Please wait - finding best movies...
It's time for Christmas break, and the sorority sisters make plans for the holiday, but the strange anonymous phone calls are beginning to put them on edge. When Clare disappears, they contact the police, who don't express much concern. Meanwhile Jess is planning to get an abortion, but boyfriend Pe β¦ter is very much against it. The police finally begin to get concerned when a 13-year-old girl is found dead in the park. They set up a wiretap to the sorority house, but will they be in time to prevent a sorority girl attrition problem? (Read More)
Subgenre: | holiday horrorpsycho thrillerslasher flickchristmas horrorcanadian horrorindependent horroramerican horrorpsychological thrillersuspenseblack comedycult filmindependent film |
Themes: | mysterious deathmurder of a police officerpolice investigationabortionmental illnessobsessionpsychopathincestvoyeurismdrunkennesspregnancychristmassuicidemurder |
Mood: | one nightambiguous endingdarknessslasheravant gardegore |
Locations: | citypolice stationsmall town |
Characters: | slasher killerserial murderermysterious villainmysterious killerserial killerterrorvillainpolice detectivealcoholickillerboyfriend girlfriend relationship |
Period: | christmas party1970s |
Story: | psycho terrorpsycho killertelephone terrorchristmas wreathhorror movie remadesorority housepsycho filmmultiple homicidegrindhouse filmholiday in titlephone terrorhomicidal maniacsadistic killerunknown killermystery killer β¦death by strangulationmysterious telephone calltracing a telephone callobscene telephone callpsychopathic killeranonymous telephone callprank telephone callpiano recitalsadistic psychopathunplanned pregnancyanti christmaschristmas starchristmas giftchristmas carolchristmas lightschristmas eveknife murderchristmas treetelephone callmurder by stranglingreference to julie christieentering through windowgothic cathedralsearch for missing personsuffocated with plastic bagsecret drinkerdesk sergeantdramatic ironypolice officer throat slithouse catpov shotdisturbed childhoodcult favoritechildren's choirhidden corpsekittyobscene gesturefireplace pokerdistorted voicebloodhoundphone taprocking horsewreathasthma attackinhalerreference to marlon brandomiddle aged womansearch partydrive in classicsmotheringgiallo esquecanuxploitationmurder spreereference to charlie chaplincollege liferemademanic depressionbloody violencedisturbingco edcreepyweirdodeeply disturbed personmultiple murdersnowballmysterious strangerrocking chairdisturbed individualice rinkcrime spreenightgownasphyxiationhookbutcherycarnagesplit personalitysororitybroken windowserial murderslashingold dark househead woundhiding in a closetmysterious mankillbreak inbad guymadmansuffocationdead girlcharacters killed one by onedead woman with eyes openhockeypsychoticbody countcellardark pastslaughteratticdead childdark humorbutcherlow budgetcrime scenegirl with glassesdead womanhomicideaccidental deathgrindhousepsychomass murdermutilationwoman with glasseschild murderholidaymaniackillingobscene finger gesturemurdererbasementsuicide attemptstalkingpianistmissing personscreamcharacter's point of view camera shotdollchild in perilscantily clad femalestabbed to deaththroat slittingstabbingmansionstrangulationcandlesubjective cameracleavagetelephonecolor in titlevoyeurhallucinationpianoblondeblood splattersurprise endingknifetwo word titleviolence (See All) |
Thought to be killed by the sole survivor of the last massacre at Camp Crystal Lake, Jason Voorhees kills his way back to the camp to once again murder its inhabitants. This time, has Jason met his match in the little boy Tommy Jarvis?
Subgenre: | psycho thrillerindependent horroramerican horrorcult filmbody horrorsadistic horror |
Themes: | psychopathmurderdeathtorturebrutalitysupernatural powerinsanitysadismevil |
Mood: | slashergorebreaking the fourth wallblood and gore |
Locations: | hospitalsex in showersex in a bathroom |
Characters: | slasher killerserial murderermysterious villainmysterious killerserial killerterrorvillainkillerbrother sister relationshipteenage girlteenage boy |
Period: | 1980s |
Story: | psycho terrorpsycho killergrindhouse filmhomicidal maniacsadistic killerpsychopathic killersadistic psychopathknife murderdrive in classicgiallo esquemurder spreebloody violencedisturbingdeeply disturbed persondisturbed individual β¦crime spreebutcheryserial murderslashingmysterious mankillbad guymadmancharacters killed one by onebody countslaughterbutchergrindhousepsychomutilationmaniackillingobscene finger gesturemurdererstalkingcharacter's point of view camera shotchild in perilstabbed to deathstrangulationsubjective camerablood splattersurprise endingviolencesexfemale nuditynumber in titlebloodmale nuditybare breastssequelfemale frontal nuditymasturbationmale rear nudityfemale rear nuditypantiescorpseunderwearmasklow budget filmdecapitationimpalementsevered headlooking at the cameraskinny dippingstabbed in the backevil manpremarital sexcabinloss of mothersexual attractionlifting someone into the airragemorguefourth parttowelback from the deadmasked manrampagerednecknew jerseyhit in the crotchstabbed in the neckstabbed in the headdisembowelmentdisfigurementbody landing on a carkilling spreemasked killercar troublestabbed in the handhuman monstersummer campshot in the eyehillbillymeat cleavernaked dead womanextreme violencegraphic violencestabbed in the facemasked villaindeformitylunaticmurder of a nude womanvillain not really dead clichehockey masklifting a female into the airruraltorturersequel to cult filmstabbedboogeymanskull crushinggory violenceeast coastgruesomejason voorheeshead shavingcorkscrewmutilated bodyfriday the thirteenthaxe in the chestmachete mutilationknife through the neckserial teen killertrailer narrated by don lafontainedeformedtwin actresses for twin sisterswessex county new jerseycrystal lake new jerseynose pushed into brainserial teen murdererslaughteredmurder in a shower (See All) |
Months after Alice beheaded psycho killer/mother Pamela Voorhees at Camp Crystal Lake, survivor Alice is still traumatized because of the murders. But there is one problem. Mrs. Voorhee's son Jason never drowned and died.So he saw Alice behead Mrs. Voorhees. Jason finds Alice soon and murders her. F β¦ive years later a camp counselor in training program begins at Campanack Lodge. Right near Jason's home.Camp Crystal Lake. As teenagers in the program start snooping around Camp Crystal Lake, they start getting killed violently one by one. (Read More)
Subgenre: | psycho thrillerindependent horroramerican horrorsuspensecult filmb horror |
Themes: | psychopathmurderdeathfearbrutalityinsanityevilexploitation |
Mood: | darknessslashergore |
Locations: | woodswheelchairpolice carlakecampfirebackwoodsrunning through the woodschase in the woods |
Characters: | slasher killerserial murderermysterious villainmysterious killerserial killerterrorvillainkillerboyfriend girlfriend relationshipteenager |
Period: | 1980ssummeryear 1984 |
Story: | psycho terrorpsycho killerhorror movie remademultiple homicidegrindhouse filmhomicidal maniacmystery killerpsychopathic killersadistic psychopathknife murdertelephone calldrive in classicgiallo esquemurder spreebloody violence β¦disturbingweirdomultiple murdercrime spreebutcheryserial murderslashingmysterious manbad guymadmancharacters killed one by onepsychoticbody countslaughterbutchergrindhousepsychomass murdermutilationmaniackillingobscene finger gesturemurdererstalkingcharacter's point of view camera shotthroat slittingstrangulationsubjective camerablondeblood splattersurprise endingviolencesexfemale nuditynumber in titlebloodsequelfemale frontal nudityflashbackkissfightnipplespantiescorpsedigit in titleslow motion scenecatbikinimasksecond partdead bodynumbered sequelswimmingdecapitationbramassacreimpalementjokesevered headcontroversyskinny dippingstalkerprologueevil manopening action sceneconvertiblelove interestkissing while having sexsplatterchesschainsawfireplacespearnipples visible through clothinggothicmachetelifting someone into the airragevillainessphone boothvictimmasked manrampageredneckbra and pantiesnew jerseyhit in the crotchpsychotronicstabbed in the headbetrefrigeratorlens flarekilling spreemasked killernude swimmingcar troublereturning character killed offhuman monstersummer campfreakskirtsexual violencewetting pantshillbillyday in titletow truckparaplegicorchestral music scoremasked villainpitchforksole survivorlunaticpsychotronic filmmurder of a nude womandying during sexvillain not really dead clichecreepkilled during sexshacklifting a female into the airtrailtorturerhanged boysadisticsequel to cult filmboogeymaneast coastsickolost dogice pickcampfire storygruesomejason voorheesdouble impalementbad jokefriday the thirteenthatonal music scoreurinating in fearmachete mutilationtea kettleviolentbrutaltrailer narrated by don lafontainegarrottingtoasting marshmallowssymphonic music scorewessex county new jerseycrystal lake new jerseychild psychologyfade to whitesack maskscare involving catserial teen murdererkilled by machetemenstrual cycledefy authorityfalse scarehand on shoulder scarelatex mask (See All) |
One summer at Camp Crystal Lake, a group of young counselors begin to get ready to lead campers. Unfortunately for the former, someone isn't happy about what's going on in the camp and enjoys playing kill the counselor. As bodies fall to the ground in the camp, no one is safe.
