise endingknifeviolencebloodgunfemale nudityf ratedmale nuditythreesomefemale frontal nuditymale frontal nuditymale rear nuditydogtwo word titlebare chested malesex scenekissfemale rear nudityfemale full frontal nuditycigarette smokingdancingnipplesphotographexplosionpartyleg spreadingchasepantiespistolshowerfirevoice over narrationfondlingcryingcell phoneshootouttitle directed by femalecorpseunderwearblood splatterfoodmirrorurinationblondeshot in the headwatching tvcatcameradrinkundressinggunfightsex in bedthongbare buttheld at gunpointsunglassesrunninglingeriebeddead bodyinterrogationvoyeurrevolvermanhattan new york citytelephonemenage a troisf worddecapitationcleavagefoot chasegay slurbrawinenew yorkstrangulationaxevideo cameraambulancemontageimpalementcocainestabbed to deathstabbed in the chestexploding carmodelsevered headscantily clad femaledrawingdouble crosscontroversypolice officer killedvoice overcigar smokingshot in the foreheadbartenderracial slurconfessionlimousineblack pantiesbusinessmanscreamingpay phonechampagnesex with shoes onmassagemistaken identitymissing personevil mankicked in the facechristmas treescreamshot in the shoulderfemale removes her clothesdatepremarital sexfirst parthandgunblood spattersplatterprivate detectivesurgerychainsawmachismoeyeglassescloseted homosexualpornographywaiteranswering machinefireplacerevelationmass murderlooking at oneself in a mirrortape recorderscene during opening creditslifting someone into the airvirusexercisewatching a moviebuttockseccentricgossipimpersonationphone boothcovered in bloodbrooklyn new york cityblack humorrapistschizophreniarealitymale underwearguardbarefootwoman in jeopardyremote controljanitorrear entry sextelescopecouchhatredfitnessimpostorcannibaldark humorheadphonesescape attemptlaughtersketchslaughterrefrigeratortuxedobody countduct tapeaxe murderbriefcasenervous breakdownalienationcharacters killed one by oneethnic slurkilling spreeworld trade center manhattan new york citysirendrugged drinkwoman in bathtubpervertvillain played by lead actorvideo tapefianceebad guyhysteriamadmanface masklaundrynotebookkilling a dogmisogynistmen's bathroomspiral staircasefemale removes her dresssnorting cocainejournalmini dresssexual perversionrestroomskyscrapermasseuselaundromatcall girlsplit personalitycredit cardbody in a trunknarcissismreference to donald trumpdance clubwoman in bra and pantiesnihilismyuppiedruggedbathrobebusiness cardoffscreen killingcdeastersense of smellbumpearl necklaceurinalcarnage80s musicsole black character dies clichevanityfur coatsushihomeless personreference to ronald reaganoverhead camera shotrealtorhobopool of bloodfemale bartenderfemale victimlunaticcocaine snortingceohedonismvice presidentanimal killingmass murdererdisturbed individualjerkwalkmaninnocent person killedsuspenderscrime spreehigh societyidentity crisismaterialismstairwellmartiniserial rapistcityscapekilled during sexbroken engagementcult figurecorporate executivenail gunwall street manhattan new york cityaxe in the headsex act reflected in mirroranswering machine messageruthlessnessbritish actor playing american characterautomated teller machinebottled watercompact discexercisingspiked drinkraincoatmisanthropeambiguitytwin towerscuisinemultiple personality disordervideotaped sexworld trade centerstockbrokerharvard universitynylonswashroomdissectionover the tophigh risedouble murderdragging a dead bodygory violenceeast coastsickolock of hairstreet walkeraxe murdererchauvinismmanicureunreliable narratorpornographic videotanning bedfirst lesbian experiencelasciviousnessmistletoemurder confessionbloodlustchainsaw murdermusic fansavagerywall streetsexual experimentationinvestment bankermurdered womanreservationsteroidlistening to music on headphonesvoice imitationyale universitydry cleaningemployee employee relationshiphacked to deathsex maniacbedsheetmergerreference to ted bundycheating on one's boyfriendoffice jobreference to mikhail gorbachevdecolletagestain27 year oldnarcissistic personality disorderparanoiacsadistic killeranti consumerismfemale victimsfrenzylithiumovercoatinner monologueslashed to deathstuffed toy animalxanaxreference to whitney houstoncouturefeet on deskreference to genesiswhite collarantisocial personality disorderblack nylon stockingsclothes hangerhiding evidencepet pigfalse alibikentucky derbysadistic sexsound systemreference to dorian graycorporate raiderdead body in bathroomreference to ed geinreference to phil collinswoman kicks a manchild of divorcechinese laundryhead in refrigeratorskin caresnorting coketruth taken as a jokecranberry juicepretend telephone callreference to elvis costellorope skippingcoasterharvard business schoolreference to ivana trump (See All)

Deep Red (1975) is one of the best movies like Misery (1990)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Deep Red (1975)

A psychic who can read minds picks up the thoughts of a murderer in the audience and soon becomes a victim. An English pianist gets involved in solving the murders, but finds many of his avenues of inquiry cut off by new murders, and he begins to wonder how the murderer can track his movements so cl …osely. (Read More)

Subgenre:
suspensecult filmparanormal phenomenaitalian horrorchristmas horrorpsychological horrorcult classic
Themes:
claustrophobiasadisminsanitypsychopathangerinvestigationdeathmurdersurrealisminfidelityrapechristmasghostjealousydrinking …drunkennessfuneralcorruptiondeath of fatherbrutalityparanoiablackmailillnesshome invasiontheatrepanicdyingtraumachristmas past (See All)
Mood:
darknessgorenightslasher
Locations:
wheelchairhospitalbarrestaurantschoolcarcemeterybathtubbicyclewaterelevatorkitchenaustraliapolice stationpolice car …cityitalytruck (See All)
Characters:
serial murdererslasher killerserial killerterrorvillainkillerhomosexualfather son relationshippolicemother son relationshipfather daughter relationshipboyfriend girlfriend relationshipdoctorsinger …boygirlpolicemanmusicianactresspsychiatristmaidprofessorjewgermangay friendmysterious villainself pity (See All)
Period:
1970s
Story:
sadistic psychopathevil womanhomicidal maniacfemale villainmad womanfemale serial killerpsychopathic killerfemale killerfemale psychopathbrutalbad girlgruesomedrive in classictorturerdeeply disturbed person …psychotronic filmbutcherymurderessserial murderslashinghuman monsterpsychoticdark pastbutcherrampagevictimdesperationpsychologymaniackillingmurdererbasementattempted murdersearchstabbingsubjective camerabeatingsurprise endingknifebloodviolencegunflashbacktwo word titlekisscigarette smokingphotographsingingchasetelephone callfiresongshootoutcorpseblood splattermirrorface slapwatching tvcameradrinksecretshootingpaintingbookvomitingrunningdead bodycafebathroomneighborpianohallucinationcolor in titlerevolvertelevisiontelephonereporterdecapitationsurvivalgay slurnewspaperbedroomflashlightjournalistbandold manstrangulationaxeimpalementstabbed to deathdinerhousejokebrunettedrivingsevered headbirddrawinghit by a cargraveyardold womannecklacedrowningpainlibraryvirgindangerstabbed in the backprologuescreamingpuppetprotestkeydollstatuechristmas treeskeletonhangingpianiststalkingthreatwitnessdarktrapsuspicioncult directorpsychiceuropearsonrecord playertv newsfireplacedesirebreaking and enteringstreetdressgothictape recorderrome italymagicianstabbed in the stomachtoyarchitectcomposergrindhousedriving a carhomeviolindead womanembarrassmentwatching televisionwhiskeycrime scenecouchpastmercilessnessstabbed in the neckmutebroken glassmental hospitalshoveltheatre audiencestairshit on the headenglishbutterflyfrustrationshadowdead maneye gougingslaughterdisfigurementbody countfemale reportergay stereotypeliving roomcharacters killed one by onedead woman with eyes openkilling spreevoodoolightplaying pianotelepathycrowclose up of eyesdead girldrumsmysterious manapparitiondark secretkillgloveslong hairmen's bathroomtwist endingfencestaircasejazz musicskirtstreet markettelevision newslizardbitternesswhodunitblood staintheatre productiontape recordingburnt facemessagemind gamejacketgreenhousehit by a trucksaxophonefallingglassdisappointmentdripping bloodeyeballlocked doormeat cleavercrushed headhallwaystabbed in the shouldertrumpetmurder witnessburnt bodyclueextreme violencefamous scoremacabrepsychic powerbourgeoisiegraphic violencedeskmenacesilencedead birdarm wrestlingbutcher knifedogfightgiallopool of bloodfemale victimhouse firehouse on firemurder spreeclose up of eyefingerprintsilhouettegrindhouse filmhatchetsecret roomcurtainlebanonwater fountainloss of controldead woman on floormystery killerengineeringhidden roompick axepinball machinemistreatmentboomerangblack glovesextrasensory perceptionchild's drawingexposed breastdisturbingraincoatsteamwife murders husbandfalling out a windowfragments of glassitalian cinemapiano teachercrawlingblowing a kissdead woman on groundclairvoyancejazz bandvoodoo dollhearing aidprogressive rockfigurinechildren's musicvideo nastywitness to murderreference to leonardo da vincicleavercognacmelting facenewsroomcarrying a dead bodysplit headfireplace pokertromboneskylightlocked upunknown killermutilated bodyattacked from behindknife in backforeignparapsychologycult favoriteproletarianleather gloveschildren's songpush buttonscene based on paintingstatuettecanary islandspiano duetwoman murders a womancradlesadistic killerhouse for salesit inanimate dollblack gloved killersweaty faceaxe in the backbloody knifedrawing on a wallhot waterknitting needlemusic conservatorypantingcomposingholding someone's head underwaterblackbirdoverflowing bathtubwater faucetflooded roomhit with a clubseeing father murderedslidingbashing someone's head into a wallbathroom sinkdragged by a truckmummified bodytearing a page from a bookgraveside ceremonyitalian flagwindow screenpsychology professor (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Friday The 13th Part III (1982)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th Part III (1982)

Jason Voorhees, having barely survived a wound to his shoulder from his own machete, is back to revenge on all that visit "his" woods. A new group of friends come over to party at an area close to the campsite. This time, Jason will be stronger than ever, and getting a hockey mask from one of those  …friends. (Read More)

Subgenre:
american horrorcult filmslasher flick
Themes:
abductionpsychopathmurderrevengedeathexploitation
Mood:
darknessgoreslasher
Locations:
woodslake
Characters:
serial murderermysterious killerslasher killerserial killerterrorvillainkillerteenagerboyfriend girlfriend relationshipteenage girlteenage boylow self esteem
Period:
1980s
Story:
sadistic psychopathpsycho killerhomicidal maniacpsychopathic killerbrutalgruesomedrive in classicpsychotronic filmserial murderslashinghuman monsterrampagepsychoragemaniac …murderercharacter's point of view camera shotsubjective camerabloodsexnuditynumber in titlesequelshowerdigit in titlebikinimasknumbered sequelaxeimpalementthird partevil mancabinsevered armdismembermentsplattermass murdermachetelifting someone into the airbarnroman numeral in titlesevered handgrindhousemasked manstupiditynew jerseystabbed in the throat3 dimensionalconvenience storepsychotronicslaughterstabbed in the eyecharacters killed one by onesequel to cult favoritekilling spreemasked killertorso cut in halfbad guycar troublemadmandefecationsexual violenceshot in the eyehillbillyeyeballhammockextreme violencefamous scoremasked villainknittingpitchforksole survivordeformitybiker gangmurder spreemass murdererdisturbed individualgrindhouse filmcrime spreelifting female in airsliced in twopregnant woman murdered3 ddate in titledisturbinghockey maskgiallo esquesequel to cult filmyo yoskull crushinggory violenceeast coastjason voorheesdorkfriday the thirteenthcult favoriteserial teen killerhead crushing3d sequel to 2d filmtrailer narrated by don lafontainewessex county new jerseycrystal lake new jerseykilled with machetesack maskpopcorn making (See All)

A Nightmare On Elm Street 5: The Dream Child (1989)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street 5: The Dream Child (1989)

Alice, having survived the previous installment of the Nightmare series, finds the deadly dreams of Freddy Krueger starting once again. This time, the taunting murderer is striking through the sleeping mind of Alice's unborn child. His intention is to be "born again" into the real world. The only on …e who can stop Freddy is his dead mother, but can Alice free her spirit in time to save her own son? (Read More)

Subgenre:
american horrorindependent filmcult filmsuperherosupernaturalparanormalstop motion animationslasher flickbody horrorurban fantasy
Themes:
evilsadisminsanitypsychopathinvestigationdeathmurderfriendshiprapeghostpregnancyfearmonsterbrutalitysupernatural power …depressiontrauma (See All)
Mood:
gorenightmareslasher
Locations:
hospitalchurchswimming poolcarmotorcyclewatercar on firedeath in a car accident
Characters:
serial murdererslasher killerserial killerterrorvillainkillernursefather son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipafrican americanfriendboyfriend girlfriend relationship …doctorboyfemale protagonistgirlbabyartistreference to godlittle girlsingle motherwaitresslittle boyalcoholicfathercrying babyalcoholic fatherpregnant from rapemysterious girlcomic book characterbaby monster (See All)
Period:
1980s1940s
Story:
sadistic psychopathpsycho killervictim invited to dinnerserial child murdererchild murdererhomicidal maniacserial child killerchild killerpsychopathic killerbrutalgruesomedrive in classicsadisticbloody violencetaunting …psychotronic filmserial murderslashingmurder of a childnewspaper clippingpsychoticdark pasttensionrampagevictimmutilationmaniackillingmurdererstabbingcar crashslow motion scenecar accidentsurprise endingknifebloodgunviolencesexfemale nudityf ratednuditybare breastssequelflashbackbare chested malefemale rear nudityphotographpartychasepistolshowertelephone calltopless female nuditycryingdreamblood splatterfoodwatching tvbare buttfalling from heightshootingplace name in titlebeddemonhallucinationgood versus evilfoot chaseflashlightdisguiseambulancedeath of friendimpalementdinerweaponaccidentapologynunchilddream sequencepart of seriesdrawinghit by a carunderwater scenetransformationpaingunshotlibrarydangerscreaminglocker roomfantasy sequencechampagnepossessiondollevil manscreamskeletonstalkingautomobilepremarital sexsevered armhaunted housedismembermentredheadundeadsplatterfreeze framewaiterfalling down stairsteen angstwarehousemass murderbeer drinkinggay characterfaintingcomic booklifting someone into the airmutantloss of friendspidercrying womanskateboardbirthfollowing someonepicnicback from the deadcelebrationmental institutiondamsel in distressplaygroundblood on faceanimated sequencemental hospitalblack and white sceneskateboardinghot tubslaughterdisfigurementbarefoot femalebody countgay stereotypeasylumcharacters killed one by onefifth partkilling spreemale objectificationvillain played by lead actortaking a showergiving birthbad guymental patientmadmanmysterious mantaking a photographreturning character killed offkillohioassumed identitytowerevil spiritbroken windowdomineering motherhospital roommasturbation referencelistening to a radionewspaper articlehit by a trucklollipopdripping bloodlocked doorbreaking a windowcarnagejockdeath of boyfriendcrying femaleeating disordertraffic accidentfacial scarjumping into watermysterious womanshape shifterclawreference to shakespeare's romeo and julietcut into piecesswimmerwet clothescut handmurder spreefetusghoulbroken bottledeath of lovergrindhouse filmplant in titlebody partscreaming womanhigh school graduationdrinking from a bottleglovearm ripped offhysterical womanbad dreammental asylumfemale in a showersecretly observingposing for a photographbossy womanhand injurypretending to be someone elsesuperhero costumepsycho terrorhand kissingfalling asleeploss of lovermidwestultrasoundhysterical outburstbaby carriagehand through chestbreaking a car windowcarrying someonelifting a female into the airplace in titleloss of boyfriendscarred facedemonicmidnight moviestreet in titleboiler roomsequel to cult filmboogeymanhorror iconfantasy sceneoff screen rapedrinking winediving boardnursery rhymeindoor swimming poolpart time jobprivate investigationfainting manforce feedinglifting a male into the aircomic book arthand bandageseeing dead peoplefeeding someonemysterious eventdream within a dreambody partspost coital sceneshape shiftingairplane ticketmutilated bodycharacter appears in newspaperjumping into a swimming pooldrinking champagnehole in the wallnightmare becomes realitybaby strollerdepressed womangraduation partyriding a motorbikechoked to deathpsycho filmkilled in a car accidentriding a motorcyclechild born of rapeserial teen killersleeping shirtlesscamera shot from inside human bodyfusiongroup hugviolent mankissing someone's handbossy mothertv show within a filmdream sequence within a dream sequencefainting womanmurder disguised as accidentserial child murderelm streetopen endingslashed to deathspringwood ohioreformed alcoholicactor reprises previous rolecrying for helpdrawing comes to lifefamily relationshippushy motherbreaking a bottlechild ghosthole in the floormale antagonistmother issuesbroken car windowfather issuesbroken dollconflict between friendssitting on the floordeformed babyspitting out a drinkwaking up someonecrashed carlifting a boy into the airpossessed boydrinking coffeelying on the floorcutting oneselfoperation roomrunning latesleeping fully clothedteam workcreepy childforced to eatgag reflexpicture comes to lifepushy father (See All)