Subgenre: | psycho thrillerslasher flickamerican horrorsuspensecult filmindependent filmteen moviemurder mysteryteen horror |
Themes: | mysterious deathpsychopathvoyeurismmurderdeathrevengefearcorruptionbrutalityinsanityhumiliationsadismevilcrueltytrauma |
Mood: | darknessslashergorenightblood and gore |
Locations: | carmotorcycleboatwaterwoodsrural settingpolice carlaketruck |
Characters: | slasher killerserial murderermysterious villainserial killerterrorvillainkillerpoliceteenagerfriendteenage boypolice officerpolicemanartistmother β¦sherifftruck driver (See All) |
Period: | 1970s1950ssummer |
Story: | psycho terrorpsycho killerpsycho filmmultiple homicidegrindhouse filmhomicidal maniacunknown killermystery killerpsychopathic killersadistic psychopathknife murderdrive in classicgiallo esquemurder spreeremade β¦disturbingbloody violenceweirdomultiple murdercrime spreebutcheryserial murderslashingmysterious mankillcharacters killed one by onepsychoticbody countslaughteratticbutcherlow budgetdead womangrindhousepsychomaniackillingmurdererstalkingstabbed to deaththroat slittingstabbingcandlesubjective cameravoyeurhallucinationblondeblood splattersurprise endingviolencesexfemale nuditynumber in titlemale nuditybare breastsmale rear nuditybare chested malekissfemale rear nuditynipplesthree word titlepantiesbeatingcorpsedigit in titlefistfightslow motion scenebikinithongbeerrunningdead bodylow budget filmmarijuanaguitardecapitationbedroombraold manaxemassacrewomandineraccidentsnakecultdream sequenceskinny dippingstrippingdangerprologuescreamingfirst of seriesmoaningdeath of childprankinjectiondeath of sonfirst partcabinkissing while having sexteenage sexfreeze framegirl in pantiesrevelationdesirenipples visible through clothingelectronic music scoredressjeepgothicheavy rainmachetehatstabbed in the stomachhammervillainessswimsuitvictimfull moonrampagebra and pantiesnew jerseystabbed in the throatobesitymercilessnesspower outagemutepsychotroniclostthunderstormbathingdisembowelmentsurpriseperversiondead manlens flareaxe murderroomkilling spreearrowdeath of loved onetank topphysical abuset shirtjoysexual awakeningbeheadingcar troubleshortsdead animalhuman monstersummer campcanoeadolescencerepressionsexual perversionrestroomfemale psychopathjacketdying mandripping bloodrobeactual animal killedday in titlesummer vacationfemale villainshirtmurder witnessevil womanextreme violencefamous scoreanthropologydisfigured facegraphic violenceorchestral music scoresexual repressionmenacemurderessgame playingbowboard gamepillowsole survivortraumatic experiencefemale victimwet clothesgrudgeoff screen murdervillain not really dead clichemurder victimcurtaintroubled teenblond boybitingsweateraxe in the headmistreatmentfemale serial killerawakeningdate in titledead teenagerlost in the woodsraincoatobese womanvillainess played by lead actressblousesadisticdark and stormy nightmutilated corpsedeath by impalementeast coastaxe murdererbad girlcamp counselorcampfire storygruesomejason voorheesbody mutilationfriday the thirteenthatonal music scoremachete mutilationmonopoly the board gameknife through the neckserial teen killercanoeingtrailer narrated by don lafontainekilled with an arrowfemale victimsstormy nightscore employs electronic instrumentsnaked bathingwoman taking off pantsemotionally disturbed personwessex county new jerseycrystal lake new jerseyjerseyelectrical generatorkilled with machetevoice impressionistquietcamp vacationunstable teenager (See All) |
In a continuation of the plot of Halloween, Michael Myers shows off his indestructability by resuming his murder spree despite being gunned down with six bullets in the original movie. Laurie Strode is once more his intended victim, with Dr. Sam Loomis again in hot pursuit.
Subgenre: | holiday horrorpsycho thrillerslasher flickamerican horrorsuspensecult film |
Themes: | murder of a police officerobsessionpsychopathvoyeurismmurderdeathjealousyfeartorturememoryseductionbrutalityparanoiainsanityblindness β¦traumamadnessmurder investigationpsychological trauma (See All) |
Mood: | darknessslashergorenight |
Locations: | small townhospitalcarwheelchairpolice carhospital fire |
Characters: | slasher killerserial murdererserial killerterrorvillainkillerboyfriend girlfriend relationshippoliceteenagerteenage girlpolice officernursedetectivepolicemansheriff |
Period: | 1970syear 1978 |
Story: | psycho terrorpsycho killerpsycho filmmultiple homicidegrindhouse filmhomicidal maniacdeath by strangulationpsychopathic killersadistic psychopathknife murdertelephone callpolice officer throat slitdrive in classicmurder spreebloody violence β¦disturbingdeeply disturbed personmultiple murderbutcheryserial murderslashingmysterious manbad guymadmandead girlcharacters killed one by onedead woman with eyes openbody countdark pastslaughterbutcherdead womanhomicidegrindhousepsychomutilationmaniacmurdererstalkingscreamcharacter's point of view camera shotstabbed to deaththroat slittingstabbingstrangulationsubjective cameravoyeurblondeblood splatterknifetwo word titleviolencesexfemale nuditynuditynumber in titlebloodmale nuditybare breastssequelmale rear nuditykissfemale rear nuditycigarette smokingnipplesexplosionchasefirecryingcar accidentshot in the chestwatching tvkissingbrawlsecretmaskshootingsecond partneighborrevolvergood versus evilhalloweenflashlightold manambulanceaccidentbrunettepart of serieshit by a carbathsearchpantyhosenews reportold womannecklaceattempted murderstalkerstrippingbeaten to deathstabbed in the backprologuescreamingperson on fireuniformpoisonproduct placementcollege studentinjectionglasseswitnesstrapsplattertv newssyringedestructionelectronic music scorehypodermic needlesexual attractionlifting someone into the aircowboy hatwalkie talkiestabbed in the stomachhammerhidingbuttockscaucasianpoolpsychologistbuttdriving a cartowelback from the deadmasked manpresumed deadcamera shot of feetrampagestabbed in the throatmanhuntmercilessnessmutebroken glasscigarette lighterhit on the headfrustrationautopsyaccidental killinghot tubshadowdead maneye gougingdisfigurementstabbed in the eyenude woman murderedlightneighborhoodbloodbathsmokemasked killerflat tirefemale stockinged feetconfusioncar troublestoreneedlemedical masksurgical maskdark secretbandagehuman monsterlighteralonesuit17 year oldearringnurse uniformdental maskblood stainclinicburnt faceparamedicshot in the eyestethoscopeadult actress playing teenage girlscalpelcigarettehand over mouthkiss on the lipsglassdripping bloodrobebleedingmurder witnessextreme violenceflamegraphic violencelighting a cigarettenurse outfitmurder attemptmasked villainroman numbered sequelbutcher knifeman on firepool of bloodfemale victimscarenude bathingsilhouettevillain not really dead clichezippo lighterdying wordssinisterescaped mental patientburningcutearringsboom boxpassing outnurse hatcuriosityset on firemidwestsmall town sheriffsearchingmichael myerscalling someone an idiotfragments of glasstorturerdemonicsequel to cult filmboogeyman21 year oldfienddouble murderyelling for helpcar won't startchildhood flashbackmelting facewoman stabbedjumpsuitlocked upsecurity guard killedsmoking a cigarettemultiple stabbingstore roomsleeping womanclosing eyes of dead personboiling waterdark killerserial teen killertemperaturepush buttonbath towelhidelighting a cigarette for a womanlighting someone's cigaretteblood draininghittingscaldinghospital patienthot waterneedle in eyeoctoberslipping and fallingstalking victimsliphomicidalteenager in dangerhit on the head with a hammeropening creditsexsanguinationlighting cigarette for womanserial teen murderervulnerablehead dunked in watermurdered with a hammerlighting a cigarette for someonerecap segmentscalding waterdead nursescalded faceself survivalcharred bodyhand on shoulder scaresleeping girlstabbed with a scalpelstalking by nightdead doctorwalking through a glass door (See All) |
Loosely based on serial killer 'Henry Lee Lucas' (qv), the film follows Henry and his roommate Otis who Henry introduces to murdering randomly selected people. The killing spree depicted in the film starts after Otis' sister Becky comes to stay with them. The people they kill are strangers and in on β¦e particularly gruesome attack, kill all three members of a family during a home invasion. Henry lacks compassion in everything he does and isn't the kind to leave behind witnesses - of any kind. (Read More)
Subgenre: | psycho thrillerindependent horroramerican horrorcult filmindependent film |
Themes: | psychopathincestmurderdeathdrugsrapetorturebrutalityinsanityevilexploitationmurder of family |
Mood: | slashergore |
Locations: | chicago illinois |
Characters: | slasher killerserial murderermysterious villainserial killerterrorvillainkillerbrother sister relationshipprostitutemurder of a prostitute |
Period: | 1980s |
Story: | psycho terrorpsycho killergrindhouse filmhomicidal maniacpsychopathic killersadistic psychopathknife murdermurder spreedisturbed individualcrime spreebutcheryserial murderslashingmysterious mankill β¦bad guymadmanbody countslaughterdark humorbutcherlow budgetpsychomutilationmaniackillingstalkingstabbed to deathstabbingstrangulationblood splattersurprise endingviolencefemale nuditycharacter name in titlenuditybloodbare breastsgunshot to deathshot in the chestlow budget filmmarijuanacriminaldecapitationbisexualvideo cameradrug dealerstabbed in the chestchild abusesevered headcontroversypantyhosestalkerevil manattempted rapeneck breakingdismembermentsplatterfemale stockinged legsragestabbed in the stomachrapistrampagepsychotronicperversionmurder of a childstabbed in the eyeabusive fatherkilling spreepervertvillain played by lead actorhuman monstersexual violencenaked dead womanextreme violencevideo footagematricidecut into piecesoff screen murderchild rapemurder of a nude womanbroken neckexploitation filmcreepdead woman on floorwoman's neck brokenbased on supposedly true storydead prostitutesadisticsickofemale hitchhikermurderer duotwo killersmutilated bodygraphic rapesex maniaclead actor's first filmdead woman on toiletdead woman wearing lingerie (See All) |
Five years after killing the goalie hockey-masked killer Jason Voorhees, Tommy Jarvis has grown up in various mental hospitals unable to get over the nightmares about Jason's return. When Tommy is sent to a rural halfway house in New Jersey for mentally disturbed teenagers, a series of grisly murder β¦s begin anew as another hockey-masked killer begins killing off all people at and around the residence. Has Jason returned from the dead to re-start his killing spree? Has Tommy decided to take over the reign of Jason, or has someone else? (Read More)
Subgenre: | psycho thrilleramerican horrorcult filmindependent film |
Themes: | police investigationpsychopathmurderdeathrevengefearbrutalityinsanitysadismevilexploitation |
Mood: | darknessslashergorerainnightmarenight |
Locations: | small towncemeterywoodsamericabackwoods |
Characters: | slasher killerserial murderermysterious villainmysterious killerserial killerterrorvillainkillerpolicemother son relationshipteenagerbrother brother relationshipsheriffcountry boy |
Period: | 1980s |
Story: | psycho terrorpsycho killermultiple homicidegrindhouse filmhomicidal maniacpsychopathic killersadistic psychopathknife murderdrive in classicmurder spreebloody violenceweirdodisturbed individualcrime spreebutchery β¦serial murderslashingmysterious manbad guymadmancharacters killed one by onehockeypsychoticbody countslaughterbutchergrindhousepsychomutilationmaniackillingobscene finger gesturemurdererstalkingcharacter's point of view camera shotchild in perilthroat slittingsubjective camerablood splattersurprise endingviolencesexfemale nuditynumber in titlebloodbare breastssequelfemale frontal nuditykissdancingchasepantiesdigit in titledead bodylow budget filmnumbered sequeldecapitationsword fightaxemassacreimpalementgravestalkerevil mandeath of brotherdeath of sonkissing while having sexchainsawmachetelifting someone into the airbarnstabbed in the stomachvictimmasked manmental institutionrampagerednecknew jerseyitalian americanpsychotroniceye gougingstabbed in the eyeaxe murderfifth partsequel to cult favoritemasked killercar troublelaundrydefecationhuman monstersummer campcomic relieftombstonehillbillyeyeballmeat cleavercrushed headextreme violencegraphic violenceorchestral music scorestabbed in the facemasked villaincut into piecesfemale victimlunaticpsychotronic filmmurder of a nude womandeath of grandfatherreturning character with different actorstabbed with scissorsfatchopping woodaxe in the headsmall town sheriffbreakdancingdate in titlehockey masksequel to cult filmdark and stormy nightcandy barclotheslinegory violencesource musiceast coastgarden shearsjason voorheesimposterjumpsuitpopular musicfriday the thirteenthgrave robbermachete mutilationserial teen killercopycattrailer narrated by don lafontaineattempted child murdermale victimwessex county new jerseycrystal lake new jerseycopycat killervertigo shotserial teen murdererlifting a woman into the airspike in the head (See All) |
Phoenix officeworker Marion Crane is fed up with the way life has treated her. She has to meet her lover Sam in lunch breaks and they cannot get married because Sam has to give most of his money away in alimony. One Friday Marion is trusted to bank $40,000 by her employer. Seeing the opportunity to β¦take the money and start a new life, Marion leaves town and heads towards Sam's California store. Tired after the long drive and caught in a storm, she gets off the main highway and pulls into The Bates Motel. The motel is managed by a quiet young man called Norman who seems to be dominated by his mother. (Read More)
Subgenre: | psycho thrilleramerican horrorsuspensecult filmindependent filmpsychological horror |
Themes: | mental illnesspsychopathvoyeurismmurderdeathmarriagemoneyfearfuneraldeceptiondivorcetheftguiltinsanitydating β¦unrequited lovemadness (See All) |
Mood: | darknessslasherrainbreaking the fourth wall |
Locations: | small townchurchhotelbathtubdesertrural settingpolice carmotelcar in water |
Characters: | slasher killerserial murdererserial killerterrorvillainkillerfamily relationshipsmother son relationshipfriendpolicemansister sister relationshipthiefpsychiatristsecretarysheriff |
Period: | 1960syear 1960 |
Story: | psycho terrorpsycho killerhorror movie remadepsycho filmgrindhouse filmhomicidal maniacpsychopathic killersadistic psychopathknife murdertelephone callcult favoritehidden corpsedrive in classicmurder spreeremade β¦disturbingbloody violenceweirdodeeply disturbed personmysterious strangerdisturbed individualcrime spreebutcherysplit personalityserial murderslashingold dark housemysterious manbad guymadmancharacters killed one by onedead woman with eyes openpsychoticbody countcellarbutchergrindhousepsychomutilationmaniackillingmurdererbasementscreammissing personcharacter's point of view camera shotstabbed to deathstabbingsubjective cameravoyeurhallucinationsurprise endingviolencebased on novelbloodone word titleinterviewflashbackbare chested malephotographshowervoice over narrationcorpseunderweararrestundressingsecretbathroomjailgood versus evilnewspaperbracaliforniadisguisewomanwidowtoiletstabbed in the chestbirdbathold womanstalkerwidowerfirst of seriesmistaken identitylong takefemale removes her clothescountrysidewitnesstrapfirst partthreatened with a knifecross dressingprivate detectiveeyeglassesfemale stockinged legsfalling down stairsbreaking and enteringlooking at oneself in a mirrorfaintinglifting someone into the airblockbusterimpersonationphone boothvictimskulldriving a carpeeping tomapartment buildingcamera shot of feetimpostorgash in the facedeath threatblack braswamparizonarainstormextortionnervous breakdownmeetingdead motherphonefemale in showerbloodbathfemale stockinged feetimpotencevillain played by lead actordirector cameohuman monsterfemale removes her dresstwist endingabandoned housestolen moneytemptationdisposing of a dead bodydomineering motherfoot closeuphearing voicesflyrole reversalmurder suspectnaked dead womansleeping in a carloss of sisterbra removingfamous scoreembezzlementoverhead camera shotrealtormatricidefemale victimreclusemurder of a nude womansilhouettefade to blackpeep holeidentity crisiscurtainred herringworking outstairwelldead woman on floorenvelopehardware storesafe sextalking to oneselfwife leaves husbandbroken engagementthreat to killhidden moneyscreaming in fearphoenix arizonawoman in braloss of girlfriendtaxidermylooking in a windowstabbed with a knifeneon signfollowinglifting a female into the airlifting an adult into the airbad mothermissing womanscreaming in horrordragging a dead bodydriving in the rainfalse accusation of murderslip the undergarmentlicense plateseclusionlooking through a windowcarrying a dead bodydissociative identity disorderrotting corpseshower curtainnight drivinghighway patrolmutilated bodyalimonyjealous manmotel clerkfamous opening thememurder weaponoedipal complexirony of fatejealous womanbased on ed geinspurned womaninsanevictim invited to dinnercleaning upposing as husband and wifestopped by policeslashed to deathmislaid trustfemale in brahouse of horrorsboothused car dealerbloody corpsemotel owneralone in housecovering a dead bodymurdered in a showerarizona desertfamous twistlistening to classical musicpsycho next doorbedridden mothersweeping floor (See All) |
Tommy Jarvis returns to the graveyard to make sure Jason Voorhees is dead and accidentally brings him back to life. Now it's up to Tommy to stop Jason's mindless killing and put him back where he belongs.