The Hunted (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Hunted (2003)

In the green woods of Silver Falls, Oregon, Aaron Hallam, a trained assassin AWOL from the Special Forces, keeps his own brand of wildlife vigil. After Hallam brutally slew four deer hunters in the area, FBI Special Agent Abby Durrell turns to L.T. Bonham-- the one man who may be able to stop him. A …t first L.T. resists the mission. Snug in retirement, he's closed off to his past, the years he spent in the Special Forces training soldiers to become skilled killers. But when he realizes that these recent slaying is the work of a man he trained, he feels obligated to stop him. Accepting the assignment under the condition that he works alone, L.T. enters the woods, unarmed--plagued by memories of his best student and riddled with guilt for not responding to Aaron's tortured letters to him as he began to slip over the edge of sanity. Furious as he is with his former mentor for ignoring his pleas for help, Aaron knows that he and L.T. share a tragic bond that is unbreakable. And, even as they go into their final combat against each other, neither can say with certainty who is the hunted and who is the hunter. (Read More)

Subgenre:
psycho thrilleramerican horrorsuspensemartial arts
Themes:
evilpsychopathlonelinessescapemurderdeathhunting
Mood:
gorenightmarecar chaseslasherblood and gore
Locations:
woodssnowhelicopterbarforestbicyclesewer
Characters:
serial murdererslasher killerserial killerterrorvillainkillertough guysniperex boyfriend ex girlfriend relationshipsniper riflepolice chaseex soldierolder man younger man relationship
Period:
1990s2000s
Story:
sadistic psychopathpsycho killerhomicidal maniacpsychopathic killerbrutalgruesomebloody violencedeeply disturbed personbutcheryserial murderslashinghuman monsterdark pastbutchervictim …psychomutilationmaniackillingobscene finger gesturemurdererduelstabbingcar accidentshot to deathknifebloodviolenceflashbackchasepistolshootoutcorpseblood splatterfistfightmachine gunshot in the headcatgunfightbrawlfalling from heightvomitingshowdownhand to hand combathandcuffsrivercombatshot in the backf wordswimmingstrangulationmassacredeath of friendthroat slittingbridgeimpalementstabbed in the chestone man armypolice officer killedshot in the foreheadkaratefbifugitiveevil mancabinwaterfallsevered armdismembermentsubtitled scenewolfstabbed in the stomachhunterswat teamhonorcrime scenehaunted by the pastu.s. armystabbed in the throatmanhuntpost traumatic stress disorderspecial forcesstabbed in the legbooby trapknife fightcommandoslaughtercaptureknife throwingbody countwar veteransevered legcharacters killed one by onekilling spreebad guymadmanfountainpostcardstabbed in the armyugoslaviamilitary uniformsole black character dies clicheextreme violenceoregongraphic violencestabbed in the faceknife murdermilitary trainingmass gravemurder spreeportland oregonsevered footdisturbed individualhoodcrime spreeauto theftpsycho terrorjumping off a bridgebritish columbiapacific northwestdisturbingkosovobalkanbiblical quoteanimal trapgory violencetrackingsurvivalistbloody spraybasic trainingbody partsethnic cleansingpsycho filmdart gunskate parknaturistrogue soldierwar buddyarrowheadyugoslavian army (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Se7en (1995) is one of the best movies like Misery (1990)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Se7en (1995)

A film about two homicide detectives' ('Morgan Freeman (I)' (qv) and ('Brad Pitt' (qv) desperate hunt for a serial killer who justifies his crimes as absolution for the world's ignorance of the Seven Deadly Sins. The movie takes us from the tortured remains of one victim to the next as the sociopath …ic "John Doe" ('Kevin Spacey' (qv)) sermonizes to Detectives Somerset and Mills -- one sin at a time. The sin of Gluttony comes first and the murderer's terrible capacity is graphically demonstrated in the dark and subdued tones characteristic of film noir. The seasoned and cultured but jaded Somerset researches the Seven Deadly Sins in an effort to understand the killer's modus operandi while the bright but green and impulsive Detective Mills (Pitt) scoffs at his efforts to get inside the mind of a killer... (Read More)

Subgenre:
psycho thrilleramerican horrorcult filmtragedy
Themes:
evilinsanitypsychopathangerinvestigationtorturedeathrevengemurderrapereligionjealousygreedmurder investigation
Mood:
neo noirgorerainslasher
Locations:
helicopterhospitalbarnightclubdeserttaxiurban settingapartmentpolice stationrooftopbrothel
Characters:
serial murdererslasher killerserial killerterrorvillainkillerhusband wife relationshippoliceprostituteteacherdetectivephotographerlawyerinterracial relationshiplust …security guardpolice detectivebiblepolice shootoutpimppregnant womanself mutilationcoronersuicide by cop (See All)
Story:
sadistic psychopathvictim invited to dinnerhomicidal maniacpsychopathic killerpsychological torturetorturercreepyserial murderhuman monstervictimpsychomutilationsociopathmaniackilling …typewritermurdererattempted murdershotguncar accidentshot to deathsurprise endingtitle spoken by characterone word titlebloodviolencenumber in titleinterviewdogbare chested malephotographchasepantiespistolshootoutcorpsedigit in titleblood splattershot in the headarrestheld at gunpointinterrogationprostitutionhandcuffsrevolvercriminaldecapitationfoot chasegay slurflashlightambulancedinersubwaywhite pantiessevered headscantily clad femalehit by a carnews reportshot in the foreheadlibraryevil mansadnesstied upfreeze framegirl in pantiestv newscard gamepokergothictape recordertied to a bedfbi agentcrucifixloss of wifeblockbusterswat teamsevered handrapistswitchbladeobesitypedophileprideautopsybulletproof vestdisfigurementknife throwingbody countboxkilling spreeage differencedead dogbad guymadmanalleycartoon on tvkillspiral staircasecockroachinformanturban decayenvypolice captaindistrict attorneyoffscreen killingscene of the crimewrathrazor bladefashion modelcluedarkroomtwo way mirrorhomeless personhitchcockianintentionally misspelled titlespaghettimurder spreebarbershopmass murdererinnocent person killedcrime spreestairwellpolice partnerjumping from a rooftopwriting in bloodel trainpsycho terrorswatpolice protagonistbreaking down a doorsleeping pillsreference to ernest hemingwaydisturbingfingerprintsreference to jack the ripperforced suicidegluttonywearing a sound wirenumber as titlemetronomeseven deadly sinstenementslothmixed alpha numeric titleabandoned apartmentnumber 7 in titleplea bargaindart boardbad guy winshyperventilationstar wars referencecredits rolling downphoto laburban gothicdelivery serviceblack detectivereference to jodie fosterair freshenerbody shavingface bandageforced eatingreference to geoffrey chaucerreference to marquis de sadereference to st. thomas aquinas (See All)

Gothika (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Gothika (2003)

Dr. Miranda Grey is a psychiatrist who works in a penitentiary, in the mental institution sector. She is married with Dr. Douglas Grey, the chief of department where Dr. Pete Graham also works. Chloe Sava, a patient of Dr. Miranda formerly abused by her stepfather, claims that she is frequently rape …d by the devil in her cell. After leaving the asylum in a stormy night, Dr. Miranda has a car accident, and when she wakes up, she is an inmate of the institution, being accused of an horrible crime and having no memory of the incident. (Read More)

Subgenre:
psycho thrillersuspensesupernaturalparanormal
Themes:
evilmental illnessinsanitypsychopathescapetorturekidnappingdeathmurdersuicidemarriagerapeghostprisonfear …memorysupernatural powerparanoiadrug usesurveillanceunrequited lovepanicdeath of daughtermissing childescape from prisonthe devilmurder of husbandrape and murder (See All)
Mood:
darknessneo noirgorerainnightmareslasher
Locations:
hospitalswimming poolcarbathtubtaxipolice stationpolice car
Characters:
serial murdererslasher killerserial killerterrorvillainkillernursefamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipdoctortattoo …female protagonistpolicemanlawyerreference to godsecurity guardpsychiatristsheriffself mutilationdoctor patient relationshipstepfather stepdaughter relationshipself immolationself cuttingsuicide by jumping off a bridge (See All)
Story:
sadistic psychopathpsycho killerhomicidal maniacpsychopathic killersadisticbloody violenceserial murderslashingintimidationnewspaper clippingmedicationthunderpsychodesperationmaniac …killingmurdererattempted murderwomansubjective cameracar crashshotguncar accidentsurprise endingknifegunviolencebloodfightsexfemale nudityf ratedfemale frontal nudityinterviewflashbackbare chested malekissphotographexplosionchasepistolshowertelephone callfirecryingcell phonedreamcorpseblood splattermirrorwatching tvcomputershootingrifletearsrunninghallucinationreporterswimmingsurvivalfoot chaseflashlightaxevideo camerathroat slittingbridgesuicide attemptprisonerfalse accusationunderwater scenecigar smokingshot in the foreheadmicrophonescreamingperson on firefantasy sequencepay phonefugitiveumbrellapossessionevil manlightningattempted rapeinjectionpursuitstalkingdeath of husbandtrusttherapypizzasyringehypodermic needlegothicheavy rainbarnsecurity camerajail cellpatientbuttocksrape victimrapistmental institutionbarefootwoman in jeopardyjanitorprison guardpillssurveillance cameradeath threatmental hospitalco workerdelusionframe uptime lapse photographythunderstormwomen's prisonabsent fatherevidencerainstormfemale doctoraxe murdernervous breakdowncellarkilling spreereckless drivingowlframed for murderdead girlmemory lossgothvideo tapebad guymental patientmadmanelectricitykillmental breakdownblackoutsatanismblood stainspreadeagledenialhearing voiceslistening to a radiostethoscopescalpelfallingwrist slittingroadblockseizurepsychiatric hospitalshockextreme violencecamcordergraphic violenceinmateman on firetrapdoorfemale victimpurgatoryprophetelectric chairchainssolitary confinementgas explosionmurder victimcircumcisionsecret roomserial rapistflickering lightcar wreckconnecticutpsycho terrordead husbandjumping off a bridgerepressed memoryhospital gowndisturbingbreaking glassfingerprintsdemonicnew hampshiresedativepenitentiarydefense attorneyconfinementpsychiatric wardlogiccatatoniatwo killerssinkholeblood pressurecutterinstinctneurosurgeonpsycho filmspontaneous combustionlistening to a car radioholding one's breath underwatercriminally insanedetourfrench shock cinemadependencefreaking outfemale victimsbrake failurehighway patrolmanurban gothicwrist bandagecovered bridgeelectric generatorfootprintsswimming gogglescell blockchained to a bedwoman on firedistorted soundanimal tortureserial rapetemporary insanitymedical restraintsfloodlightbroken car headlight (See All)

A Nightmare On Elm Street 3: Dream Warriors (1987)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street 3: Dream Warriors (1987)

Picking up where the original Nightmare left off, Nancy has grown up and become a psychiatrist specializing in dream therapy. She meets a group of children at a local hospital facing Freddy Krueger, the same demon she once encountered in her sleep. One of them is Kristen, who has the power to draw o …ther people into her dreams. Working with a male doctor assigned to the case, Nancy helps the kids realize their special abilities within the nightmare world. When Freddy captures one of her charges, she leads a rescue attempt into Krueger's domain, in hopes of putting his spirit to rest once and for all. (Read More)

Subgenre:
psycho thrilleramerican horrorindependent filmcult filmsupernaturalstop motion animation
Themes:
evilsadisminsanitypsychopathmurderdeathghostfuneralmonstersupernatural power
Mood:
gorenightmareslasher
Locations:
barchurchcemeteryschool boy
Characters:
serial murdererslasher killerserial killerterrorvillainkillernursefather daughter relationshipteenagermother daughter relationshipdoctortough guylittle girlsingle motherself mutilation …alcoholic fatherevil nurse (See All)
Period:
1980s
Story:
sadistic psychopathpsycho killerserial child murdererchild murdererhomicidal maniacvillain not really dead clicheserial child killerchild killerpsychopathic killerdrive in classicsadisticbloody violencecreepybutcheryserial murder …slashingbutcherrampagevictimragemaniackillingmurdererbasementisolationstabbingslow motion scenerescuesurprise endingviolencefemale nuditynumber in titlesequelbondagebare chested malecigarette smokingfiredreamcorpsedigit in titleblood splatterthongfalling from heightbedrock musicbathroomnumbered sequeldemondecapitationfoot chasenewspaperdeath of friendimpalementstabbed to deathsuicide attemptstabbed in the chestnundream sequenceradiochild in periltonguethird partcharacter repeating someone else's dialoguestabbed in the backscreamingpuppetpay phonedollevil manskeletoncharacter says i love youundeadsplatterfalling down stairsteen angstelectronic music scorelifting someone into the aircomatied to a bedcrucifixback from the deadclockdrug overdoseswitchbladetrappedwindmutefalling to deathhypnosisstairsstabbed in the legschool uniformdead childjumping through a windowknife fightfogdisfigurementstabbed in the eyebody countcharacters killed one by onekilling spreepajamassmokebad guymadmanalleyreturning character killed offohioevil spiritabandoned housestabbed in the armgroup therapyboy with glassesburnt facebody in a trunkscalpelone linerdruggedwrist slittingrazor bladecarnagedisembodied headwheelchair boundsuper powerpsychiatric hospitalaspiring actresshit with a shovelclawthird in seriestelevision setdigging a gravemattressgymnasticsmurder spreeghoulsolitary confinementbreaking a mirrorsleepwalkingpitholy waterchantingfedoraglovetroubled teensexual innuendopayphonecut armreanimationfalling asleeplifted by the throattricyclejumping ropehospital gownmarionetteorderlydead teenagerdisturbingboneslifting a female into the airbad motherhanged boydemonicsedativestreet in titleboiler roomforced suicideboogeymansexy nursegluereference to edgar allan poefurnacedungeons and dragonsnursery rhymehanged girlbourbonmohawkpunk girljump scarelong tongueolder woman younger manexperimental drugteen smokingburn scardream within a dreamskipping ropescaredshared dreamscratchingfreddy kruegerburned with a cigarettependulumgroup of teenagersstabbed with glassfootstepsserial teen killerdead pigpromiscuous motherbegins with a quotebossy motherinanimate object comes to lifespeaking spanishsleep disordernewton's cradleex drug addictfeathersserial child murderelm streetspringwood ohiofalling leavespapier macheteenager in dangerveinhomemade weaponstabbed with a needleselective mutismbreaking through wallphysical harmbicycle bellchase scenecommitted to asylumdiet cokeisolation cellkids playingscar tissuewidowed motherbathroom sinkminiature modelshoutteenager murderedunfit mothercarrying a childchasing a girlforced drug usenegligent motherteardrop tattoocarrying a girldisabled characterdisabled teenagerinstant coffeeolder woman younger boypopsicle sticktendon (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Collector (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Collector (2009)