Subgenre: | psycho thrillerslasher flickamerican horrorcult filmsupernaturalparanormal phenomenateen horror |
Themes: | murder of a police officerpsychopathmurderdeathprisonmonstersupernatural powerinsanityevil |
Mood: | darknessslashergorecar chasebreaking the fourth wall |
Locations: | small townforestcemeteryboatwoodslakeamerica |
Characters: | slasher killerserial murdererserial killerterrorvillainkillerpoliceteenagerzombiesheriff |
Period: | 1980s |
Story: | psycho terrorpsycho killerpsycho filmhomicidal maniacpsychopathic killersadistic psychopathknife murderdrive in classicmurder spreebloody violencebutcheryserial murderslashingkillbad guy β¦madmanbody countslaughterbutcherpsychomass murdermutilationmaniackillingmurdererstalkingstabbed to deathstabbingblood splattersurprise endingviolencesexcharacter name in titlenumber in titlesequelflashbackmasknumbered sequeldemondecapitationflashlightmassacreambulancesevered headchildlooking at the cameradrowningelectrocutionevil manneck breakingunderwatersevered armdismembermentundeadblood spattersplattergothicmachetelifting someone into the airvictimback from the deadmasked manrampagenew jerseyshovelstabbed in the headsevered legsequel to cult favoritekilling spreebloodbathmasked killerbeheadingsummer campactual animal killedsixth partstabbed in the facemasked villainrecreational vehiclecut into piecesheart ripped outfemale victimoff screen murdervillain not really dead clicheghoulpaintballhead ripped offreturning character with different actorreanimationstruck by lightningdead teenagerhockey masklifting a female into the airdemonicdark and stormy nightgrave robbinggory violenceeast coastunderwater fightjason voorheesdouble impalementmutilated bodyfriday the thirteenthstabcamaromachete mutilationviolentbrutalcomic drunkwessex county new jerseycrystal lake new jerseycut to piecespolice officer crushedstabbing a police officerserial teen murdererkilled by machete (See All) |
The residents of Haddonfield don't know it yet... but death is coming to their small sleepy town. Sixteen years ago, a ten year old boy called Michael Myers brutally kills his step father, his elder sister and her boyfriend. Sixteen years later, he escapes from the mental institution and makes his w β¦ay back to his hometown intent on a murderous rampage pursued by Dr Sam Loomis who is Michael's doctor and the only one who knows Michael's true evil. Elsewhere a shy teenager by the name of Laurie Strode is babysitting on the night Michael comes home... is it pure coincidence that she and her friends are being stalked by him? (Read More)
Subgenre: | psycho thrillerslasher flickamerican horrortragedy |
Themes: | mysterious deathmurder of a police officerpolice investigationpsychopathsuicidemurderdeathkidnappingrapetorturebrutalitydysfunctional familyinsanitysadismevil β¦home invasion (See All) |
Mood: | darknessslashergoreblood and gore |
Locations: | small townstrip club |
Characters: | slasher killerserial murdererserial killerterrorvillainkillerboyfriend girlfriend relationshipteenagerafrican americanboyhostagepsychiatristsheriff |
Period: | 1970s |
Story: | psycho terrorpsycho killerpsycho filmmultiple homicidesadistic killerpsychopathic killersadistic psychopathknife murdermurder spreebloody violencedisturbingcreepyweirdodeeply disturbed personmultiple murder β¦crime spreebutcherycarnageserial murderslashingbad guymadmancharacters killed one by onepsychoticbody countdark pastbutchercrime scenepsychomass murdermaniackillingmurdererstalkingcharacter's point of view camera shotchild in perilstabbed to deaththroat slittingstabbingstrangulationsubjective camerablood splatterknifeviolencesexfemale nuditybloodmale nudityfemale frontal nudityfemale rear nudityfemale full frontal nudityphotographtitle spoken by characterchasepistolwoman on topbeatingcorpseremakeshot in the headfalling from heightmaskdead bodytelevisionstrippershot in the backf wordmassacreimpalementstabbed in the chestjokecontroversygraveyarddrowningauthorbeaten to deathstabbed in the backattackuniformevil manbaseball bathangingshot in the shoulderpremarital sexloss of motherprofanityteenage sexblood spattersplatterkilling an animalelectronic music scorelifting someone into the airrageloss of friendpsychologistvictimhome moviebroken legmasked manrampagetensionmanhuntshot in the facemental hospitalheadphonesperversionmurder of a childbroken armduct tapekilling spreepumpkinbloodbathswearingmasked killerhit with a baseball batpervertmexican americanporn magazinedead animalhuman monstertrick or treatingabandoned housesexual violencetombstoneschool principalautumnstrong languagewhite trashdripping bloodbloody body of childpalm treenaked dead womanloss of sisterkiller childpsychiatric hospitalextreme violencedisfigured facegraphic violencemasked villainmatricidebutcher knifeloss of familyfemale victimdying during sexanimal killingmass murderervillain not really dead clichejack o'lanterndying wordscreepescaped mental patientchild killedthroat rippinghigh school friendmental asylumforkmidwestmichael myersdeath of petlifting a female into the airloss of boyfriendtorturerchild murders a childhanged boysadisticboogeymanreference to charles mansongun storepsychiatric wardskull crushinggory violencesatanicsickocontroversialcarrying a dead bodymurder of a policewomanjumpsuitclosing credits sequencesororicidebritish manmutilated bodychoked to deathempty swimming poolmultiple versionsviolentbathroom stallbrutalteen sexdisturbed childinsanekilled with a forkmonster as victimanimal mutilationslashed to deathwhite maskabusive childhoodthroat slitinstitutionalizationaluminum baseball batslaughteredinstitutionalizedchild as murdererfake skeleton (See All) |
The year is 1963, the night: Halloween. Police are called to 43 Lampkin Ln. only to discover that 15 year old Judith Myers has been stabbed to death, by her 6 year-old brother, Michael. After being institutionalized for 15 years, Myers breaks out on the night before Halloween. No one knows, nor want β¦s to find out, what will happen on October 31st 1978 besides Myers' psychiatrist, Dr. Loomis. He knows Michael is coming back to Haddonfield, but by the time the town realizes it, it'll be too late for many people. (Read More)
Subgenre: | holiday horrorpsycho thrillerslasher flickamerican horrorcult filmindependent filmteen movieteen horror |
Themes: | psychopathmurderdeathfearcorruptionparanoiaevilmurder of family |
Mood: | slasherhigh schoolnight |
Locations: | small towncarcar theftkitchen knife |
Characters: | slasher killerserial murdererserial killerterrorvillainkillerhusband wife relationshipteenagerboyteenage girlteenage boyfemale protagonistgirllittle girllittle boy β¦psychiatristdoctor patient relationship (See All) |
Period: | 1970s1960syear 1963year 1978 |
Story: | psycho terrorpsycho killerhorror movie remadepsycho filmgrindhouse filmhomicidal maniacpsychopathic killersadistic psychopathknife murderdrive in classicmurder spreecreepyweirdoserial murderhiding in a closet β¦killbad guymadmandead woman with eyes openbody countdead womangrindhousepsychomutilationmaniackillingmurdererstalkingcharacter's point of view camera shotstabbed to deaththroat slittingstabbingstrangulationsubjective cameratelephoneblood splattersurprise endingknifeviolencefemale nuditynudityone word titledogguncigarette smokingtitle spoken by charactershot to deathshot in the chestwatching tvfalling from heightmaskrunninglow budget filmmarijuananeighbortelevisiongood versus evilhalloweenchildgunshotattempted murderprologuesuburbfirst of seriespay phoneevil manhalloween costumelong takefirst parthandgunpot smokingteen angstbulletelectronic music scorebabysitterlifting someone into the airstabbed in the stomachblockbustermasked manwatching televisionwoman in jeopardycouchunderage drinkingburglarymanhuntmercilessnesstvtitle at the endkilling spreepumpkinnude woman murderedphonemasked killerdead doggothmental patientyellingclosethuman monstersuit and tiefence17 year oldcigaretteautumnwoman wearing only a man's shirtkiller childfamous scorebabysittingcarpentermasked villainknittingbutcher knifefemale victimoff screen murderwetnessvillain not really dead clicheescaped mental patientno endingpayphonelight bulbmidwestghost costumewoman smoking cigarettesmall town sheriffmichael myerstrick or treattalking on phonedead teenagerheadstonemusic score composed by directorwoman strangled to deathfalling out a windowchild murders a childdemonicphone conversationcuttingboogeyman21 year oldpumpkin carvinglifting a male into the airwoman stabbedlaundry roomcarrying a dead bodyjumpsuitsmoking a cigarettesororicideescaped killerreturn to hometownindestructibilitysmashed pumpkinurban gothicautumn leavesknitting needleoctoberhouse of horrorsteenager in dangergiant pumpkinteenager murdered (See All) |
Alexia travels with her friend Marie to spend a couple of days with her family in their farm in the country. They arrive late and they are welcomed by Alexia's father. Late in the night, a sadistic and sick killer breaks into the farmhouse, slaughters Alexia's family--including their dog--and kidnap β¦s Alexia. Marie hides from the criminal and tries to help the hysterical and frightened Alexia, chase the maniac, and disclose his identity in the end. (Read More)
Subgenre: | independent horrorsuspenseindependent filmb movieb horrorsadistic horrorpsychological horrorfrench horrorhorror b movie |
Themes: | psychopathmurderdeathfriendshipsurrealismkidnappingrapefeartorturedeath of fatherbrutalitydeath of motherinsanitysadismevil β¦unrequited lovehome invasionexploitationdeath of wifemadnessmurder of fathermurder of husbandmurder of mothermurder of brothermurder of son (See All) |
Mood: | darknessslashergorenightmarecar chasenightblood and gore |
Locations: | hospitalforestbathtubwoodsrural settingroad tripfrancetruckgas stationsinging in a carbackwoodsback country |
Characters: | slasher killerserial murderermysterious villainmysterious killerserial killerterrorvillainkillerfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationship β¦friendboybrother sister relationshipteenage girlfemale protagoniststudentbest friendfrenchbest friendsdeath of boy (See All) |
Story: | psycho killergrindhouse filmhomicidal maniacsadistic killerpsychopathic killersadistic psychopathtelephone callgiallo esquemurder spreebloody violenceweirdodeeply disturbed persondisturbed individualcrime spreebutchery β¦serial murderslashingkillbad guymadmansuffocationcharacters killed one by onebody countslaughterbutchergrindhousepsychomass murdermutilationchild murdermaniackillingmurdererstalkingdollscantily clad femalethroat slittingstabbingsubjective cameratelephonevoyeurblood splattersurprise endingknifeviolencefemale nudityf ratedbloodbare breastsfemale frontal nudityflashbackmasturbationdogguncigarette smokingphotographlesbian kisschaseshowerdreamcorpsecar accidentmirrorurinationshot in the headshotgunslow motion sceneshootingriflesunglassesbedcar crashdead bodylow budget filmbathroomneighborshot in the backdecapitationsurvivalflashlightbound and gaggedaxemassacreimpalementstabbed in the chesthousesevered headvanon the runevil mandeath of childdeath of brotherpursuitdeath of sondeath of husbandsleepingeuropeblood spattersplatterchainsawfireplacekilling an animallistening to musicsurvivorstabbed in the stomachsevered handstrangerrape victimfollowing someonerapistfemale killerrampagerednecktensionsurveillance cameramobile phonegash in the facebroken glassmental hospitalplot twistperversionmurder of a childswingclassmateaxe murdersexual assaultkilling spreeparrotdead dogbeing followedpervertblood on camera lenstaking a showerbarbed wirevideo surveillanceearphonesclosetnecrophiliaminimal castkilling a doghuman monsterfarmhousefemale psychopathlistening to a radiocornfieldpiercinggreenhouserazor bladeurinalexamfemale villainevil womanextreme violencemurder of wifefilling stationgraphic violencemurderessstabbed in the facecar radiohiding under a beddeath of familyfeetcut into pieceslesbian subtextbutcher knifefemale victimvineyardchainsdriving at nightbludgeoningwalkmanexploitation filmstraight razorcreepbloody body of a childserial rapistsexual predatorgas station attendantfemale serial killerplastic bagcircular sawpadlockbreaking a car windowdoor bellmultiple personality disorderpolice vanpsychiatric wardgory violencesickoaxe murdererbad girlpreyambient musicunreliable narratorfemale murdererjumpsuitshower curtainnecrophiliacvision of the futureaxe in the cheststabhead in a toiletstabbed with glasskeychainsex with the deadfrench shock cinemapierced belly buttonsouthern francefemale victimsfrench cinemalesbian lead charactergas pumpslashed to deathearplugsrear ending a carpsychotic killerserial rapesolarisationfrench manserial killing (See All) |
On Elm Street, Nancy Thompson and a group of her friends (comprising Tina Gray, Rod Lane and Glen Lantz) are being tormented by a clawed killer in their dreams named Fred Krueger. Nancy must think quickly, as Fred tries to pick them off one by one. When he has you in your sleep, who is there to save β¦ you? (Read More)
Subgenre: | slasher flickindependent horroramerican horrorcult filmindependent filmteen movieteen horror |
Themes: | psychopathmurderrevengesurrealismfuneralsupernatural powerevil |
Mood: | slasheravant gardegorehigh schoolnightmare |
Locations: | police stationcemeterybathtub |
Characters: | slasher killerserial murderermysterious villainserial killerterrorvillainalcoholickillerboyfriend girlfriend relationshiphusband wife relationshipmother son relationshipfather daughter relationshipmother daughter relationshipteenage girlpolice chase β¦self mutilationpolice lieutenant (See All) |
Period: | 1980s |
Story: | psycho terrorhorror movie remadegrindhouse filmhomicidal maniacpsychopathic killersadistic psychopathdrive in classicremadedisturbingbutcheryserial murderbad guymadmancharacters killed one by onebody count β¦cellarbutchergrindhousepsychomaniacstalkingcharacter's point of view camera shotstrangulationsubjective cameratelephoneblood splattersurprise endingviolencebloodbare chested malecigarette smokingdreamcorpsemirrorface slapslow motion scenearrestfalling from heightbeddemonjailclassroomgood versus evilfoot chasedeath of friendstabbed in the chesthousecoffeeperson on firefirst of seriesevil manhangingdeath of sonpremarital sexcharacter says i love youfirst partreference to william shakespearecult directorstrong female characterfalling down stairsburned aliveelectronic music scoregothiclifting someone into the airhatcrucifixvictimstrong female leadseriesswitchbladesevered fingerheadphonesbooby trapdisfigurementalarm clockvigilantismloud sexclimbing through a windowburnt face15 year olddripping bloodfinger cut offbody bagdeath of boyfriendgraphic violencemaggotopen endedclawreference to shakespeare's hamletpillowsledgehammerbreaking through a doorfamous linevillain not really dead clicheplant in titlecreepglovetrail of bloodhit with a chairface ripped offchild killerchild murdererdead teenagerhanged boydemonicsevered facestreet in titleboiler roomevil deadserial child killerbroken backfurnacelucid dreamsatanicsleep deprivationburn scarshared dreamfreddy kruegernightmare becomes realitysleep overserial teen killerserial child murderbarred windowelm streetspringwood ohioreference to shakespeare's julius caesarserial child murdererunplugged electronic worksfemale stuck in sticky substancefalling asleep in classscar tissuecult male character (See All) |
Jason Voorhees, having barely survived a wound to his shoulder from his own machete, is back to revenge on all that visit "his" woods. A new group of friends come over to party at an area close to the campsite. This time, Jason will be stronger than ever, and getting a hockey mask from one of those β¦friends. (Read More)
Subgenre: | slasher flickamerican horrorcult film |
Themes: | psychopathmurderdeathabductionexploitation |
Mood: | darknessslashergore |
Locations: | lake |
Characters: | slasher killerserial murderermysterious killerserial killerterrorvillainkillerboyfriend girlfriend relationshipteenagerteenage girlteenage boylow self esteem |
Period: | 1980s |
Story: | psycho killergrindhouse filmhomicidal maniacpsychopathic killersadistic psychopathcult favoritedrive in classicgiallo esquemurder spreedisturbingdisturbed individualcrime spreeserial murderslashingbad guy β¦madmancharacters killed one by onehockeyslaughtergrindhousepsychomass murdermaniacmurderercharacter's point of view camera shotsubjective camerasexnuditynumber in titlebloodsequelshowerdigit in titlebikinimasknumbered sequelaxeimpalementthird partevil mancabinsevered armdismembermentsplattermachetelifting someone into the airragebarnroman numeral in titlesevered handmasked manstupidityrampagenew jerseystabbed in the throat3 dimensionalconvenience storepsychotronicstabbed in the eyesequel to cult favoritekilling spreemasked killertorso cut in halfcar troubledefecationhuman monstersexual violenceshot in the eyehillbillyeyeballhammockextreme violencefamous scoremasked villainknittingpitchforksole survivordeformitypsychotronic filmbiker gangmass murdererlifting female in airsliced in twopregnant woman murdered3 ddate in titlehockey masksequel to cult filmyo yoskull crushinggory violenceeast coastgruesomejason voorheesdorkfriday the thirteenthserial teen killerbrutalhead crushing3d sequel to 2d filmtrailer narrated by don lafontainewessex county new jerseycrystal lake new jerseykilled with machetesack maskpopcorn making (See All) |
A psychic who can read minds picks up the thoughts of a murderer in the audience and soon becomes a victim. An English pianist gets involved in solving the murders, but finds many of his avenues of inquiry cut off by new murders, and he begins to wonder how the murderer can track his movements so cl β¦osely. (Read More)
Subgenre: | christmas horrorsuspensecult filmparanormal phenomenaitalian horrorpsychological horrorcult classic |
Themes: | psychopathdrunkennesschristmasmurderdeathsurrealisminfidelityrapeghostjealousydrinkingfuneralinvestigationangercorruption β¦death of fatherbrutalityparanoiablackmailinsanityillnesssadismhome invasiontheatrepanicdyingtraumaclaustrophobiachristmas past (See All) |
Mood: | darknessslashergorenight |
Locations: | citypolice stationhospitalbarrestaurantschoolcarcemeterybathtubbicyclewaterelevatorkitchenwheelchairaustralia β¦police caritalytruck (See All) |
Characters: | slasher killerserial murderermysterious villainserial killerterrorvillainkillerboyfriend girlfriend relationshiphomosexualfather son relationshippolicemother son relationshipfather daughter relationshipdoctor β¦singerboygirlpolicemanmusicianactresspsychiatristmaidprofessorjewgermangay friendself pity (See All) |