When the Chase family moves to an isolated house in the middle of nowhere in Detroit, Arkin is hired to fix the windows and the doors. Later he meets his daughter and his wife that has a debt with dangerous sharks and needs money, but his week payment is not enough to pay her debts. Arkin plots to h …eist the safe of Michael Chase during the night to raise the necessary money. However, when he arrives in the house, he finds that a sadistic criminal has imprisoned the family and planted traps everywhere. Arkin seeks a way out of the deadly house to save his life. (Read More)

Subgenre:
american horrorsuspenseindependent filmindependent horrorsadistic horrorslasher horrorhorror b movie
Themes:
murder of a police officerevilsadisminsanitypsychopathescapetorturemurderdeathbrutalityhome invasionexploitationcruelty
Mood:
gorenightslasherblood and gore
Locations:
strip clubtrying to escape
Characters:
mysterious killerserial killerterrorvillainkillerhostagehusband wife relationshipfather daughter relationshipteenagermother daughter relationshipteenage girlthiefself mutilationtalking to oneself in a mirrormysterious villain …the familykiller dogdirector of photography (See All)
Story:
sadistic psychopathpsycho killerhomicidal maniacpsychopathic killerdark and stormy nightsadisticdeeply disturbed personpsychotronic filmbutcheryserial murderslashinghuman monsterpsychoticbutcherrampage …victimpsychodesperationmutilationmaniacisolationstabbingcar crashslow motion sceneshotgunbeatingsurprise endingknifeviolencebloodfightfemale nuditycharacter name in titlebare breastsfemale frontal nudityflashbacktwo word titlecigarette smokingnippleslesbian kisspistolcorpseblood splattermirrorpunched in the faceshowdownheld at gunpointdead bodyhandcuffsgood versus evilsurvivalfoot chasegay slurflashlightimpalementstabbed to deathstabbed in the chesthousetied to a chairscantily clad femalechild in perilhit by a cardangerscreamingelectrocutiondebtevil manscreamactor shares first name with characterneck breakingtrapfirst partthreatened with a knifeex convictblood spattercrime bossfalling down stairskilling an animallooking at oneself in a mirrortape recorderhammerhidingspidercovered in bloodteddy bearhomeanimal attackhomicidemasked maneaten alivewoman in jeopardyburglartrappedsevered fingermobile phoneburglarymercilessnessgash in the facepsychotronicescape attemptscissorsscene after end creditsdisembowelmentperversiontitle at the endslaughterknife throwinggasolinestabbed in the eyebody countboxcharacters killed one by onebloodbathmasked killerdead dogfemale female kissinterrupted sexblood on camera lensintestinesbarbed wirebad guymysterious manwifestabbed in the handset upconstruction workerpistol whiplightervery little dialogueacidclimbing through a windowself defensehead bashed incigarettepredatorbowling alleyman kills a womanheld captivechandelierfinger cut offretrocarnageex conmacabrebloodshedmasked villaindead cattrickcut into piecesjewelcut handhouse on firemurder spreedragging a bodyviolent deathgrindhouse filmex wifeexploitation filmcrime spreecaptivityclothes rippingbear traphung upside downthroat rippingmystery killersliced in twobandaged handmultiple homicideblack glovesgutsexterminatordeadlineheld hostagewaspgiallo esquetea partyburnt hand911 calllock pickpreylasciviousnesscaptive womancold blooded killerear bleedingteeth knocked outtrip wiremutilated bodydead body in a bathtubman murders a womanmouth sewn shutstabbed in the earbotoxobjectificationtrapped in a houseblouse rippingpolice officer neck brokenblack gloved killerevil doginsane manslashed to deathdisturbed personcut to piecesfalling through a staircaseisolatedhome intruderfemale in perilfish hookhidden safelaundry chuteboarded up windowburned handknife through handhung by a hookpick lockduct tape over eyeskept in a boxruthless killer (See All)

The Dead Zone (1983) is one of the best movies like Misery (1990)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Dead Zone (1983)

Johnny Smith wakes from a coma due to a car accident, only to find he has lost five years of his life, and yet gained psychic powers. Foreseeing the future appears to be a 'gift' at first, but ends up causing problems...

Subgenre:
psycho thrilleramerican horrorsuspenseindependent filmcult filmsupernaturaltragedyparanormalparanormal phenomenacanadian horror
Themes:
madnesspsychopathinvestigationdeathmurderlovesurrealismsuiciderapechristmasfeardeceptionsupernatural powerdeath of motherparanoia …blackmaildeath of wifepanicapocalypsedisabilitymurder investigationunlikely heronuclear holocaust (See All)
Mood:
neo noirslasher
Locations:
wheelchairsnowhospitalschoolchurchpolice cartrucktunnelschool teacherfire truck
Characters:
serial murdererserial killervillainnursehusband wife relationshipfather son relationshipmother son relationshipboyfriend girlfriend relationshipdoctorteacherpolice officerphotographerbabylittle boy …psychiatristsnipersheriffgermanex boyfriend ex girlfriend relationshipsniper rifleself mutilation (See All)
Period:
world war two1980s1970swinterseeing the future
Story:
serial child murdererchild murdererhomicidal maniacserial child killerchild killerpsychopathic killerbased on the works of stephen kingdrive in classicpsychotronic filmbased on novelserial murderslashingrampagemutilationsociopath …maniacmurdererisolationattempted murdercar crashslow motion scenerescueshot in the chestcar accidentshot to deathsurprise endingtitle spoken by characterbloodfemale nudityflashbackkissphotographexplosionchasepistolfireshootoutdreamcorpseblood splatterwatching tvbattlegunfightfalling from heightletterrifleheld at gunpointhandcuffsrevolvertelephonef wordreportergood versus evilflashlightambulancemansionpoliticianstabbed in the chestman with glassesassassinationchild in perilunderwater scenepolice officer killednews reportmarriage proposaldrowningflash forwarddangerprotestwidowerpay phoneproduct placementdeath of childrabbitchristmas treelightningshot in the shoulderscarbodyguardtragic eventpremarital sexcharacter says i love youloss of mothergenerallove interestcult directorsacrificepsychicnewspaper headlinecorrupt copbattlefieldchild murderheart attackhenchmancold waricedestinydesireassassination attemptelectronic music scorereference to adolf hitlergothicheavy raincomaexploding buildingloss of wifepress conferencesevered handgrindhouseambitionpresumed deadcrime scenevisionmercilessnessevacuationpsychotronicscissorssenatordeath of protagonistdark herodead childrainstormslaughterbody countsexual assaultmoral dilemmaarrogancemain character diesfirefightersouthern accentbad guyteachingswastikacrutchesroller coastermegalomaniacold flameelection campaignbillboardpolitical campaigndeputykiss on the lipsreluctant heropremonitionhead injuryrallycorrupt politicianshot in the handpolitical candidatestar crossed loversbra removingpsychic poweroverturning cartitle same as booktragic endingpresidential candidatemainecar rolloverheadachehouse on fireassassination plotgrindhouse filmstabbed with scissorsnuclear threatcandidatechild killeddental bracesstabbed in the mouthpolitical assassinationsexual predatorpayphonescreaming in feartorture chamberextrasensory perceptionfrozen lakewalking stickworld war threecharacter appears on tvnew hampshiregazeboreference to edgar allan poepolitical rallyhuman shieldsubterfugesee through brachild's bedroomevil politicianneurologistwaking up from a comadental headgearparanormal phenomenonnuclear attackkissing in the rainpsychiatrist patient relationshipcharacter appears on magazine coverromantic kisscontemporary settingclothes ripped offkiller copstormy nightserial child murderstuffed toy rabbitgirl in periltoy rabbitex fiance ex fiancee relationshipserial teen murderersecond sightaltering the futurepsychic detectivereading lessontruck car collisionaspiring politician (See All)

P2 (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

P2 (2007)

The story centers on a corporate climber who gets stuck working late on Christmas Eve and finds herself the target of an unhinged security guard. With no help in sight, the woman must overcome physical and psychological challenges to survive.

Subgenre:
psycho thrillersuspenseindependent filmblack comedyslasher flickpsychological thrillerholiday horrorchristmas horror
Themes:
madnessabductionmental illnessinsanityobsessionpsychopathlonelinessinvestigationescapekidnappingmurderrevengedeathinfidelitychristmas …betrayalfeardrunkennessdeceptionparanoiasurveillancecrueltypanicnear death experience (See All)
Mood:
darknessneo noirgorecar chaseslasherone night
Locations:
snownew york citycarwatertaxielevatorurban settingpolice carcityoffice
Characters:
slasher killerhostagepolicefemale protagonistpolice officerpolicemansecurity guardpolice detectivemysterious villain
Period:
winter
Story:
victim invited to dinnerpsychological torturebipolar disorderdeeply disturbed persontauntingphysical abuseintimidationtensioncaptivesociopathmaniacobscene finger gestureisolationcharacter's point of view camera shotattempted murder …duelwomanstabbingsubjective cameracar crashcar accidentbeatingsurprise endingknifeone word titleviolencebloodfightnumber in titledogexplosionpartychasetelephone callfirecryingcell phonehigh heelscorpsedigit in titleblood splatterfistfightmirrorpunched in the facebrawlplace name in titlerunninghandcuffsvoyeurmanhattan new york cityf wordcleavagesurvivalfoot chasenewspaperflashlightbound and gaggedwinestrangulationaxevideo cameraambulancetied to a chairnonlinear timelineexploding carfalse accusationapologyhit by a cardouble crossargumentstalkerorganized crimestabbed in the backscreamingperson on fireelectrocutionattackproduct placementknocked outkicked in the facechristmas treeattempted rapebodyguardstalkingexploding bodydie hard scenariorecord playerholidaypickup truckeavesdroppinganswering machineburned alivekilling an animalsecurity camerakicked in the stomachvideotapeimpersonationcovered in bloodteddy bearfaked deathparking garageanimal attackcrushed to deathduct tape over mouthbarefootwoman in jeopardydamsel in distressfloodstealing a cartrappedbloody nosesurveillance cameramisunderstandingpower outagebusinesswomantitle appears in writingco workerescape attemptstabbed in the headchristmas evesexual harassmentdisembowelmentaerial shotblood on shirtdead manone daybuildinggasolinestabbed in the eyelonerbody countduct tapenervous breakdowncharacters killed one by oneburned to deathreckless drivingchloroformflat tiredead dogintestinesreference to elvis presleyaccountantcar troubleyellingchristmas presenttaserdisposing of a dead bodyanimal abusemind gamebody in a trunkdruggedhandcuffedwoman kills a manstabbed in the shouldermurder witnesssexual frustrationcar set on firetow truckgropingoverturning carmenacenervousnesshomeless personwoman fights a mantormentcrowbarfemale victimwhite dressimprovised weapontrunklocked in a roommolestationanimal killingchristmas lightsdoormanman hits a womanstupid victimfake accentreal timesurveillance footagechrysler building manhattan new york citycat and mousecrime of passionchristmas decorationstragic villainwrench911power failurewoman punches a mancrushed by a carforkman fights a womanhomeless womannight watchmanrottweilerman punches a womansingle set productionwoman hits a mandog bitehandcuffed womanrental carnew york city skylinetire ironfire hosechased by a dogno cellphone signalduct tape gaglock pickdumb policesprinkler systempettingflipping carstabbed with a forksleeping womanclaustrophobicderangedemployee employee relationshippersonality disorderstuck in an elevatorattacked with a knifefingernail cut offdragged by a carelvis presley impersonatorsanta costumecar showroomdeath of a petvideo screenkilling a petflooded roomwet dressburned up cartitle appears on screenbitten in the legbroken cameratitle appears in text on screenchicken racerace impersonation (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Halloween (1978)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloween (1978)

The year is 1963, the night: Halloween. Police are called to 43 Lampkin Ln. only to discover that 15 year old Judith Myers has been stabbed to death, by her 6 year-old brother, Michael. After being institutionalized for 15 years, Myers breaks out on the night before Halloween. No one knows, nor want …s to find out, what will happen on October 31st 1978 besides Myers' psychiatrist, Dr. Loomis. He knows Michael is coming back to Haddonfield, but by the time the town realizes it, it'll be too late for many people. (Read More)

Subgenre:
psycho thrilleramerican horrorindependent filmcult filmslasher flickteen movieteen horrorholiday horror
Themes:
evilpsychopathdeathmurderfearcorruptionparanoiamurder of family
Mood:
high schoolnightslasher
Locations:
small towncarcar theftkitchen knife
Characters:
serial murdererslasher killerserial killerterrorvillainkillerhusband wife relationshipteenagerboyteenage girlteenage boyfemale protagonistgirllittle girllittle boy …psychiatristdoctor patient relationship (See All)
Period:
1970s1960syear 1963year 1978
Story:
sadistic psychopathpsycho killerhomicidal maniacvillain not really dead clichepsychopathic killerdrive in classiccreepyweirdoserial murderhuman monsterpsychomutilationmaniackillingmurderer …character's point of view camera shotattempted murderstabbingsubjective camerashot in the chestshot to deathsurprise endingknifetitle spoken by characterone word titleviolencegunfemale nuditynuditydogcigarette smokingblood splatterwatching tvfalling from heightmaskrunninglow budget filmmarijuananeighbortelevisiontelephonegood versus evilhalloweenstrangulationthroat slittingstabbed to deathchildgunshotprologuesuburbfirst of seriespay phoneevil manhalloween costumelong takestalkingfirst parthandgunpot smokingteen angstbulletelectronic music scorebabysitterlifting someone into the airstabbed in the stomachblockbustergrindhousedead womanmasked manwatching televisionwoman in jeopardycouchunderage drinkingburglarymanhuntmercilessnesstvtitle at the endbody countdead woman with eyes openkilling spreepumpkinnude woman murderedphonemasked killerdead doggothbad guymental patientmadmanyellingclosethiding in a closetkillsuit and tiefence17 year oldcigaretteautumnwoman wearing only a man's shirtkiller childfamous scorebabysittingcarpentermasked villainknife murderknittingbutcher knifefemale victimoff screen murderwetnessmurder spreegrindhouse filmescaped mental patientno endingpayphonelight bulbpsycho terrormidwestghost costumewoman smoking cigarettesmall town sheriffmichael myerstrick or treattalking on phonedead teenagerheadstonemusic score composed by directorwoman strangled to deathfalling out a windowchild murders a childdemonicphone conversationcuttingboogeyman21 year oldpumpkin carvinghorror movie remadelifting a male into the airwoman stabbedlaundry roomcarrying a dead bodyjumpsuitsmoking a cigarettesororicidepsycho filmescaped killerreturn to hometownindestructibilitysmashed pumpkinurban gothicautumn leavesknitting needleoctoberhouse of horrorsteenager in dangergiant pumpkinteenager murdered (See All)

The Last House On The Left (1972)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Last House On The Left (1972)

On the eve of her seventeenth birthday, Mari Collingwood tells her parents that she is going to the concert of underground band Bloodlust in New York with her friend Phyllis Stone. She borrows the family's car and heads with her friend to a dangerous neighborhood in the city. Meanwhile, the sadistic … and cruel escapees Krug Stillo and Fred 'Weasel' Podowski are hidden in a hideout with their partners Sadie (Jeramie Rain) and Krug's addicted son Junior Stillo (Marc Sheffler) after killing two guards and one shepherd in their runaway. The two girls seek marijuana near the theater and meet Junior that offers some Colombian grass to them. They go to his apartment and are subdued by the criminals that rape Phyllis. On the next morning, they hide the girls in the trunk of their convertible and head to Canada. However, they have a problem with the car's rod and they stop on the road close to Mari's house. When Phyllis tries to escape, the gang stabs her to death and shots Mari after humiliating and raping them. They seek shelter in Mari's home, but during the night, her mother overhears a conversation of the criminals telling that they have killed her daughter. She tells her husband and they plot a scheme to revenge the death of their princess. (Read More)

Subgenre:
american horrorindependent filmcult filmsadistic horror
Themes:
madnessabductionevilsadisminsanitypsychopathinvestigationescapetorturekidnappingrevengedeathmurdersuiciderape …voyeurismseductionbrutalityhumiliationcrueltyvengeancerape and revengerape and murder (See All)
Mood:
gorehigh schoolnightmareslasher
Locations:
swimming poolforestcemeterylakerunning through the woods
Characters:
serial murdererslasher killerserial killerterrorvillainkillerfamily relationshipsfather son relationshippoliceteenage girlreference to godsheriffself justice
Period:
1970s
Story:
sadistic psychopathserial child murdererhomicidal maniacfemale villainserial child killerfemale serial killerpsychopathic killerfemale killerfemale psychopathbad girldrive in classicsadisticbloody violenceserial murderhuman monster …murder of a childvictimmutilationmaniackillingmurdererstabbingshot to deathknifegunviolencefightbloodfemale nudityfemale frontal nuditydogfemale rear nudityfemale full frontal nuditypantiesshowerblood splatterurinationremakeshootingbeerbirthdaymarijuanavoyeurfoot chasebound and gaggedgangconcertthroat slittingstabbed to deathtoiletfemale pubic hairwhite pantiesscantily clad femalebathcontroversycigar smokingnecklacelatex glovespublic nuditydrug addictstabbed in the backscreamingsuburbelectrocutionevil manringconvertiblefemale removes her clotheschickendirectorial debutsevered armhandgunbased on filmcult directordismembermentbralesschainsawnipples visible through clothingbeer drinkingmachetesexual abuseice creamgrindhouserape victimrapistpeeping tomhitchhikingwoman in jeopardyswitchbladerock concertsufferingcynicismhippiepet dogjunkiepedophiledisembowelmentperversioncastrationducksexual assaultfemale in showerbloodbathshot multiple timesdead girlpervertprayingbad guymadmancannabisforced to striprunning awayspit in the facemisogynistphysiciansexual perversionsexual violenceelectronic musicdegradationdouble barreled shotgunescaped convictwetting pantsfilm starts with textparentheld captiverazor bladecarnageatrocitystation wagonshot through the mouthgraphic violencereading a newspaperchild molesterbakingdisturbed individualstreamlong haired maleserial rapistbitingpaybacksexual predatorstabbed multiple timesrunning out of gasrunning for your lifemistreatmentescaped prisonerperson in a car trunkpocket knifebased on supposedly true storysexual crueltypokiesbanned filmdisturbingsex offenderforced suicidestabbed in the bellyhands tied behind backrefugeinfamybloody handmutilated corpsecheckershorror movie remadevideo nastysickocandlelight dinnerpsychological tormentcaged birdreference to j. edgar hoovertrip wiregraphic raperotten teethserial teen killerlocked in a car trunkescaped killerlive chickenhair curlersfemale victimsengine troublereference to the grand canyonplaying checkersstuffed in a car trunkbaking a cakeprison escapeewoman smoking a cigarmedical gownserial teen murdererice cream barsmoking in bathtubwoman in a trunkremake of swedish film (See All)

Halloween H20: 20 Years Later (1998) is one of the best movies like Misery (1990)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloween H20: 20 Years Later (1998)

On Halloween in 1963, Michael Myers murdered his sister, Judith. In 1978, he broke out to kill his other sister, Laurie Strode. He killed all of her friends, but she escaped. A few years later, she faked her death so he couldn't find her. But now, in 1998, Michael has returned and found all the pape …rs he needs to find her. He tracks her down to a private school where she has gone under a new name with her son, John. And now, Laurie must do what she should have done a long time ago and finally decided to hunt down the evil one last time. (Read More)

Subgenre:
psycho thrilleramerican horrorindependent filmcult filmslasher flickteen horror
Themes:
abductionevilinsanitypsychopathdeathmurderdrugsparanoiaalcoholism
Mood:
high schoolnightmareslasher
Locations:
small townschoolelevatorkitchentruck
Characters:
slasher killerserial killerterrorvillainnursefamily relationshipspolicemother son relationshipteenagerboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boygirlpoliceman …security guardalcoholicsecretarymysterious villain (See All)
Period:
1990syear 1998
Story:
sadistic psychopathpsycho killerhomicidal maniacvillain not really dead clichepsychopathic killersadisticbloody violenceserial murderslashingnewspaper clippingrampagevictimpsychoragemaniac …character's point of view camera shotattempted murderstabbingsubjective cameracar accidentknifeviolencebloodnumber in titlesequelchasepistolfalling from heightmaskbirthdaydead bodyneighborhallucinationtelephonedecapitationgood versus evilhalloweenflashlightwinecandlecaliforniaaxeambulancedeath of friendthroat slittingstabbed to deathtoiletstabbed in the chestweaponsevered headstalkerstabbed in the backprologuekeyuniformmistaken identityevil manactor shares first name with characterstalkingreunionflowersplatterbreaking and enteringheroinesurvivorlifting someone into the airloss of friendhidingfaked deathmasked mantrappedunderage drinkingdelusionstabbed in the legboarding schoolknife throwingbody countaxe murdercharacters killed one by onedivorceesecret identitypumpkinmasked killerhockeyreflectionstolen caranniversarybad guybeheadingcar troublemadmanmysterious manfire extinguisherreturning character killed offhiding in a closetgatebody baggraphic violencestabbed in the facehiding placemasked villainknife murderbutcher knifefemale victimmurder spreesittingseventh partpsycho terrormichael myersdead teenagerdoor belllifting an adult into the airboogeymanlifting a male into the airjumpsuitsequel with unusual numberaxe in the chestcult favoritehead chopped offgarbage disposalserial teen killertrailer narrated by don lafontainewhite maskhome intruderevil uncleschool counselor (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

A Nightmare On Elm Street 2: Freddy's Revenge (1985)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street 2: Freddy's Revenge (1985)

A new family moves into the house on Elm Street, and before long, the kids are again having nightmares about deceased child murderer Freddy Krueger. This time, Freddy attempts to possess a teenage boy to cause havoc in the real world, and can only be overcome if the boy's sweetheart can master her f …ear. (Read More)

Subgenre:
american horrorcult filmsupernaturalparanormalparanormal phenomenaslasher flickteen horrorbody horrorsupernatural horrorurban fantasylgbt horrorcult classichorror b movie
Themes:
evilsadismpsychopathescapekidnappingdeathmurderrevengefriendshipsurrealismghostfearmonstervoyeurismbrutality …supernatural powerparanoiapanicmysterious deathshower murder (See All)
Mood:
darknessgorerainhigh schoolnightmareslasherpoetic justice
Locations:
small townbarschoolswimming poolbusdesertbaseballstormgay barschool busbus driverabandoned factoryschool bus driver
Characters:
serial murdererslasher killerserial killerterrorvillainkillerfamily relationshipshusband wife relationshiphomosexualfather son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationship …friendboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boyteachergirlstudentpolicemanlittle girlself mutilationdrivergay teacher (See All)
Period:
1980syear 1985
Story:
sadistic psychopathpsycho killerserial child murdererchild murdererhomicidal maniacvillain not really dead clicheserial child killerchild killerpsychopathic killerdrive in classicsadisticpsychotronic filmbutcheryserial murderslashing …murder of a childnewspaper clippingbutcherrampagepsychomutilationmaniacobscene finger gesturemurdererbasementcharacter's point of view camera shotstabbingsubjective cameraslow motion sceneshotgunsurprise endingknifefightviolencebloodcharacter name in titlenuditynumber in titlemale nuditysequelmale rear nuditybondagedogbare chested malecigarette smokingpartychaseshowertelephone callfirecryingdreamdigit in titleunderwearblood splatterface slapwatching tvundressingbikinibare buttsunglassessecond partplace name in titledead bodyneighbornumbered sequeldemonhallucinationvoyeurclassroomcriminalf wordfoot chasename in titlemassacrebasketballimpalementfootballstabbed to deathstabbed in the chestsnakeapologydream sequencebirdchild in perilcreaturespankingtransformationbartenderpublic nuditylegendstabbed in the backscreaminglocker roomperson on firepossessionevil mankicked in the facelightningscreamdiaryconvertiblegymhigh school studentexploding bodyratcharacter says i love youthreatened with a knifeclasshaunted housewhippingbare chested male bondagenewspaper headlineredheadundeadcoachapplauseidentityteen angstburned alivekilling an animalnipples visible through clothingelectronic music scorewoundmass murderbeer drinkinggothicgay characterlooking at oneself in a mirrorlistening to musiclifting someone into the airjoggingmousestabbed in the stomachbarefoot malevisitcovered in bloodgrindhousesadomasochismteenage protagonistcrying mans&mback from the deadmale underwearfull moondamsel in distressseriesblood on faceunderage drinkinggash in the faceescape attempthit on the headrainstormdisfigurementraised middle fingerhomoeroticismsuspectbarbecuebody countbriefscellarkilling spreealarm clocktelekinesismale objectificationtaking a showerbad guybarking dogmadmanhigh school teacherstuffed animalohiocafeteriaurban legendassumed identitysecond in seriesevil spiritbroken windowfish tankbroken mirrorbus stopsplit personalityburnt facepush upshearing voicesnewspaper articlevolleyballbare chested boyjock strapteenage sexualitymale name in titlelocked doorbreaking a windowpool partykicked in the headstabbed in the shoulderwhite briefsmoving inmurder suspectcrotch grabreading a newspaperawkward situationjumping into watershape shifterclawwoman in a bikinidance sceneheatriding a bikedead birdundressing someonewet clothesbaseball teambreaking through a doorfeet on tablemurder spreedragging a bodybreaking a mirrorgrindhouse filmsleepwalkingplant in titlearms tied overheadleg injuryidentity crisisdomineering fatherno endingglovecaged animalcrying maleshower roomwagontalking to oneselfboom boxbad dreampassive aggressive behaviortoastercut armsecretly observinghand injuryrepeated eventpsycho terrorlifted by the throatlocked injumping ropehand through chestgym classinvisible mansocial outcastblood on handsgay subtextgym teacherplace in titlescarred facedemonicstreet in titleboiler roomsequel to cult filmclassmate classmate relationshipgarden partykidnapped girlpower planthorror iconburnt handtaking off shoeswalking in the rainhomoerotic fighttennis racketcoors beerfurnacescreaming mantaking off pantsgory violencemale in a showernursery rhymetennis ballsleep deprivationwatching someone sleeplong tonguemelting facelifting a male into the airexposed brainhand bandagehell on earthmale bare buttmysterious eventburn scarcaged birdkidnapped womanobscene gestureshape shiftingskin rippingarm injuryscience teacherbaseball coachoverweight manteen sexualityfreddy kruegerjumping into a swimming poolnightmare becomes realitybird in a cageraw meatpossessed manclimbing a laddermale female fightsleeping shirtlessbad guy winsbiology teacherbiting someonegrillgroundedspurting blooddragging someoneattempted child murderescape out a windowclothes torn offpet birdsleep disorderclothes ripped offlocking a doorunpunished antagonistcracked mirrorhigh school coachkidnapped boymurder of a nude manscore employs electronic instrumentsserial child murdertaking off socksurban gothicbarred windowelm streetopen endingslashed to deathspringwood ohiothrowing something at someonehit on the head with a ballsleeping in classactor reprises previous rolebloody footprintcrying for helpmale bondagemistaken belief that someone is deadrunning barefoottrampled to deathdomineering husbandschoolmate schoolmate relationshipcar over a cliffexploding animalleather barmale antagonistbandaged armescape by the windowface injuryhomophobic remarkreference to jack kerouacsleeping in underwearwrapped in a blanketbiology classburned handfalling asleep in classreading someone's diaryschool gymserial teen murdererarm bandagebroken doorhijacked busleg bandageplaying baseballpossessed boys&m clubsadistic teacherscar tissuecrotch grabbingdrinking coffeeface scarkilled in a showerlying on the floorripped off clothestowel snappingburning oneselffemale voyeurkidnapped manlocked in a carquestioning sexualitybiting legcutting someonedriving off roadhead rippingintroverted boymass panicmurder in a showerpassive aggressive manpouring rainsleeping fully clothedbossy fathergrabbing one's crotchscreaming boytalking with one's mouth full (See All)

I Spit On Your Grave (1978)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

I Spit On Your Grave (1978)

The film follows Jennifer, a writer who is working on a new novel and needs to get out of the city to finish it. She rents a riverside cabin in upstate New York to work on her novel, attracting the attention of a number of rowdy male locals. They catch Jennifer one day and strip her naked for the vi …llage idiot (Matthew) and rape her. Jennifer is later attacked and raped a further two times by the four degenerates, and her novel is also destroyed. But Jennifer recovers, and in her now-twisted, psychotic state, she begins to seek revenge on the men. (Read More)

Subgenre:
american horrorindependent filmcult filmb movievideosadistic horrorhorror b movie
Themes:
evilsadismpsychopathangertorturekidnappingrevengedeathmurderrapefearvoyeurismseductionbrutalityhumiliation …exploitationcrueltyvengeancerape and revengerevenge murder (See All)
Mood:
goreslasher
Locations:
small townnew york citychurchforestcarbathtubbicyclewaterlakegas stationcountry
Characters:
serial murdererserial killervillainkillerwriterfemale protagonistgirllustself justicesex with a stranger
Period:
1970s
Story:
sadistic psychopathpsycho killerfemale villainfemale serial killerpsychopathic killerfemale killerfemale psychopathgruesomedrive in classicsadisticcreepymurderessserial murderhuman monsterpsychotic …victimdesperationmutilationragekillingmurdererauthorbeatingknifegunbloodviolencefemale nuditymale nuditybare breastsfemale frontal nuditymale frontal nuditybare chested malefemale rear nudityfemale full frontal nuditycigarette smokingnipplesmale full frontal nudityleg spreadingpantiesfondlingcryingmirrorbikinilow budget filmvoyeurmale pubic hairriveralcoholtelephonecleavagenewspapergangnew yorkaxefemale pubic hairwhite pantiesdrivingman with glassesscantily clad femalecontroversydrowningjeanspublic nudityone against manysmokinggravescreamingunderground filmevil manhangingfemale removes her clothesglassesthreatcabinhandgunvigilanterecord playereyeglassesclaim in titlenipples visible through clothinginjurysexual abusegrindhouserape victimrapistredneckwoman in jeopardylow budgetmercilessnessdeath threatdark herosexploitationpanties pulled downgang rapeperversioncastrationbody countaxe murderbruisecharacters killed one by onekilling spreemisogynywoman in bathtubpervertkillviolence against womenvigilantismmisogynistcanoefemale removes her dressmental retardationsexual perversionsexual violenceloserharmonicadegradationanal rapebubble bathheld captivewhite trashwrathmotorboatcarnageatrocitywoman wearing only a man's shirtbleeding to deathhammockextreme violencegraphic violencesmall breastsfemale prisonerfemale victimshared bathone woman armymurder spreeviolent deathdelivery boygrindhouse filmnoisesexual humiliationsuspendersfemale writersex on the floorgenital mutilationdeath by hangingmultiple homicidemistreatmentconnecticutdebaucherysexual sadismsexual crueltybanned filmdisturbinghanged boyeye candyinfamygory violenceeast coastmisandryvideo nastyfemale murdererlasciviousnessreference to coca colawoman murders a manoral rapefemale vigilantereading in bedrevenge killingextreme filmman forced to stripturning the tableswriter as protagonistmaking lovewoman haterpredator turns victimcut off penisderanged manpredator becomes preyrapist comeuppancetorture threatjean jacketsexy legsunpunished crimeforced fellatiopucciniloss of peniswoman's revengewoman on all foursbag of groceriesbottle rapemale genital mutilationrepetitive rape victimdisgusting (See All)

The Devil's Rejects (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Devil's Rejects (2005)