Period: | 1970s |
Story: | grindhouse filmhomicidal maniacsadistic killerunknown killermystery killerpsychopathic killersadistic psychopathchristmas treetelephone callcult favoritefireplace pokerdrive in classicmurder spreedisturbingdeeply disturbed person β¦butcheryserial murderslashingmysterious mankilldead girlcharacters killed one by onedead woman with eyes openpsychoticbody countdark pastslaughterbutchercrime scenedead womangrindhousemaniackillingmurdererbasementstalkingpianistdollstabbed to deathstabbingstrangulationsubjective cameratelephonecolor in titlehallucinationpianoblood splattersurprise endingknifetwo word titleviolencebloodflashbackgunkisscigarette smokingphotographsingingchasefiresongshootoutbeatingcorpsemirrorface slapwatching tvcameradrinksecretshootingpaintingbookvomitingrunningdead bodycafebathroomneighborrevolvertelevisionreporterdecapitationsurvivalgay slurnewspaperbedroomflashlightjournalistbandold manaxeimpalementdinerhousejokebrunettedrivingsevered headbirddrawinghit by a carsearchgraveyardold womannecklacedrowningpainattempted murderlibraryvirgindangerstabbed in the backprologuescreamingpuppetprotestkeystatueskeletonhangingthreatwitnessdarktrapsuspicioncult directorpsychiceuropearsonrecord playertv newsfireplacedesirebreaking and enteringstreetdressgothictape recorderrome italymagicianstabbed in the stomachtoyarchitectpsychologycomposerdesperationdriving a carhomeviolinfemale killerembarrassmentwatching televisionrampagewhiskeycouchpastmercilessnessstabbed in the neckmutebroken glassmental hospitalshoveltheatre audiencestairshit on the headenglishbutterflyfrustrationshadowdead maneye gougingdisfigurementfemale reportergay stereotypeliving roomkilling spreevoodoolightplaying pianotelepathycrowclose up of eyesdrumsapparitiondark secretgloveslong hairhuman monstermen's bathroomtwist endingfencestaircasejazz musicskirtstreet markettelevision newslizardbitternessfemale psychopathwhodunitblood staintheatre productiontape recordingburnt facemessagemind gamejacketgreenhousehit by a trucksaxophonefallingglassdisappointmentdripping bloodeyeballlocked doormeat cleavercrushed headfemale villainhallwaystabbed in the shouldertrumpetmurder witnessburnt bodyclueevil womanextreme violencefamous scoremacabrepsychic powerbourgeoisiegraphic violencedeskmenacemurderesssilencedead birdarm wrestlingbutcher knifedogfightgiallopool of bloodfemale victimpsychotronic filmhouse firehouse on fireclose up of eyefingerprintsilhouettehatchetsecret roomcurtainlebanonwater fountainloss of controldead woman on floorengineeringhidden roompick axepinball machinemistreatmentboomerangblack glovesextrasensory perceptionfemale serial killerchild's drawingexposed breastraincoatsteamwife murders husbandfalling out a windowfragments of glassitalian cinemapiano teachertorturercrawlingblowing a kissdead woman on groundclairvoyancejazz bandvoodoo dollhearing aidprogressive rockfigurinechildren's musicvideo nastywitness to murderreference to leonardo da vincibad girlcleavercognacmad womanmelting facegruesomenewsroomcarrying a dead bodysplit headtromboneskylightlocked upmutilated bodyattacked from behindknife in backforeignparapsychologyproletarianleather glovesbrutalchildren's songpush buttonscene based on paintingstatuettecanary islandspiano duetwoman murders a womancradlehouse for salesit inanimate dollblack gloved killersweaty faceaxe in the backbloody knifedrawing on a wallhot waterknitting needlemusic conservatorypantingcomposingholding someone's head underwaterblackbirdoverflowing bathtubwater faucetflooded roomhit with a clubseeing father murderedslidingbashing someone's head into a wallbathroom sinkdragged by a truckmummified bodytearing a page from a bookgraveside ceremonyitalian flagwindow screenpsychology professor (See All) |
It's been nearly ten years since Freddy Krueger terrorized people in the dreams, and the towns folk want to keep him erased from their memory. Freddy still has one more plan on getting back to Elm Street. He resurrects Jason Voorhees and sends him off to kill. The more bodies which fall to the groun β¦d, the stronger in which Freddy becomes. This is until, Freddy realizes that Jason isn't going to step aside easily, and must be taken down himself. (Read More)
Subgenre: | psycho thrillerslasher flickcanadian horroramerican horrorsuspensecult filmindependent filmsupernaturalparanormal phenomena |
Themes: | psychopathdrunkennesssuicidemurderdeathrevengekidnappingghostfeartorturedeath of fatherbrutalitysupernatural powerdeath of motherinsanity β¦evilabductiontraumafear of water (See All) |
Mood: | slashergorerainhigh schoolnightmarebreaking the fourth wallblood and gore |
Locations: | police stationsmall townforestcemeterylakeschool nurse |
Characters: | slasher killerserial murderermysterious villainserial killerterrorvillainkillerboyfriend girlfriend relationshipfather son relationshipmother son relationshipfather daughter relationshipteenage girlteenage boyzombielittle girl β¦sheriff (See All) |
Period: | 2000s |
Story: | psycho terrorpsycho killerpsycho filmhomicidal maniacpsychopathic killersadistic psychopathmurder spreebloody violencebutcheryserial murderslashingmysterious mankillbad guymadman β¦characters killed one by onebody countslaughterbutcherpsychomass murdermutilationchild murdermaniackillingmurdererstalkingcharacter's point of view camera shotchild in perilstabbingblood splattersurprise endingviolencecharacter name in titlebloodsequelflashbackphotographexplosionpartypistolshowerfirevoice over narrationdreamcorpseslow motion scenebrawlfalling from heightmaskcar crashdemondecapitationfoot chaseimpalementsevered headdream sequenceunderwater scenevandrowningskinny dippinglibrarycharacter repeating someone else's dialoguevirginprologueperson on fireelectrocutioncover upevil mandeath of childdeath of brotherhigh school studentneck breakingpremarital sexcabinsevered armdismembermentundeadsplatterburned aliveheroinemachetelifting someone into the aircomaragesevered handvictimgoatcrushed to deathmasked manrampagesevered fingernew jerseymisunderstandingpsychotronicmedicationmurder of a childalternate realityeye gougingdemonic possessionkilling spreegeekburned to deathmasked killernewspaper clippingtorso cut in halfblood on camera lensbeheadingfinal showdownnecrophiliadockohiosummer camplockerevil spiritsexual violencestonerdomineering motherflaskhanging upside downburnt facecornfielddeputywrist slittingkidnapperdripping bloodchild kidnappingravedeath of boyfriendcrossoverburnt bodypsychiatric hospitalgraphic violenceclawmasked villaindeformityfemale victimpsychotronic filmbreaking through a doormass murderervillain not really dead clicheghoulchild abductionescaped mental patientfedoracaterpillarglovearm ripped offchild killedsevered earsliced in twoeighth partmidwestchild killerobituarychild murdererhand through chestdead teenagerhockey masktorturerdemonicboiler roomsadisticmissing person posterburnt handpassed out drunkserial child killerbroken backtranquilizergory violenceeast coastlucid dreamsataniccamp counselorgruesomejason voorheesdouble impalementhell on earththrown through a glass dooreleventh parttwo killersshared dreamdisbelieving adultfreddy kruegerfriday the thirteenthmonster versus monsternightmare becomes realityreanimated corpsemachete mutilationserial teen killerbrutaltroubled childhoodreference to the three stoogesmutilated childsevered nosehead spinmonster as victimserial child murderelm streetslashed to deathspringwood ohioabusive childhoodserial child murdererwessex county new jerseycrystal lake new jerseyevil versus evilkilled with machetekiller vs killerdreams vs realityserial teen murdererkilled by machete (See All) |
The graduating class of the local high school is going on a luxury cruise with Jason Voorhees as a stowaway. The heroine Rennie Wickham believes she was almost drowned by Jason as a child. Jason eventually sinks the boat and kills many of the students on it, but many of them escape to Manhattan. A l β¦ong battle with Jason ensues until Jason is washed away in the New York sewers by a midnight flooding of toxic waste. (Read More)
Subgenre: | psycho thrillerslasher flickamerican horrorcult filmindependent filmparanormal phenomenateen horror |
Themes: | murder of a police officerpsychopathmurderdeathrevengemonstersupernatural powerevildrug addiction |
Mood: | slashergorerainhigh school |
Locations: | citynew york cityboatwoodsseaamericasewer |
Characters: | slasher killerserial murderermysterious villainserial killerterrorvillainkillerteenage girlteenage boyzombiepolice officerteacher student relationship |
Period: | 1980s |
Story: | psycho terrorpsycho killerhomicidal maniacpsychopathic killersadistic psychopathknife murdermurder spreebutcheryserial murderbad guymadmancharacters killed one by onebody countslaughterdead child β¦butcherpsychomutilationmaniaccharacter's point of view camera shotstabbed to deaththroat slittingstabbingstrangulationhallucinationblood splatterviolencefemale nuditycharacter name in titlenumber in titlebloodsequelbare chested maleexplosionpantiesmirrornumbered sequeldemonguitarmanhattan new york citydecapitationflashlightgangnew yorkaxevideo cameraimpalementsubwaywhite pantiesexploding carnecklacedrowningon the runblack pantieselectrocutionevil manattempted rapeunderwaterundeadhypodermic needlelifting someone into the airback from the deadmasked manmale underwearrampagenew jerseyblack bradisembowelmentstabbed in the eyesequel to cult favoritemasked killerbeheadingsummer campaccidental shootingstatue of liberty new york citycrushed headdisembodied headcruise shipmasked villaintoxic wastedeformitylunaticmetrooff screen murdermurder of a nude womanmass murdererghoulbody paintblond boyeighth partpolice officer knocked unconsciousstruck by lightningharpoondead teenagerhockey masklifting a female into the airtwin towerstrailer narrated by percy rodriguezlifeboatspear guneast coastjason voorheesmutilated bodyfriday the thirteenthkilled with a forkhit with a guitarwessex county new jerseycrystal lake new jerseyjerseyserial teen murdererbig applegirl strangling (See All) |