In Ruggsville, Texas, the police under the command of Sheriff John Quincy Wydell attack the house of the sadistic serial killers Firefly family (a.k.a. The Devil's Reject) and they arrest mother Firefly, but Otis B. Driftwood and Baby Firefly escape from the siege. Tiny is wandering nearby the house … and also escapes. Otis and Baby call their patriarch, the mad clown Captain Spaulding and they schedule to reunite at an isolated motel in the desert. When Otis and Baby arrive, they kidnap two families of singers, using sadism and violence against the harmless persons. Meanwhile, Sheriff Wydell promises to capture and kill the runaways, seeking revenge for the death of his brother, the Deputy George Wydell. (Read More)

Subgenre:
psycho thrillerindependent filmcult filmblack comedysadistic horror
Themes:
murder of a police officermadnessevilsadisminsanitypsychopathangerescapetorturekidnappingmurderdeathrevengefriendshipsuicide …rapebetrayalfeardeceptionseductiondeath of fatherbrutalitydeath of motherparanoiahumiliationexploitationcrueltycannibalismvengeanceself sacrificepolice brutalitynear death experiencemurder of family (See All)
Mood:
gorenightmareambiguous ending
Locations:
barbathtubpolice stationfarmroad tripmotelgas stationtexasbrothel
Characters:
serial killerterrorvillainhostagenursefamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoobrother brother relationship …brother sister relationshipprostitutepolice officertough guymaidsheriffpolice shootoutpimpaunt niece relationshipsuicide by copmurder of a prostitute (See All)
Period:
1970syear 1978
Story:
homicidal maniacfemale villainfemale serial killerpsychopathic killerfemale killerfemale psychopathpsychological torturesadisticbutcheryserial murderhuman monsternewspaper clippinghighwaybutcherrampage …ragemaniacobscene finger gesturemurdererbasementpigslow motion scenerescueshotgunshot in the chestshot to deathbeatingknifetitle spoken by characterviolencebloodsequelflashbackmale rear nuditydogbare chested malesex scenefemale rear nudityfemale full frontal nuditycigarette smokingphotographexplosionchasepantiespistolshowerfireshootoutwoman on topdreamcorpseblood splattermachine gunhorseface slapshot in the headpunched in the facewritten by directorarrestgunfightsex in bedbare buttvomitingshowdownrifleheld at gunpointbeersecond partdead bodylow budget filminterrogationmarijuanajailhandcuffsrevolvercriminalshot in the backf wordsurvivalfoot chasegay slurbound and gaggedambushstrangulationaxedeath of frienddrug dealerthroat slittingimpalementcocainestabbed to deathstabbed in the chestfemale pubic hairtied to a chairwhite pantiescultdream sequenceanti herochild in perildouble crosspolice officer killednews reportcigar smokingshot in the legshot in the foreheadracial sluron the runbeaten to deathstabbed in the backscreamingclownelectrocutionpay phonefugitiveevil manknocked outopening action sceneattempted rapefarmershot in the shouldermanipulationdeath of brothersplit screendeath of sonneck breakingthreatened with a knifechickenprofanityshot in the armwhippingcult directorcowfreeze framestylized violencehead buttmass murderlooking at oneself in a mirrorscene during opening creditscowboy hatstabbed in the stomachkicked in the stomachphone boothcovered in bloodgrindhouserapistinterracial friendshipmasked mangas maskwatching televisionredneckcrime scenestealing a carstabbed in the throathatredhit in the crotchcannibalmercilessnessstabbed in the neckescape attemptreference to satancigarette lighterstabbed in the legdeath of protagonistpunched in the chestjumping through a windowthrown through a windowwisecrack humorblood on shirtone daybounty hunterslaughterbulletproof vesttough copdisfigurementknife throwinggasolinebarbecuebody countaxe murderranchsexual assaultsevered legkilling spreedeath of loved onefemale in showermedia coveragesouthern accentclose up of eyesnews reportershot through a windowgothmarijuana jointpervertreference to elvis presleyprayingbad guymadmanface maskreturning character killed offstabbed in the handnecrophiliaforced to stripshot in the neckspit in the facehomagepistol whipmisogynistsexual violencestandoffvulgaritytrailer homefilm starts with texthit by a truckdeputyman kills a womantrailer parkman punching a womansole black character dies clichemacabreshot in the throatcarjackinggraphic violenceexploding housedeath of familyreference to star warsknife murderbutt slapcross countryfilm criticfemale victimcocaine snortinghouse on firemurder spreemass murderergrindhouse filmevil clownbilingualisminnocent person killedcrime spreereturning character with different actorknife in the chestserial rapistslow motion action sceneno survivorssouthdutch anglemodern westernsuit of armorcult figurerunning out of gaskiller clownwriting in bloodred light districtmultiple homicidecmnfsexual torturepossebody armorman punches a womantrailer trashpolice vigilantismblockadegas grenaderoadkillreference to jack the rippersevered faceclown makeupentrailssatanicroadiereference to mark twainviolence against a womannail through handoral rapecattle prodmutilated bodynecrophiliacpig maskderanged womanreference to groucho marxderanged manblood bathforced nudityrape with a gun barrel (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

A Nightmare On Elm Street 4: The Dream Master (1988) is one of the best movies like Misery (1990)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street 4: The Dream Master (1988)

Following up the previous Nightmare film, the dream demon Freddy Krueger is resurrected from his apparent demise, and rapidly tracks down and kills all three of the surviving Elm Street kids. However, Kristen (who has the ability to draw others into her dreams) wills her special ability to her frien …d Alice before her demise. Afterwords, Alice soon realizes that Freddy is taking advantage of that unknown power she now wields to pull a new group of teenage children into his foul domain. (Read More)

Subgenre:
american horrorsuspenseindependent filmmartial artscult filmblack comedysupernaturalparanormal
Themes:
evilpsychopathmurderrevengefuneralsupernatural power
Mood:
gorerainhigh schoolnightmareslasher
Locations:
small townhospitalbeachcemeteryelevatorschool nurseblood in water
Characters:
serial murdererslasher killerserial killerterrorvillainkillerfather son relationshipfather daughter relationshipteenagermother daughter relationshipafrican americanbrother sister relationshiptough guylittle girlwaitress
Period:
1980s
Story:
sadistic psychopathpsycho killerserial child murdererchild murdererhomicidal maniacserial child killerchild killerpsychopathic killerdrive in classicsadistictorturerbutcheryserial murderslashingold dark house …butcherrampagemutilationmaniackillingmurderercar crashsurprise endingbloodnumber in titlesequelfemale frontal nuditydogbare chested malecigarette smokingphotographfiredreamcorpsedigit in titleblood splatterurinationface slappunched in the faceplace name in titlerock musicneighbornumbered sequeldemonambulancedeath of friendstabbed to deathdinerstabbed in the chestsevered headcoffincharacter repeating someone else's dialoguelocker roomwidowerperson on firepay phoneevil mankicked in the faceskeletondeath of brothercheerleaderdeath of songlassesunderwatersevered armsleepingundeadpizzasurgeryteen angstelectronic music scoreslow motionwoman with glasseslifting someone into the airstabbed in the stomachkicked in the stomachfourth partmovie theatercrushed to deathback from the deadseriesresurrectionstabbed in the headblack and white scenedaydreamsouldisfigurementabusive fatherlooking at self in mirrorbroken armkilling spreevillain played by lead actorbad guyreturning character killed offneedlejunkyardohiodefecationcockroachevil spiritbugweightliftingclimbing through a windowfish tankbroken mirrorasthmaburnt facebody in a trunkdripping bloodafrican american womanpunching bagjockdeath of boyfriendhome videoclawburn victimmurder spreetime loopplant in titlehead ripped offreturning character with different actorwater fountainfedoralifting female in airbandanaglovetroubled teendeja vufalling through the floorman dressed as womanpayphonereanimationcrushed by a cardaydreamingrepeated eventfalling asleepsleeping pillsbitten on the armhand through chestdisturbingafrican american mandemonicoverprotective fatherstreet in titleboiler roomsequel to cult filmreference to aristotlewaterbedlucid dreamdead body in waterthrown through a wallburn scarpin upsandcastlefreddy kruegerreflection in watertumbleweeddart boardserial teen killerbitten by a doghand through headnunchuckreflection in car mirrordog urinationtheatre marqueeasleep at the wheelloss of best friendhole through torsoserial child murderelm streetspringwood ohiofilm starts with a quotepin up girlfemale stuck in sticky substanceproducer cameofalling asleep in classscar tissuevolkswagen cargrumpy father (See All)

Blow Out (1981)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Blow Out (1981)

This stylish Brian De Palma thriller plays off the theme of the unsuspecting witness who discovers a crime and is thereby put in grave danger, but with a novel twist. Jack Terry is a master sound recordist who works on grade-B horror movies. Late one evening, he is recording sounds for use in his mo …vies when he hears something unexpected through his sound equipment and records it. Curiosity gets the better of him when the media become involved, and he begins to unravel the pieces of a nefarious conspiracy. As he struggles to survive against his shadowy enemies and expose the truth, he does not know whom he can trust. (Read More)

Subgenre:
psycho thrilleramerican horrorindependent filmcult filmconspiracyb horrorpolitical thrillerpolitical conspiracy
Themes:
claustrophobiaevilsadismpsychopathinvestigationtorturemurderdeathpoliticsfilmmakingparanoiaguiltsurveillanceexploitationtechnology
Mood:
neo noirnightslasher
Locations:
snowhospitaltraincityrooftoptrain stationpennsylvaniacar in water
Characters:
serial murdererslasher killerserial killervillainkillerdoctorprostitutedetectivephotographerhitmanmurder of a prostitute
Period:
1980swinter
Story:
sadistic psychopathpsycho killerhomicidal maniacpsychopathic killerdrive in classicsadistictorturercreepypsychotronic filmserial murderslashingpsychoticrampagevictimpsycho …mutilationmaniackillingmurdererrescuecar accidentsurprise endingknifetitle spoken by charactergunfemale nuditynuditybare breastsfemale frontal nudityflashbacktwo word titlebare chested malechaseshowerwoman on topurinationwatching tvlingerievoyeuralcoholtelephonereportercleavageassassindisguisebridgestabbed to deathpoliticiansubwayassassinationunderwater scenegunshotpoint of viewscreamingpay phonecover upevil manattempted rapehairy chesttragic eventsplit screenfilm within a filmwitnessfireworkscult directorgraffititrusttape recorderrecordingcaught having sexcrying womanmovie theaterphone boothfroggrindhouseparadedead womanmale underwearwatching televisionwoman in jeopardydamsel in distressveteranslaughtermustachephiladelphia pennsylvanialonerbody countbriefscharacters killed one by onedead woman with eyes openkilling spreereckless drivingpolitical corruptionfilm industryinterrupted sexbad guymadmantruthsubway stationtelevision newsblackoutmotel roomrestroomgovernortv reporterwhodunitcarnageemergency roomwhite briefspresidential electionwoman in lingerienewscasthitchcockiantragic endingpresidential candidateenigmafemale victimstrangled to deathtapemurder spreetelevision reporterdisturbed individualbroken bottlegrindhouse filmwiretappingsoundslow motion action scenesubway trainundershirtgovernment corruptionpolitical assassinationwoman in showereye witnesspayphonemedia manipulationgarroterainy nightdisturbingred lighttirewoman strangled to deathaudio tapereconstructiondead prostitutegiallo esqueaudio recordingwearing a sound wirefish marketspying on couple having sexelectronicscold blooded murdernews broadcasteast coastwoman in perilmilitary veteranpolitical cover upice pickfilm businesswiretap360 degree panscreening roomanonymous telephone callimplied fellatiophone tapreference to benjamin franklinspying on someonebody mutilationsorority housepoint of view shotsteadicampaying for sexpsycho filmincriminating photographsound effectunwanted sexual advancesweeping womanbird's eye shotsound manediting roomfemale victimswearing a wiretelephone repairmancar off bridgeprojection roomsound engineersound effectscondescensionroman a clefnoisesoral sex in publicstreet prostituteblow outsound recordiststabbed with an ice picktire blow outhit on the head with a bottlereference to the zapruder filmsound equipmentyellsound mixingfoley artistliberty bellmurder in bathroomover dubbingartistic creationphiladelphiathe media (See All)

It (2017)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

It (2017)

In the Town of Derry, the local kids are disappearing one by one, leaving behind bloody remains. In a place known as 'The Barrens', a group of seven kids are united by their horrifying and strange encounters with an evil clown and their determination to kill It.

Subgenre:
american horrorsupernatural
Themes:
madnessabductionevilsadismpsychopathmurderdeathfearmonstermemoryracismbrutalitysupernatural powerbullyinghomophobia …crueltychildhoodcannibalismmissing childunlikely friendshipschool bullyingsupernatural powers (See All)
Mood:
gore
Locations:
small townschoolforestbicyclesewernew boy in town
Characters:
serial killervillainpoliceteenagerchildrenzombiebullylittle boyjewchildhood friendbar mitzvahboy in underwearevil father
Period:
1980ssummeryear 1989year 1988
Story:
sadistic psychopathpsycho killerserial child murdererchild murdererhomicidal maniacserial child killerchild killerpsychopathic killerbloody violencedeeply disturbed personcreepbased on novelmurder of a childbutcherpsycho …mutilationmaniackillingmurdererbasementtitle spoken by characterone word titlebloodviolenceflashbackkissblood splattercatbattlepaintingbookbathroompianodemongay slurnewspaperchild abusechildcoffinchild in perilcreaturelibraryclownmissing persondeath of brotherbrotherfirst partsevered armgaragesplattersistereyeglassesballoonstreetsexual abuseoverallscovered in bloodinterracial friendshipeaten aliveswitchbladebraverystabbed in the throatpedophileturtleabusive fatherbroken armcellarkilling spreeloss of brotherheroismunderdogpervertspittingbad guygirl in bra and pantiesoutcastwoodabandoned housebicyclingwellpharmacybare chested boypatricideparentraininggraphic violencejumping into watercleaningchild molesterfourth of julystutteringteenage girl in underwearpool of bloodreference to michael jacksonoverbearing motherold houseghoulglowing eyesevil clownsidewalkarm ripped offchild swearingchild killeddutch angleflickering lightkiller clownscreaming in fearpocket knifecamaraderiemonstersdisturbinghypochondriachit with a rockmissing person posterscreaming in horrorsinkfamily lifechild smoking cigaretteimplied incestadultererbitten in the facehell on earthinhalertraumatic childhoodviolence against a childeaster eggstorm drainslideshowdark killerheadless corpseleperplaster castreference to metallicaserial teen killerarm in a casthiding in a bathroomprojectortraumatic childhood experienceblood oathson kills fatherred balloonsadistic killerchildhood crushserial child murderevil creaturefear of clownscutting own hairmissing boystuttering characterthrowing stonesserial killerssexual child abuseslut shamingboy wearing glassesclosed doorreference to clark kentbullying victimfloating in the airpainting comes to lifecutting one's own hairdisappearance of a childflooded basementkilling a sheepreference to molly ringwaldthrown down a wellcutting the palm of one's handpaper boatreference to lois lanereference to new kids on the blockarm bitten offcarving into human fleshchild eaterchild rapistclown dollcursessheep farm (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Child's Play 2 (1990)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Child's Play 2 (1990)

Andy Barclay has been placed in a foster home after the tragic events of the first film, since his mother was committed. In an attempt to save their reputation, the manufacturers of Chucky reconstruct the killer doll, to prove to the public that nothing was wrong with it in the first place. In doing … so, they also bring the soul of serial killer Charles Lee Ray back to life. As Chucky tries to locate Andy, the body count rises. Will Andy be able to escape, or will Chucky succeed in possessing his body? (Read More)

Subgenre:
psycho thrilleramerican horrorblack comedysupernatural
Themes:
evilpsychopathescapedeathsupernatural power
Mood:
goreraincar chaseslasher
Locations:
chicago illinoisschool buswater gun
Characters:
serial murdererslasher killerserial killerterrorvillainkillerhusband wife relationshippoliceboyteachernew student
Period:
1990s
Story:
sadistic psychopathpsycho killerhomicidal maniacvillain not really dead clichepsychopathic killergruesomebloody violencebutcherybutcherpsychomaniacobscene finger gesturemurdererbasementslow motion scene …car accidentbloodsequelcigarette smokingsingingpunctuation in titlecorpsedigit in titlefalling from heightheld at gunpointsecond partapostrophe in titlefoot chasebound and gaggedstrangulationambulancethroat slittingstabbed to deathstabbed in the chesttied to a chairfalse accusationchild in perillimousinebeaten to deathelectrocutionpossessiondollevil manlightningdeath of husbandneck breakingthreatened with a knifefalling down stairsburned alivegothiclifting someone into the airtied to a bedtoynosebleedsevered handblack humorshovelstabbed in the legexploding headthrown through a windoweye gougingswingraised middle fingerstabbed in the eyesocial workersevered legsequel to cult favoritevoodoopajamasframed for murdersuffocationbad guymadmanhiding in a closetevil spiritclimbing through a windowelementary schoolhanging upside downburnt facehead bashed inactress shares first name with characteryuppiedripping bloodsewing machineorchestral music scorehiding under a beddigging a gravelocked in a roomliquor storetrail of bloodbedtime storyfire alarmevil dollfoster homepsycho terrormidwestthrown through a windshieldassembly linechantfoster parentlocked in a closetfalse accusation of murderfoster mothercar phonekiller dollfoster fatheraccused of murderdisbelieving adultpsycho filmreference to pinocchiohiding under the coverschild smoking a cigarettenewspaper manreference to hansel and gretelscore employs electronic instrumentstoy factoryfoster parentingsuffocated with plastic bagthrown down stairsevil smileelectric knifereflection in a car mirrorxeroxfoster sister (See All)

The Hills Have Eyes 2 (2007) is one of the best movies like Misery (1990)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Hills Have Eyes 2 (2007)

A team of trainees of the National Guard brings supply to the New Mexico Desert for a group of soldiers and scientists that are installing a monitoring system in Sector 16. They do not find anybody in the camp, and they receive a blurred distress signal from the hills. Their sergeant gathers a rescu …e team, and they are attacked and trapped by deformed cannibals, having to fight to survive. (Read More)

Themes:
evilinsanitypsychopathtorturemurderrevengedeathsuiciderapecannibalismrape and revenge
Mood:
goreslasher
Locations:
desertwaternew mexico
Characters:
slasher killerserial killerterrorvillain
Period:
year 2007
Story:
sadistic psychopathpsycho killerhomicidal maniacpsychopathic killersadisticbloody violencepsychotronic filmsledgehammerserial murderhuman monsterrampagebroken legpsychoragemaniac …stabbingrescueshot in the chestshot to deathsurprise endingfightfemale nuditynuditybare breastssequelexplosionpistolfirelickingcorpseblood splatterremakeshot in the headfalling from heightriflenumbered sequelf wordgood versus evilsurvivalgay slurarmyimpalementstabbed to deathstabbed in the chesttrainingbeaten to deathstabbed in the backevil mankicked in the faceshot in the shouldertragic eventexploding bodysevered armdismembermentsplatterropeclaim in titlemutantassaultaccidental deathguardsevered fingerhit in the crotchcannibalgash in the facestabbed in the headdynamiteaccidental killingminebody countaxe murderkilling spreenude woman murderedtorso cut in halffemale soldierblood on camera lensintestinesgiving birthbad guymadmanstrandedsexual violencestabbed in the armanal rapesuicide bomberbayonetmeat cleaverbleeding to deathextreme violencegraphic violencestabbed in the facedrillunwanted pregnancydeformitystupid victimhillgrindhouse filmbody partno endingstabbed in the mouthfalling off a cliffaxe in the headsevered tonguenational guardshootpregnant woman nudeskull crushingsequel to remakesickolong tongueraped by monstermutilated bodyumbilical cordtwisted anklegraphic rapeport a pottystillbirthtraining exercisesadistic torturedynamite explosionthrown from a cliffsemen in womanlast daywoman murderedfacial deformityfreeclimbing (See All)

Friday The 13th Part Viii: Jason Takes Manhattan (1989)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th Part Viii: Jason Takes Manhattan (1989)

The graduating class of the local high school is going on a luxury cruise with Jason Voorhees as a stowaway. The heroine Rennie Wickham believes she was almost drowned by Jason as a child. Jason eventually sinks the boat and kills many of the students on it, but many of them escape to Manhattan. A l …ong battle with Jason ensues until Jason is washed away in the New York sewers by a midnight flooding of toxic waste. (Read More)

Subgenre:
psycho thrilleramerican horrorindependent filmcult filmparanormal phenomenaslasher flickteen horror
Themes:
murder of a police officerevilpsychopathescapemurderrevengedeathmonstersupernatural powerdrug addiction
Mood:
gorerainhigh schoolslasher
Locations:
woodsnew york cityboatseacityamericasewer
Characters:
serial murdererslasher killerserial killerterrorvillainkillerteenage girlteenage boyzombiepolice officerteacher student relationshipmysterious villain
Period:
1980s
Story:
sadistic psychopathpsycho killerhomicidal maniacpsychopathic killerbutcheryserial murderbutcherrampagepsychomutilationmaniaccharacter's point of view camera shotstabbingviolenceblood …female nuditycharacter name in titlenumber in titlesequelbare chested maleexplosionpantiesblood splattermirrornumbered sequeldemonhallucinationguitarmanhattan new york citydecapitationflashlightgangnew yorkstrangulationaxevideo camerathroat slittingimpalementstabbed to deathsubwaywhite pantiesexploding carnecklacedrowningon the runblack pantieselectrocutionevil manattempted rapeunderwaterundeadhypodermic needlelifting someone into the airback from the deadmasked manmale underwearnew jerseyblack bradead childdisembowelmentslaughterstabbed in the eyebody countcharacters killed one by onesequel to cult favoritemasked killerbad guybeheadingmadmansummer campaccidental shootingstatue of liberty new york citycrushed headdisembodied headcruise shipmasked villainknife murdertoxic wastedeformitylunaticmetrooff screen murdermurder of a nude womanmurder spreemass murdererghoulbody paintblond boyeighth partpolice officer knocked unconsciouspsycho terrorstruck by lightningharpoondead teenagerhockey masklifting a female into the airtwin towerstrailer narrated by percy rodriguezlifeboatspear guneast coastjason voorheesmutilated bodyfriday the thirteenthkilled with a forkhit with a guitarwessex county new jerseycrystal lake new jerseyjerseyserial teen murdererbig applegirl strangling (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Halloweenviii: Resurrection (2002)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloweenviii: Resurrection (2002)

Serial Killer Michael Myers is not finished with Laurie Strode, and their rivalry finally comes to an end. But is this the last we see of Myers? Freddie Harris and Nora Winston are reality programmers at DangerTainment, and are planning to send a group of 6 thrill-seeking teenagers into the childhoo …d home of Myers. Cameras are placed all over the house and no one can get out of the house... and then Michael arrives home! (Read More)

Subgenre:
american horrorindependent filmcult filmslasher flickteen horror
Themes:
murder of a police officerevilpsychopathrevengedeathmurderfeardeceptionsurveillance
Mood:
goresatireslasher
Locations:
wheelchairwoodsforestkitchenrooftopfire truck
Characters:
slasher killerserial killervillainkillernurseteenage girlteenage boysecurity guardpsychiatristcoroner
Period:
2000s
Story:
sadistic psychopathhomicidal maniacpsychopathic killerserial murderhuman monsterold dark housenewspaper clippingrampagebroken legmaniackillingobscene finger gesturemurderercharacter's point of view camera shotsubjective camera …surprise endingknifebloodfightviolencefemale nuditysequelflashbacktwo word titlechasefirecell phonecorpseblood splatterfistfightmirrorwatching tvcomputercameraundressingbrawlfalling from heightmaskshowdownf worddecapitationgood versus evilhalloweenfoot chaseflashlightstrangulationaxeambulancemontagethroat slittingimpalementstabbed to deathstabbed in the chestinternetsevered headpolice officer killednews reportstabbed in the backelectrocutionproduct placementevil mankicked in the facecollege studentlightningskeletondisappearanceneck breakingthreatened with a knifesevered armchainsawheavy rainlifting someone into the airsecurity cameraloss of loved onemorgueskullfatemasked manmental institutionstabbed in the throatstabbed in the headblack brae mailrainstormraised middle fingergasolinebody countaxe murdercasual sexcharacters killed one by onesequel to cult favoritekilling spreemasked killerhalloween partytext messaginginterrupted sexvideo surveillancebad guyreturning character killed offhiding in a closetabandoned housewebcamclimbing through a windowwhodunithanging upside downlocked doorbreaking a windowjockbody baghanged manhead cut offfilmed killingmurder attemptbutcher knifeman on firelocked in a roombreaking through a doorpeep holestupid victimbreaking a mirrorx rayed skeletonsecret roomcrime spreeleg woundcamera focus on female buttimpersonatoreighth partmichael myersdead teenagerlifting a female into the airboogeymandeath by electrocutionskull crushingjumpsuitsee you in hellcult film referencedecomposed bodybutt grabserial teen killerclown maskpolice officer throat slitovernight in a haunted housereality tv productioneyes wide openwhite maskair hornreal movie shown in fictional situationcord (See All)

Natural Born Killers (1994)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Natural Born Killers (1994)

Mickey Knox and Mallory Wilson aren't your typical lovers - after killing her abusive father, they go on a road trip where, every time they stop somewhere, they kill pretty well everyone around them. They do however leave one person alive at every shootout to tell the story and they soon become a me …dia sensation thanks to sensationalized reporting. Told in a highly visual style. (Read More)

Subgenre:
psycho thrillerindependent filmcult filmblack comedy
Themes:
madnessevilsadisminsanitypsychopathescapekidnappingmurderdeathrevengelovesurrealismrapeprisonfear …deceptionincestseductioncorruptiondeath of fatherbrutalitydeath of motherparanoiadysfunctional familysurveillanceexploitationcrueltypolice brutalityprison escape (See All)
Mood:
neo noirgoresatirenightmarearchive footageslasherbreaking the fourth wallstylization
Locations:
woodsforestparis francedesertlondon englandkitchenfarmroad tripmotelgas stationcampfireroad movienew mexicoprison bus
Characters:
serial killerhostagehusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoobrother sister relationshipprostitutedetectivetough guynative american …waitresssecurity guardjapanesepolice detectivepsychiatristaustralianpolice shootoutself mutilationwitch doctor (See All)
Period:
1990s
Story:
homicidal maniacfemale serial killerpsychopathic killerfemale killerfemale psychopathhuman monsterpsychoticdark pasthighwayfanrampagevillainesssociopathmaniackilling …murderercharacter's point of view camera shotauthorwomansubjective cameraslow motion scenerescueshotgunshot in the chestshot to deathbeatingsurprise endingknifefightbloodviolencesexinterviewflashbackbare chested malecigarette smokingdancingphotographexplosionsingingthree word titlepantiespistolfirecell phoneshootoutdreamcorpseblood splatterfistfightmachine gunhorseurinationface slapshot in the headpunched in the facecameraarrestundressinggunfightbrawlshootingbookvomitingheld at gunpointbeersunglassesdemonjailhallucinationhandcuffstelevisioncriminalshot in the backf wordgay slurflashlightjournalistbound and gaggedambushstrangulationmassacremontagethroat slittingbridgestabbed to deathdinerprisonerstabbed in the chestweaponmapsnakechild abusesevered headdream sequenceanti herodisarming someonedouble crosscontroversypolice officer killedfemme fatalenews reportdrowningshot in the foreheadon the runflash forwardone against manycharacter repeating someone else's dialoguebeaten to deathprologueelectrocutionfantasy sequencefugitivepoisonon the roadangelevil mankicked in the facerabbittough girlringscene during end creditsconvertiblewitnessneck breakingpremarital sexthreatened with a knifefireworksnewspaper headlinesubtitled scenecorrupt copsplatterfreeze frameriotpickup trucktv newswolfburned alivemass murderlooking at oneself in a mirrortape recorderfamescene during opening creditssexual abusecowboy hatsecurity camerajail cellwalkie talkiekicked in the stomachpop culturemediacovered in bloodgrindhousesheepjournalismsadomasochismrape victimpart animationblack humortorchfateanimal attackmexican standoffschizophreniasocial commentaryhaircutmechanicwatching televisionredneckcrime scenehaunted by the pasttokyo japanprison guardstealing a carcynicismdual wieldstabbed in the throatanimated sequencemercilessnessironychaosblack and white scenetime lapse photographypunched in the chestsexual harassmentassault rifleaccidental killingarizonablood on shirtwedding ringknife throwinggasolineabusive fatherfemale reporterkilling spreeburned to deathmedia coveragefast motion scenesouthern accentbullet timeclose up of eyesdesert eaglenews reportershot through a windowblood on camera lensvillain played by lead actortaserstock footagefilm crewautographjukeboxrepressionfish tankcameramancoca colatornadoescaped convictanarchysawed off shotgunscorpiondeath rowshamanpatricideantwhite trashpiewoman kills a manshot in the handcorrupt policefight the systemextreme violencefilmed killingtragic pastwoman fights a manmatricidecrowbarfemale criminalnevadatabloidrattlesnakesex with a minorjailbreakpool of bloodcockney accentexposesnake biteanimal killingmass murdererprison wardensolitary confinementknocked out with a gun buttsocial decayinnocent person killedextreme close upkicked in the groincrime spreehorse chasemaceprison riotdrugstoredutch angleantidotesuper bowlgeneration xnewscastermedia manipulationsurprise during end creditswoman punches a manmass mediafemale bodybuilderescaped prisonermob of reporterspepper spraytelling a joketear gasgas grenadeshooting starreference to charles mansonriot policeimplied incestmagic mushroombleeped dialoguemulletmedia hypehuman shieldmurderer duoindian reservationlaundry roomslide locked backnavajotrippyyin and yanglaugh tracklovers on the lamtwo killerstraumatic childhoodknife in backtv journalisttime magazinenews crewshivmanicsevered toefugitive sextrampled to deathhanging bodyhowie screammedia exploitationpsychedelic imageeeny meeny miny moetv advertdarwinian struggle for survivalrear projectionorff carmina buranatabloid journalistpsychopathic copsnakebite poisonstargazing (See All)

Breakdown (1997) is one of the best movies like Misery (1990)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Breakdown (1997)

Jeff and Amy Taylor are moving to California and must drive across the country. When they find themselves stranded in the middle of a desert with hardly anyone or anything around, their trip comes to a sudden halt. Amy had taken a ride with a friendly trucker to a small diner to call for help, but a …fter a long time, Jeff becomes worried. He finds that no one in the diner has seen or heard from his wife. When he finds the trucker who gave Amy the ride, the trucker swears he has never seen her. Now Jeff must attempt to find his wife, who has been kidnapped and is being held for ransom. But who can he trust? (Read More)

Subgenre:
psycho thrillersuspensecult filmconspiracy
Themes:
abductionpsychopathangerescapekidnappingrevengemurderdeceptionparanoia
Mood:
neo noircar chase
Locations:
desertrural settingtruckcar explosion
Characters:
serial killerhostagehusband wife relationshippolicepolice chasetruck driver
Period:
1990s
Story:
psychological torturedeeply disturbed personmysterious strangertauntingphysical abuseintimidationfight to the deathhighwaytensiondesperationcaptivesociopathmaniacisolationduel …car crashshotgunshot in the chestbeatingone word titleviolencegunchasecell phoneshootoutfalling from heightvomitingshowdownlieheld at gunpointriverfoot chasegangstrangulationdinerexploding carorganized crimebinocularspay phoneon the roadvacationmissing personkicked in the facebankmanipulationstalkingcontestdie hard scenariotied upjeepcowboy hatbarnmexican standoffcrushed to deathransomduct tape over mouthredneckwoman in jeopardyconfrontationmercilessnessstabbed in the neckescape attemptaerial shotone dayduct tapeextortionchaingunfiresouthern accentsweathit by a truckswimming underwatersleeping in a carcarjackingoverturning carmenacecar breakdownheathitchcockianfemale victimstupid victimdonutcat and mousechild with a guntruck stopauto theftcrushed by a carfall to deathperson in a car trunkrailroad crossingpadlockpokiesemotional abusetemperautomobile accidentplan gone wrongbank accountbound with duct tapeland rovermurderer duodumb policejunk foodstolen goodsmissing wifecoolermoney transfercar falls into waterhiding in a bathroomfat guy18 wheelerletter openerswiss army knifedriving in the wrong directionhit by a falling objecthit with a gun buttillegal businesstaking the law into one's own handsstolen vehiclecrashing through a gatenear misscleaning a carplaying dumbstolen license platejack knifed truck (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Joker (2019)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Joker (2019)