Best-selling novelist Paul Sheldon is on his way home from his Colorado hideaway after completing his latest book, when he crashes his car in a freak blizzard. Paul is critically injured, but is rescued by former nurse Annie Wilkes, Paul's "number one fan", who takes Paul back to her remote house in β¦ the mountains (without bothering to tell anybody). Unfortunately for Paul, Annie is also a headcase. When she discovers that Paul has killed off the heroine in her favorite novels, her reaction leaves Paul shattered (literally)... (Read More)
Subgenre: | psycho thrilleramerican horrorsuspensesurvival horror |
Themes: | murder of a police officermental illnessobsessionpsychopathmurderdeathrevengekidnappingtortureescapeinvestigationangerlonelinessinsanitysadism β¦evilabductionwritingmadnessclaustrophobia (See All) |
Mood: | darknessneo noir |
Locations: | small townhelicoptersnowwoodswheelchairsnow storm |
Characters: | slasher killerserial murderermysterious killerserial killerterrorvillainkillernursewriterhostageshooting a police officerbaby killer |
Story: | psycho killerhomicidal maniacpsychopathic killersadistic psychopathdrive in classicbloody violencecreepyweirdodeeply disturbed personmysterious strangerbutcheryserial murderslashingold dark housepsychotic β¦dark pastbutcherpsychomutilationmaniackillingobscene finger gesturemurdererbasementcharacter's point of view camera shotstabbingsubjective camerasurprise endingknifeviolencebased on novelbloodone word titlegunfighttitle spoken by characterbeatingshot to deathcar accidentshot in the chestshotgunrescueslow motion scenecar crashwomansearchduelattempted murderauthorisolationpigtypewritersociopathragecaptivevillainesspsychologydesperationvictimfemale killerbroken legrampagetensionthunderfanfight to the deathmedicationmurder of a childhighwaynewspaper clippingphysical abuseintimidationnovelhuman monsterfemale psychopathblizzardfemale villainevil womanmatchidolmurderesspsychological torturereclusepsychotronic filmsledgehammervillain not really dead clichecreepscrapbooktauntingbipolar disorderborderline personality disorderobsessed fanfemale serial killerchild killerchild murderervillainess played by lead actresstorturersadisticpolice officer shot in the backdark and stormy nightbased on the works of stephen kingserial child killermarshalbludgeoned to deathbad girlmad womangruesomemeltingreference to liberaceattempted escapedruggingbrutaldislocated shoulderromance novelistvictim invited to dinnerfight sceneceramicgrande dame guignolmale victimserial child murdererhomecare nursepicking lockstruggling authorfemale emasculating a male (See All) |
In part six of the Nightmare on Elm Street series, dream monster Freddy Krueger has finally killed all the children of his hometown, and seeks to escape its confines to hunt fresh prey. To this end, he recruits the aid of his (previously unmentioned) daughter. However, she discovers the demonic orig β¦in of her father's powers and meets Dad head-on in a final showdown (originally presented in 3-D). (Read More)
Subgenre: | psycho thrillerindependent horroramerican horrorblack comedycult filmindependent filmsupernaturaldark comedyparanormal |
Themes: | psychopathmurderdeathsurrealismdrugsghosttorturesupernatural powerdeath of motherinsanitysadismevilamnesia |
Mood: | darknessslashergorerainhigh schoolnightmare |
Locations: | small townairplaneroad trip |
Characters: | slasher killerserial murdererserial killerterrorvillainkillerfamily relationshipsfather son relationshipfather daughter relationshipteenagerteacherself mutilationyounger version of characterdeafnessgerman american β¦evil father (See All) |
Period: | 1970s1990s1960s1940s1950s |
Story: | psycho terrorpsycho killerhomicidal maniacpsychopathic killersadistic psychopathdisturbed childhooddrive in classicmurder spreebloody violencedisturbingcreepybutcheryserial murderkillbad guy β¦madmanpsychoticbody countdark pastslaughterbutcherpsychomutilationchild murdermaniackillingmurdererchild in perilstrangulationsubjective camerablood splatterknifeviolencef ratedcharacter name in titlebloodsequelflashbackbare chested maletitle spoken by characterfirepunctuation in titletitle directed by femaledreamrescueslow motion scenefalling from heightapostrophe in titledemoncriminalgood versus evilimpalementstabbed in the chestboxingmapchild abusedrawingshot in the legcharacter repeating someone else's dialoguebeaten to deathstatueevil manknocked outkicked in the facescene during end creditsexploding bodyundeadfalling down stairsburned alivekilling an animalhead buttgothicscene during opening creditssexual abuseragekicked in the stomachtherapistphone boothvictimorphanagerapistback from the deadrampagecameosevered fingercrossbowkicked in the crotch3dexploding headthrown through a windowparachutemurder of a childdisfigurementknife throwingraised middle fingerabusive fatherkilling spreenewspaper clippingposterhit with a baseball batmarijuana jointvillain played by lead actorstabbed in the handmolotov cocktailohiohuman monsterchild molestationevil spiritstonerburnt facecameo appearancekidnapperplaying a video gamefinger cut offchild kidnappingpunching bagsleeping in a carkiller childsixth partclawfamily mandeath of title characterlunaticanimal killinghusband murders wifefairghoulsleepwalkingsheltercreepglovefalling through the floorchild killedmidwestbroken handchild killerrepressed memorywater towerchild murdererman punches a womanadopted childreference to friedrich nietzschehit by a bustorturerboiler roomsadisticsequel to cult filmabusive stepfatherboogeymanburnt handhearing aidhit with a frying panserial child killergreen bloodfear of heightsdream worldgory violencesleep deprivationfilm starts with quotethrown through a wallfalling down a hillgruesomedream within a dreamear bleedingshared dreamfreddy kruegernightmare becomes reality3d glasseschoked to deathserial teen killerstabbed in the ear3d sequel to 2d filmtrailer narrated by don lafontainetroubled childhoodpipe bombanimal mutilationdaughter murders fatherflashback sequenceloud noiseserial child murderelm streetspringwood ohioabusive childhoodserial child murdererspikesreference to nintendoteenage murdererhit with a beltthrown from an airplanefingernails on chalkboardchild as murderer (See All) |
On Halloween in 1963, Michael Myers murdered his sister, Judith. In 1978, he broke out to kill his other sister, Laurie Strode. He killed all of her friends, but she escaped. A few years later, she faked her death so he couldn't find her. But now, in 1998, Michael has returned and found all the pape β¦rs he needs to find her. He tracks her down to a private school where she has gone under a new name with her son, John. And now, Laurie must do what she should have done a long time ago and finally decided to hunt down the evil one last time. (Read More)
Subgenre: | psycho thrillerslasher flickamerican horrorcult filmindependent filmteen horror |
Themes: | psychopathmurderdeathdrugsparanoiainsanityevilabductionalcoholism |
Mood: | slasherhigh schoolnightmare |
Locations: | small townschoolelevatorkitchentruck |
Characters: | slasher killermysterious villainserial killerterrorvillainalcoholicboyfriend girlfriend relationshipfamily relationshipspolicemother son relationshipteenagerbrother sister relationshipteenage girlteenage boygirl β¦nursepolicemansecurity guardsecretary (See All) |
Period: | 1990syear 1998 |
Story: | psycho terrorpsycho killerhomicidal maniacpsychopathic killersadistic psychopathknife murdercult favoritemurder spreebloody violenceserial murderslashinghiding in a closetmysterious mankillbad guy β¦madmancharacters killed one by onehockeybody countpsychomaniacstalkingcharacter's point of view camera shotstabbed to deaththroat slittingstabbingcandlesubjective cameratelephonehallucinationknifeviolencenumber in titlebloodsequelchasepistolcar accidentfalling from heightmaskbirthdaydead bodyneighbordecapitationgood versus evilhalloweenflashlightwinecaliforniaaxeambulancedeath of friendtoiletstabbed in the chestweaponsevered headattempted murderstalkerstabbed in the backprologuekeyuniformmistaken identityevil manactor shares first name with characterreunionflowersplatterbreaking and enteringheroinesurvivorlifting someone into the airrageloss of friendhidingvictimfaked deathmasked manrampagetrappedunderage drinkingdelusionstabbed in the legboarding schoolknife throwingaxe murderdivorceesecret identitypumpkinmasked killernewspaper clippingreflectionstolen caranniversarybeheadingcar troublefire extinguisherreturning character killed offgatebody baggraphic violencestabbed in the facehiding placemasked villainbutcher knifefemale victimvillain not really dead clichesittingseventh partmichael myersdead teenagerdoor belllifting an adult into the airsadisticboogeymanlifting a male into the airjumpsuitsequel with unusual numberaxe in the chesthead chopped offgarbage disposalserial teen killertrailer narrated by don lafontainewhite maskhome intruderevil uncleschool counselor (See All) |