Forever alone in a crowd, failed comedian Arthur Fleck seeks connection as he walks the streets of Gotham City. Arthur wears two masks -- the one he paints for his day job as a clown, and the guise he projects in a futile attempt to feel like he's part of the world around him. Isolated, bullied and  …disregarded by society, Fleck begins a slow descent into madness as he transforms into the criminal mastermind known as the Joker. (Read More)

Subgenre:
suspensecult filmblack comedystand up comedydark comedytragedypsychological thriller
Themes:
madnesswritingevilmental illnessinsanityobsessionpsychopathlonelinessangerinvestigationescaperevengemurderdeathlove …moneybetrayaldrunkennessdancegangsterdeceptioncorruptiondeath of fatherbrutalitydeath of motherdepressionhumiliationabusehome invasionadoptioncrueltyunemploymentrevolutionpolice brutalitymurder investigationmurder of familychildhood traumapsychological trauma (See All)
Mood:
darknessneo noirgoreambiguous endingstand updownward spiral
Locations:
hospitalbathtubbuselevatorurban settingapartmentpolice carcitytaxi driver
Characters:
serial killervillainnursepolicemother son relationshipafrican americanpolice officerdetectivesingle motherinterracial relationshiplittle boypolice detectivepsychiatristcomedianemployer employee relationship …stand up comedianpolice chaseneighbor neighbor relationshipdysfunctional relationshippolice violencedeath wishrunning from the policedancing in underwear (See All)
Period:
1980syear 1981
Story:
psycho killerbloody violencedeeply disturbed personpsychotronic filmserial murderdark pastmedicationtensionrampagepsychoragesociopathmaniackillingmurderer …isolationcar crashslow motion sceneshot in the chestcar accidentshot to deathbeatingsurprise endingtitle spoken by characterone word titlefightbloodgunviolencecharacter name in titleinterviewflashbackbare chested malecigarette smokingdancingsingingchasepistoltelephone callfiredreamunderwearblood splattermirrorurinationshot in the headpunched in the facewatching tvwritten by directorarrestmasklettershootingbased on comiclieheld at gunpointrunningbathroomneighborpianohallucinationrevolvertelevisionfightingcriminaltelephoneshot in the backf wordfoot chasenewspaperorphanbased on comic bookambushdisguiseambulancemontagestabbed to deathdinerweaponsubwayjokechild abuseno opening creditsanti herohit by a cardouble crossbathcontroversynews reportshot in the legshot in the foreheadpainconfessionargumentstalkermicrophonedangerportraitbusinessmanclownprotestlocker roomfired from the jobliarfantasy sequencepay phonereadingkicked in the faceopening action scenediarydomestic violencelong takescarpianistbodyguardstalkingthreatsadnessloss of fatherratsuspicionstageloss of motherprofanitylove interestvigilanteclass differencesgraffitinewspaper headlinesingle parentriotinterracialapplausetv newslive broadcastanswering machinemedicinerevelationstreetheavy rainlooking at oneself in a mirrorfamevandalismkicked in the stomachassaultmovie theaternosebleedvideotapeblockbusterimpersonationphone boothtv showrape victimfollowing someoneschizophreniasocial commentarymasked manmale underwearblack womanapartment buildingmental institutiondwarfface paintsufferingcynicismblood on facehatredkickingmercilessnessironychaosdiscussionrejectionstabbed in the neckmillionairemental hospitaldelusionescape attemptscissorsbutlerlaughteraccidental killingsocietyrefrigeratortuxedostabbed in the eyelonerdressing roomsocial workeropening a doorexistentialismbriefslaughingalienationdc comicsswearingcrowdmedia coveragepiano playervillain played by lead actorsuffocationmental patientmagic trickface maskalleynotebookoutcastdark secretstreet gangmoney problemsmental breakdownmen's bathroomspiral staircasesubway stationjournalsuit and tiepiano playingstaircasestrikecheering crowdself defensehospital roomflareurban decayinsane asyluminterracial kissanarchynarcissismstrokeadopted sonnihilismstrong languageman kills a womanoffscreen killinggun violenceafrican american womanmale protagonistaltered version of studio logowhite briefstv studiofilmed killingalter egodeath of familybus ridematricideradio newsloss of familyhoodiecockney accentunwanted kissgarbage canreference to batmanweight lossfinger gunsocial decayevil clownextreme close upfictional citystabbed with scissorsstreet vendorabusive mothertragic villainsubway traintv hosttalk show hostreading a lettermental asylumkiller clownmass mediamental disordermoral ambiguitycriminal mastermindel trainapplying makeupcomedy clubstreet performertelling a jokegreen hairburning carfictional talk showsick motherbad mothersmileanti villainhospital visitclown makeupsupervillaininfamybleeped dialoguefemale psychiatristpsychological tormentnickname as titlecharity benefitgarbage bagson murders motherjokerblood on walldancing in the streetorigin storyirrational behaviorsmothered with a pillowstrange behaviorsiren the alarmbanging head against wallquestioned by policeurban violenceill motherbad guy winsclown maskfighting the systemfalse friendcivil unrestback alleycriminally insanepublic transportinner conflictsocial unresttrash bagbloody footprintdysfunctional societymayoral candidateviolent outburstchildren's hospitalpsychological disorderarkham asylumdriven insaneopening creditspublic transitstreet riotlife of crimegotham cityhappy faceexit signkiller as protagonistsubway ridevillain as protagonistco worker co worker relationshipkilling a ratblood spattered faceerratic behaviorsad clownsubway platformsympathetic villainthe jokerwhite paintaccidentally firing a gunhit by a taxireference to wall streetuncontrollable laughterurban decadencedysfunctional personmass protestmurderer as protagoniststreet trashtrash can (See All)

The Last House On The Left (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Last House On The Left (2009)

While being transported by two detectives in a car, the dangerous criminal Krug is rescued by his brother Francis and his girlfriend Sadie, and they brutally kill the detectives. Meanwhile Emma, her husband John, and their daughter Mari Collingwood head to their summer home near the lake. Mari borro …ws the family car to meet her friend Paige that is working in a store in the town. While in the store, they befriend a teen boy named Justin, who offers some marijuana to Paige in the motel where he is lodged. While they are smoking marijuana in Justin's room, Krug, Francis, and Sadie arrive and abduct the girls. Krug drives Mari's car and she causes them to crash into a tree. Krug stabs Paige and rapes Mari; however Mari manages to escape, swimming in the lake, but Krug shoots her in the back. They walk through the isolated road in the woods and they reach Collingwood's house telling that they have just had a car accident. Emma and John welcome the strangers until they discover what has happened to their beloved daughter. (Read More)

Subgenre:
american horror
Themes:
murder of a police officersadismpsychopathescapetorturekidnappingdeathrevengemurderfriendshiprapebrutalityguiltcrueltyvengeance
Mood:
goreslasherhorror movie remake
Locations:
woodsforestboatkitchenlakemotelstorm
Characters:
serial murdererserial killerterrorkillerhostagehusband wife relationshipfather son relationshipfather daughter relationshipmother daughter relationshipdoctorbrother brother relationshipteenage girl
Story:
psycho killerhomicidal maniacfemale serial killerpsychopathic killerfemale killerhuman monsterfight to the deathragesociopathmaniacmurderercar crashshot in the chestcar accidentbeating …violencebloodfemale nudityfemale frontal nuditybare chested malefemale rear nuditychasepantiespistolshowercell phonecorpseblood splatterremakeshot in the headpunched in the facemaskheld at gunpointshot in the backswimmingcleavagefoot chasebound and gaggedwinestrangulationdeath of friendstabbed to deathstabbed in the chestwhite pantiesscantily clad femalenecklaceon the runstabbed in the backliarfugitiveknocked outkicked in the facedeath of brotherdeath of sonthreatened with a knifegirl in pantiesfalling down stairspot smokingfireplaceno pantiesstabbed in the stomachcoitusrape victimrapistwoman in jeopardystealing a carpunched in the stomachgunshot woundstabbed in the headexploding headjumping through a windowpanties pulled downperversionconvictrainstormabusive fathersexual assaultcopulationmarijuana jointgirl in bra and pantiesmadmanparalysisviolence against womenshot in the neckhead woundmisogynistremorsefemale friendshipsexual violence17 year oldescaped convictshot in the eyenihilismheld captivesummer vacationunderage smokingnaked dead womancountry housebroken nosegropingfemale criminalbutcher knifehit with a hammercoughing bloodfemale victimmurder of a nude womanbreaking a bottle over someone's headsexual humiliationknife held to throatdepravitymicrowave ovenserial rapistchild with a gunswimming in underwearsexual predatortortured to deathremake of american filmrunning for your lifeescaped prisonerdelinquentrailroad crossingsexual crueltyhit with a rockhands tied behind backgirl stripped down to bramismatched bra and pantieshit on the head with a fire extinguisherseat beltstitchessummer houseboathousefire pokerfemale sociopathgarbage disposalguest housenihilistrunning out of ammoescaped killerclothes torn offremake of remakecauterizationbegging for liferapist comeuppanceprison escapeeshot through the eyesprayed with fire extinguisherremake of swedish film (See All)

Manhunter (1986)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Manhunter (1986)

Will Graham is a former FBI agent who recently retired to Florida with his wife Molly and their young son. Graham was a 'profiler'; one who profiles criminal's behavior and tries to put his mind into the minds of criminals to examine their thoughts while visiting crime scenes. Will is called out of  …his self-imposed retirement at the request of his former boss Jack Crawford to help the FBI catch an elusive serial killer, known to the press as the 'Tooth Fairy', who randomly kills whole families in their houses during nights of the full moon and leaves bite marks on his victims. To try to search for clues to get into the mind of the killer, Will has occasional meetings with Dr. Hannibal Lecktor, a charismatic but very dangerous imprisoned serial killer that Will captured years earlier which nearly drove him insane from the horrific encounter that nearly cost Will's life. With some help and hindrance, Will races against the clock before the next full moon when the 'Tooth Fairy' will strike again. Elsewhere, a local photographer named Francis Dollarhyde, the killer that Will is looking for, struggles to stay undetected while seeing a hope of redemption when be begins a relationship with a blind woman who is not aware of his double life. (Read More)

Subgenre:
suspenseindependent filmcult film
Themes:
murder of a police officermadnesssadisminsanitypsychopathinvestigationtorturekidnappingdeathmurderprisonbrutalityguilthome invasioncannibalism …blindnessmurder of family (See All)
Mood:
neo noirgoreslasherstylization
Locations:
wheelchairwoodsbeachforestairplanepolice station
Characters:
mysterious killerserial killervillainkillerhostagehusband wife relationshipfather son relationshippolicemother son relationshipboyfriend girlfriend relationshiptattoodetectivehomosexualitypsychiatrist
Period:
1980s
Story:
sadistic psychopathpsychopathic killerpsychological tortureweirdobased on novelserial murderhuman monstermurder of a childpsychosociopathsearchwomanshotgunshot in the chestcar accident …shot to deathone word titlebloodgunviolencebare chested malecigarette smokingphotographtelephone callcell phoneshootoutdreamcorpseblood splattermirrorgunfightkissingshootingshowdownheld at gunpointrevolvercriminaltelephonegood versus evilgay slurjournalistambushstabbed in the chesttied to a chairman with glassescultanti heroshot in the legstalkerhotel roomfbiperson on firemistaken identityrace against timeevil manstalkingtrappremarital sexcharacter says i love younewspaper headlinewashington d.c.freeze framesupermarketelectronic music scoregothictape recorderfbi agentvideotapefloridahome movieparking garagecrying manwhite housemental institutioncrime scenepump action shotguncannibalgash in the facemental hospitalpsychotronicmiami floridapolice officer shotjumping through a windowblack eyedisfigurementtigernotekilling spreephoneburned to deathholding handsman cryingveterinarianpolice officer shot in the chestbroken mirrorbearded mankiss on the lipsscene of the crimeblind womanpalm treepsychoanalysisdarkroomwatching a videoman on firebaltimore marylandtoilet paperbreaking a mirrorpsychosisnewspaper reporterwoman in dangerdepravityman in a wheelchairslide showtalking to oneselfset on fireposing for a photographcriminal mastermindcoming out of retirementst. louis missouriliterary adaptationfamily in dangerslide projectorends with freeze frameforensicsphone conversationfamous songoedipus complexgrocery shoppinganthropophagusneonreference to the new york timesvoice recordingtwo killerscharacter appears on front page of a newspaperreference to houdinicode breaking8 trackreference to harry houdiniprofilervisually impaired personclimbing a ropefamily photohomicide investigationlighting a cigarette for a womantabloid reporterfirearm pointed at the cameraphoto labphotograph in newspaperreference to william blakefbi profilerhannibal lecterface slashedgin and tonichaving picture takenbalding mannote read aloudfax transmissioncamera flashmalevolencevhs videoex fbi agentlighting a cigarette for someonepreventing a murderforensic psychiatristmuzzle flashphreakingpunching one's fist into a mirrorred dragontied to a wheelchair (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Dead Calm (1989) is one of the best movies like Misery (1990)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Dead Calm (1989)

An Australian couple take a sailing trip in the Pacific to forget about a terrible accident. While on the open sea, in dead calm, they come across a ship with one survivor who is not at all what he seems.

Subgenre:
suspensecult film
Themes:
insanityobsessionpsychopathtorturekidnappingdeathmurderrapeadulteryseductionbrutalitydrug usegrief
Mood:
rainnightmarenight
Locations:
hospitaltrainaustraliapolice carseashipoceanyachtstorm at seaship on fire
Characters:
serial killerterrorhostagehusband wife relationshippolicedoctorpolicemandancerphotographeraustralianaustralian abroaddeath of killer
Story:
psycho killerpsychological torturedeeply disturbed personbased on novelpsychoticmedicationcaptivesociopathmaniacmurdererisolationduelsubjective camerarescueshotgun …car accidentbeatingknifefightviolencebloodsexfemale nuditymale nudityfemale frontal nudityflashbackmale rear nuditydogtwo word titlebare chested malekissfemale rear nuditycigarette smokingdancingphotographchaseshowerfirecryingsongcorpsefoodbare buttheld at gunpointtearssunglassesdead bodyswimmingflashlightsubwayapologyradiounderwater scenedrowningbinocularsmicrophonekeyevil mandeath of childdeath of sonsuspiciondie hard scenariosurvivorwristwatchstrangerhome movierailway stationblack humorpassportwoman in jeopardydivingphoto shoottrappedpillsloss of sonhit in the crotchdeath threattitle appears in writingrowboatexploding headdead childevidenceone dayrainstormsailoropening a doornude woman murderedminimal castalonesailboatsailingraftdegradationmarried coupleflareunconsciousnessdruggedswimming underwaterlying on bedman in swimsuitstabbed in the shouldershot through the mouthtitle same as booksole survivorbreaking through a doorflare gunmass murdererdriving at nightkicking in a doorknocked out with a gun buttradarvoyagecat and mousepacific oceanhands tiedwriting in bloodlooking at picturebathing suitmovie projectorsleeping pillsharpoonfood poisoningdeath of dogmerry christmasthrown through a windshieldnaval officerwashing hairabandoned shipspear gunwoman in perildead body in waterblonde childwater pumprotting corpsefilm with ambiguous titlearm injurysalvagenitrous oxidesinking boatkilled in a car accidentpumpnauseagas canmarlboro cigarettesman punches womanwife's sexual pretenceengine roomflare gun as weaponreference to joni mitchellbanging on a doorschoonerhead on collisionflooded roomreference to julio iglesiasday for nightplaying fetch with a dogdingyreference to orpheusfuel gaugebotulismpulling someone's hair (See All)

Disturbia (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Disturbia (2007)

After his father is killed in a car accident, things unravel for Kale Brecht and he is placed under house-arrest for punching his Spanish teacher. Having nothing better to do, Kale occupies himself by spying on his neighbors. But one night, he witnesses what appears to be a murder going on in Mr. Tu …rner's house. Kale becomes obsessed with uncovering the truth behind these murders but, after a few unsettling run-ins with Mr. Turner, it becomes a matter of life and death. And the ominous question: Who is watching whom? (Read More)

Subgenre:
suspenseblack comedy
Themes:
murder of a police officerpsychopathinvestigationescapekidnappingdeathrevengemurderfriendshipbetrayaljealousydrinkingvoyeurismdeath of fatherparanoia …photographypanic (See All)
Mood:
neo noirhigh schoolslasher
Locations:
swimming poolcarbicyclepolice carcourtroomrooftopstormfishing boat
Characters:
serial killerterrorvillainwriterfather son relationshippolicemother son relationshipfather daughter relationshipteenagermother daughter relationshipfriendboyteenage boyteacherstudent …policemandancerpolice detectivecousin cousin relationship (See All)
Story:
homicidal maniacpsychopathic killerhuman monsterthunderrampagebroken legpsychocaptivesociopathmaniacobscene finger gesturebasementduelwomancar accident …knifetitle spoken by characterone word titlegunbloodfightviolencedogkissdancingpartychasetelephone callcell phonecorpseblood splatterfoodpunched in the facewatching tvcomputerdrinkarrestbikinibookplace name in titlerunningdead bodybathroomneighborhandcuffsvoyeurclassroomswimmingnewspapervideo cameraeatingimpalementstabbed to deathstabbed in the chestjudgesevered headtrialfishingflash forwardbinocularssuburbmissing personevil manreadingrabbitbaseball batlightningskeletonpranklong takescarwighigh school studentstalkingwitnessneck breakinggardenclasssubtitled scenegarageflirtingtv newsteen angstbreaking and enteringlistening to musicassaultskullparking garagebarefootwoman in jeopardywindtelescopespanishbroken glassshovelscissorsstabbed in the legyoung lovedeerduct tapeextortioncellarkilling spreereckless drivingchocolatexboxbad guyearphonesmadmanboredomclosetlaundrycoca colalistening to a radiostakeoutxbox 360bunk bedplaying a video gamereference to youtubemercedes benzshirtford mustanghitchcockianbmwcamera phonenewlywedbutcher knifeleg injurysecret roomcurtainfictional cityfordhardware storetv hostlawn mowerchevroletsnorricamwatching someoneipoddishwashermissing womanpeanut butterhouse arrestmoving vanpsphdtvdead deerred bullgarden shearswet jeanslawn mowingporch swingoverturned carcarcasscocoonjaguar cardecomposed bodyplaystation portablefelonybagelfelonford crown victoriasurgical toolvolkswagen new beetlelexusmoverankle monitor1 year latervolvo cartwinkiesapple macbookitunesspanish teacherhonda accordlove seekingapple macbook proreference to ituneschevrolet tahoeelectronic tagford f150 pickup truckjaguar s type (See All)

The Loved Ones (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Loved Ones (2009)

In order to avoid a ghostly figure in the road, high school senior Brent Mitchell wraps his car around a tree, killing his father. Constantly confronted by his mother's emotional collapse after the accident, Brent escapes into a marijuana fueled world of loud metal music to block the pain and guilt. … Dejected and out of sorts, he has a shot at happiness with his girlfriend Holly, a grounded, caring girl with drop dead good looks, a dream date for the high school prom. But his plans are thwarted by a disturbing series of events that take place under a mirrored disco ball, involving pink satin, glitter, syringes, nails, power drills and a secret admirer. Brent has become the prom king at a macabre, sadistic event where he is the entertainment. (Read More)

Themes:
madnesssadisminsanityobsessionpsychopathescapetorturekidnappingrevengedeathmurderfriendshipdrugsjealousyfear …incestdeath of fatherbrutalitydysfunctional familyhumiliationunrequited lovecrueltycannibalismvengeance (See All)
Mood:
gorehigh schoolnightone night
Locations:
small townaustraliapolice carsex in caroral sex in a car
Characters:
terrorhostagefamily relationshipspolicemother son relationshipfather daughter relationshipteenagerfriendboyfriend girlfriend relationshipteenage girlteenage boyself mutilationself justice
Story:
victim invited to dinnermad womanpsychopathic killerfemale killerfemale psychopathsadisticphysical abusevictimdesperationcaptiveragekillingstabbingcar crashknife …gunviolencebloodsexfemale nuditynumber in titledogbare chested malepartypunctuation in titlecryingcell phoneblood splattercondomundressingrunningfightingsurvivalflashlightstabbed to deathdrawinghit by a carfemme fatalemissing personscreamhigh school studentloss of fathertied upcharacter says i love youteenage sexpot smokingteen angstballoonloss of loved onehammerdead womanconfrontationhatredmercilessnessgash in the facerejectionstabbed in the necktaking a pictureescape attemptheartdead manfamily dinnerdead motherparentsstrugglerunning awaykilling a dogdead fatherlockerdegradationmaking outinfatuationteenage daughterheld captiveobsessive loverazor bladepromatrocitycrazinesskiller childvolkswagenfatal attractionteenage crushmatricidesalthopelessnessrock climbingspoiled bratstabbed in the footforkhostilityenduranceemaciationhigh school dancerosesmale tied uprun over by a carhigh school promdrill in the headsavagerycuttertoolboxstruggle for survivalwill to liveprom queenself defenceelectric drillprom dressmaking out in a cartroubled teenage girlfemale in brahole in the headprom kingbleeding footfemale jealousypsycho girl (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Nick Of Time (1995)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Nick Of Time (1995)

Gene Watson is a public accountant who arrives on a train at Union Station in Los Angeles, accompanied by his 6-year-old daughter Lynn. Because of his ordinary looks, he is approached by a pair of sinister people named Smith and Jones. Pretending to be cops, Smith and Jones kidnap Lynn and confront  …Gene with a simple choice -- kill California governor Eleanor Grant in 90 minutes or less, or Lynn will die. Watson is given a gun, six bullets, and a name tag, and he is told to go to the Westin Bonaventure Hotel and kill Eleanor, who is giving an afternoon speech. While Jones is watching Lynn in a van, Smith watches Watson in order to prevent Watson from alerting the authorities. Watson must quickly find some way to get himself and Lynn out of this seemingly impossible situation. (Read More)

Subgenre:
psycho thrillersuspenseblack comedyconspiracypsychological thrillerpolitical thrillerpolitical conspiracy
Themes:
abductionobsessionpsychopathescapetorturekidnappingrevengemurderdeathmoneybetrayalpoliticsfeardeceptioncorruption …brutalityparanoiablackmailsurveillancepanicnear death experienceunlikely hero (See All)
Mood:
neo noir
Locations:
wheelchairbartrainhotellos angeles californiataxielevatorkitchentaxi drivertrain station
Characters:
hostagehusband wife relationshipfather daughter relationshippolice officerlittle girlsecurity guardjapanesemaidsingle fatherex soldierfrench kissmysterious villain
Period:
1990s
Story:
female psychopathpsychological torturedeeply disturbed personmysterious strangertauntingphysical abuseintimidationtensiondesperationcaptivesociopathmaniacobscene finger gesturecharacter's point of view camera shotduel …subjective cameraslow motion scenerescueshot in the chestshot to deathbeatingsurprise endingfightgunbloodviolenceflashbackphotographchasepistolshootoutdreamcorpseblood splatterfistfightface slapshot in the headpunched in the facewatching tvgunfightbrawlfalling from heightvomitingshowdownheld at gunpointsunglassesrevolvershot in the backf wordfoot chasestrangulationvideo cameradisguisepoliticiantoiletman with glassesdisarming someoneassassinationchild in perildouble crossvannews reportshot in the legshot in the foreheadbartenderlimousinestalkercharacter repeating someone else's dialoguedangerscreamingkeywidowerelectrocutionfantasy sequencepay phonemissionproduct placementrace against timesuitcaseevil manknocked outbaseball batshot in the shouldermanipulationspeechbodyguardstalkingsuspiciondie hard scenarioshot in the armsecret agentsilencercorrupt copsingle parenteavesdroppingwaiterfalling down stairsbulletassassination attemptballoonlooking at oneself in a mirrorshot in the stomachsecurity camerawalkie talkieloss of loved onewristwatchpress conferencejumping from heighttimeteddy bearfollowing someonemexican standoffclockjanitorshopliftingcynicismimpostormercilessnesspunched in the stomachdark humorevacuationkicked in the crotchescape attemptsenatorpunched in the chestone daybulletproof vestraised middle fingermustacheethnic slurkilling spreegovernment agentmoral dilemmapolitical corruptionmedia coveragesouthern accenthit with a baseball batimpersonating a police officernews reporteraccountantmysterious manstuffed animalfountainvomitpistol whipmen's bathroomsuit and tiedisposing of a dead bodyamputeegovernorcameramanhired killerassistantcampaignbusiness cardman kills a womanmarching bandcorrupt politicianroller skatingtrumpetmetal detectorcamcorderorchestral music scoremenacemysterious womannervousnesshomeless personhitchcockianfrenchmancarrotfemale victimassassination plotsocial decaywalkmaninnocent person killedreal timenews footageextreme close upvietnam war veterancat and mousegovernment conspiracyred herringenvelopecoerciondutch anglegovernment corruptionpolitical assassinationman fights a womanskaterprosthetic limbthick accentman punches a womantemperconservatismplan gone wrongthrown from heightprosthetic legcold blooded murderlobbyistmurderer duofemale politicianhotel suitebellboyname tagrollerbladinghit in the stomachderangedman with a ponytailplacardpolitical speechcampaign managerjack danielsreference to godzillashoeshineroller bladescoloring booklos angeles storm drainthrown off a balconyeverymanwindow cleaneriris shotshoeshine boykey cardroller bladerripping a telephone from the walldigital clocknewsmanpartial deafnesstaking law into own handshors d'oeuvres (See All)

Curse Of Chucky (2013) is one of the best movies like Misery (1990)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Curse Of Chucky (2013)

After the events of Seed of Chucky, Nica, a young woman forced to a wheelchair since birth, has to regroup her sister, Barb and her brother-in-law, Ian for a funeral after the death of her mother. While dealing with Barb, Ian, along with their 5-year-old daughter, Alice; Nica receives an odd package … - a creepy doll. After people start showing up dead, the fearless Nica soon suspects that the creepy doll is much more than just a doll. (Read More)

Subgenre:
american horrorparanormal
Themes:
murder of a police officerevilsadismpsychopathescapemurderdeathadulteryfuneralsupernatural powerdeath of mothermurder of family
Mood:
goreslasher
Locations:
wheelchaircemeteryelevatorcourtroom
Characters:
slasher killerserial killerterrorfamily relationshipshusband wife relationshipmother daughter relationshippolice officersister sister relationshipaunt niece relationshipbrother in law sister in law relationship
Period:
year 1988year 2013
Story:
homicidal maniacvillain not really dead clichedark and stormy nightcreepyold dark housewomancar crashslow motion scenesurprise endingknifeviolencebloodcharacter name in titlesequelflashback …lesbian kisscorpseblood splatterwritten by directorfalling from heightf worddecapitationaxethroat slittingstabbed to deathtied to a chairjudgesevered headchild in perilcharacter repeating someone else's dialoguestabbed in the backelectrocutiondollelectronic music scorescene during opening creditssevered handhome movieduct tape over mouthcameoblack and white scenestabbed in the legscene after end creditsevidencedeath of sistereye gougingstabbed in the eyeaxe murdernannyclose up of eyesblood on camera lenscartoon on tvbag over headblackoutfilm projectoryoung version of characterblood stainwoman in bra and pantieseyeballwrongful convictionparaplegicsixth partstabbed in the facedirect to video sequel to theatrical moviehandicappedstabbed with scissorsdeliveryevil dollhorror iconreference to charles mansondeath by electrocutionkilled in police carmanic laughterkiller dollmurder disguised as suiciderat poisonsunflowerjump scaremurdered priestpolice officer throat slitanimate dollvictorian houseelectronic music score in style of orchestral music scorenanny campoisoned food (See All)

The Silence Of The Lambs (1991)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Silence Of The Lambs (1991)

FBI trainee Clarice Starling works hard to advance her career, while trying to hide/put behind her West Virginia roots, of which if some knew, would automatically classify her as being backward or white trash. After graduation, she aspires to work in the agency's Behavioral Science Unit under the le …adership of Jack Crawford. While she is still a trainee, Crawford asks her to question Dr. Hannibal Lecter, a psychiatrist imprisoned, thus far, for eight years in maximum security isolation for being a serial killer who cannibalized his victims. Clarice is able to figure out the assignment is to pick Lecter's brains to help them solve another serial murder case, that of someone coined by the media as Buffalo Bill, who has so far killed five victims, all located in the eastern US, all young women who are slightly overweight (especially around the hips), all who were drowned in natural bodies of water, and all who were stripped of large swaths of skin. She also figures that Crawford chose her, as a woman, to be able to trigger some emotional response from Lecter. After speaking to Lecter for the first time, she realizes that everything with him will be a psychological game, with her often having to read between the very cryptic lines he provides. She has to decide how much she will play along, as his request in return for talking to him is to expose herself emotionally to him. The case takes a more dire turn when a sixth victim is discovered, this one from who they are able to retri… (Read More)

Subgenre:
psycho thrillersuspensecult film
Themes:
murder of a police officermental illnesspsychopathinvestigationescapekidnappingmurderrevengefriendshipsuicideprisonbrutalitycannibalismmurder investigationstarvation
Mood:
neo noirgore
Locations:
airplaneairportelevatormuseumsinging in a car
Characters:
serial killerterrorvillainkillerhostagepolicefemale protagonistdetectivetranssexualhomosexualitypsychiatrist
Period:
1990s
Story:
sadistic psychopathbased on novelserial murderhuman monsterdark pastvictimpsychologymutilationsociopathmaniacmurdererbasementisolationwomanrescue …surprise endingviolencef ratedsequelflashbackmale frontal nuditymasturbationbased on bookshootoutcorpseblood splattermaskanimal in titlehandcuffsmale pubic hairrevolvergood versus evilorphanambulancesevered headman with glassespolice officer killednews reportfive word titletraininglibrarybeaten to deathfbipay phonerace against timeevil manpursuitloss of fatherwashington d.c.strong female characterchessflirtingtv newsheroinemass murdergothicfbi agentagentblockbusterswat teamclassical musicpsychologiststrong female leadmental institutionhaunted by the pastcouchpet dogcannibalfemale leadsenatordisembowelmentautopsybody countgay stereotypeimpersonating a police officerbad guybarking doggraduationohioloss of daughterwellmind gamestrait jacketfemale herotransvestismvirginiapsychoanalysisfuneral homeillinoiswakemusic boxorchestral music scoretragic pastsewingbaltimore marylandsexual identitymass murdererelevator shaftfamous linenight vision gogglesu.s. senatormemphis tennesseesecret pastcourthouseanimal in cast creditsbucketdrugstorerookie copjail breakacademymarylandcharacter appears on tvmothwest virginiadoor bellbahamassevered facefat girleffeminacyobstacle courseanthropophaguschildhood flashbacktwo killerscocoonfemale fbi agenttraumatic childhoodentomologistanagrambad guy winscase filebased on ed geincontemporary settingstorage facilitypolice trainingskinningsmall doglights suddenly go outpolice officer bittenescape from handcuffswearing human skinmace sprayreference to barry manilowsinging along with a recordhuman in a cageunhappy childhoodmoving furnituresinging along with radiohead in a jarmanginapolice batonfemale senatornight vision sequencepoodle dogfbi traineemuzzle flashobject made of body partobject made of human skinsenator's daughtersmithsonian institutionreference to hannibal lecter (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Showing Top 50 Matches Above.
Do you need specific genre & keyword selection to find films similar to Misery?
<< FIND THEM HERE! >>