Three backpackers travel into the Australian Outback, only to find themselves stranded at Wolf Creek crater. Once there they are encountered by a bushman, Mick Taylor, who offers them a ride back to his place. Little do the three know that their adventure into the Outback, would be a complete nightm β¦are after the backpackers find a way to escape. (Read More)
Subgenre: | slasher flicksuspensecult filmindependent filmaustralian horrorsadistic horror |
Themes: | psychopathdrunkennessmurderdeathkidnappingrapedrinkingfeartortureescapebrutalityinsanitysadismevilabduction β¦exploitationcruelty (See All) |
Mood: | darknessslashergorecar chasenightblood and gore |
Locations: | barbeachrestaurantswimming poolcarhelicopterairplanedesertaustraliaroad triptruckcavegas stationcampfireroad movie β¦australian outbackcar on fireshed (See All) |
Characters: | slasher killerserial murderermysterious villainmysterious killerserial killerterrorvillainkillerhusband wife relationshipdoctorsingerhostageaustralianself mutilation |
Period: | year 1999 |
Story: | psycho terrorpsycho killergrindhouse filmhomicidal maniacsadistic killerpsychopathic killersadistic psychopathknife murdermurder spreebloody violencedeeply disturbed persondisturbed individualbutcheryserial murderslashing β¦head woundmysterious manbad guymadmancharacters killed one by onebody countslaughterbutcherhomicidepsychomutilationmaniackillingobscene finger gesturemurdererstabbed to deathstabbingvoyeurblood splatterknifetwo word titleviolenceblooddoggunkisscigarette smokingphotographtitle spoken by characterexplosionsingingpartychasebased on true storysongcorpseshot to deathcar accidentmirrorshot in the chesturinationshot in the headshotgunslow motion scenedrinkvomitingrifleheld at gunpointsunglassesdead bodylow budget filmcafebathroomguitarshot in the backf wordswimminggay slurflashlightbound and gaggedmassacrevideo cameraimpalementfalse accusationcontroversyvanpainflash forwardattempted murderdangerstabbed in the backprologueumbrellaon the roadstorytellingtentevil manattempted rapepursuitcountrysidetragic eventautomobileisolationpigfirst partdismembermentufogaragepickup truckwolfwoundtouristscene during opening creditsloss of friendcaptivedesperationflatulencestrangervictimhome movierapistrampagerednecksufferingsevered fingermercilessnessgunshot woundbroken glassfallblood on shirtperversionrainstormcapturecliffminetied feetopening a doorsexual assaultkilling spreebloodbathdrugged drinkreflectionpervertbarking dogcar troublecrucifixionparalysisjunkyardshot in the neckpostcardscene before opening creditsfirearmhuman monstersydney australiastrandedhikingoutbackvery little dialoguefemale friendshipsexual violenceplaying guitarmind gamefilm starts with textnihilismepiloguesunrisefinger cut offsurfboardlying on bedauto mechanicstation wagoncar set on fireextreme violencemeteorcamcorderfilling stationgraphic violenceoverturning carbriton abroadcaravantied up while barefootwaking upsole survivorfemale victimkangaroocar rollovermass murdererdriving at nightvillain not really dead clicheexploitation filmsoutherncaptivitycreepguard dogends with texttauntingcaged animalcamperserial rapisteclipsedecomposing bodyscreaming in feardesolationwatching someoneoxygen maskbeing watchedwoman driverextreme closeupsolar eclipsespiked drinkabandoned minemobile homeburning carbackpackingmutilated corpsebackpackergory violencetrackingburpsickocratervolkswagen busbritish womancampfire storyrotting corpsehunting knifesavagerybroken down carhelplessnessvandalizing a carsex maniacviolentbrutalshooting a horsegas canhikerpit bullremote locationsleeping on a beachemuregaining consciousnessbloody knifebuying a carslashed to deathgun sightunidentified flying objectbushmanmale victimpsychotic killerroad mapserial rapemining campused car lottire blow outsevered spinespree killerbegging to be killedboogie boardclimbing down a cliffmad dogstripped cardesert roadfriendly strangermurder by a knifeserial killingtorturerertowing (See All) |
This stylish Brian De Palma thriller plays off the theme of the unsuspecting witness who discovers a crime and is thereby put in grave danger, but with a novel twist. Jack Terry is a master sound recordist who works on grade-B horror movies. Late one evening, he is recording sounds for use in his mo β¦vies when he hears something unexpected through his sound equipment and records it. Curiosity gets the better of him when the media become involved, and he begins to unravel the pieces of a nefarious conspiracy. As he struggles to survive against his shadowy enemies and expose the truth, he does not know whom he can trust. (Read More)
Subgenre: | psycho thrilleramerican horrorcult filmindependent filmconspiracyb horrorpolitical thrillerpolitical conspiracy |
Themes: | psychopathmurderdeathpoliticstorturefilmmakinginvestigationparanoiaguiltsadismsurveillanceevilexploitationtechnologyclaustrophobia |
Mood: | slasherneo noirnight |
Locations: | cityhospitaltrainsnowrooftoptrain stationpennsylvaniacar in water |
Characters: | slasher killerserial murdererserial killervillainkillerdoctorprostitutedetectivephotographerhitmanmurder of a prostitute |
Period: | 1980swinter |
Story: | psycho killersorority housepsycho filmgrindhouse filmhomicidal maniacpsychopathic killeranonymous telephone callsadistic psychopathphone tapdrive in classicgiallo esquemurder spreedisturbingcreepydisturbed individual β¦carnageserial murderslashingbad guymadmancharacters killed one by onedead woman with eyes openpsychoticbody countslaughterdead womangrindhousepsychomutilationmaniackillingmurdererstabbed to deathcleavagetelephonevoyeursurprise endingknifetwo word titlefemale nuditynuditybare breastsfemale frontal nudityflashbackbare chested maleguntitle spoken by characterchaseshowerwoman on topcar accidenturinationrescuewatching tvlingeriealcoholreporterassassindisguisebridgepoliticiansubwayassassinationunderwater scenegunshotpoint of viewscreamingpay phonecover upevil manattempted rapehairy chesttragic eventsplit screenfilm within a filmwitnessfireworkscult directorgraffititrusttape recorderrecordingcaught having sexcrying womanmovie theaterphone boothfrogvictimparademale underwearwatching televisionrampagewoman in jeopardydamsel in distressveteranmustachephiladelphia pennsylvanialonerbriefskilling spreereckless drivingpolitical corruptionfilm industryinterrupted sextruthsubway stationtelevision newsblackoutmotel roomrestroomgovernortv reporterwhodunitemergency roomwhite briefspresidential electionwoman in lingerienewscasthitchcockiantragic endingpresidential candidateenigmafemale victimstrangled to deathtapepsychotronic filmtelevision reporterbroken bottlewiretappingsoundslow motion action scenesubway trainundershirtgovernment corruptionpolitical assassinationwoman in showereye witnesspayphonemedia manipulationgarroterainy nightred lighttirewoman strangled to deathaudio tapereconstructiontorturerdead prostitutesadisticaudio recordingwearing a sound wirefish marketspying on couple having sexelectronicscold blooded murdernews broadcasteast coastwoman in perilmilitary veteranpolitical cover upice pickfilm businesswiretap360 degree panscreening roomimplied fellatioreference to benjamin franklinspying on someonebody mutilationpoint of view shotsteadicampaying for sexincriminating photographsound effectunwanted sexual advancesweeping womanbird's eye shotsound manediting roomfemale victimswearing a wiretelephone repairmancar off bridgeprojection roomsound engineersound effectscondescensionroman a clefnoisesoral sex in publicstreet prostituteblow outsound recordiststabbed with an ice picktire blow outhit on the head with a bottlereference to the zapruder filmsound equipmentyellsound mixingfoley artistliberty bellmurder in bathroomover dubbingartistic creationphiladelphiathe media (See All) |
Andy Barclay has been placed in a foster home after the tragic events of the first film, since his mother was committed. In an attempt to save their reputation, the manufacturers of Chucky reconstruct the killer doll, to prove to the public that nothing was wrong with it in the first place. In doing β¦ so, they also bring the soul of serial killer Charles Lee Ray back to life. As Chucky tries to locate Andy, the body count rises. Will Andy be able to escape, or will Chucky succeed in possessing his body? (Read More)
Subgenre: | psycho thrilleramerican horrorblack comedysupernatural |
Themes: | psychopathdeathsupernatural powerevil |
Mood: | slashergoreraincar chase |
Locations: | chicago illinoisschool buswater gun |
Characters: | slasher killerserial murdererserial killerterrorvillainkillerhusband wife relationshippoliceboyteachernew student |
Period: | 1990s |
Story: | psycho terrorpsycho killerpsycho filmhomicidal maniacpsychopathic killersadistic psychopathsuffocated with plastic bagbloody violencebutcheryhiding in a closetbad guymadmansuffocationbody countbutcher β¦psychomaniacobscene finger gesturemurdererbasementdollchild in perilstabbed to deaththroat slittingstrangulationbloodsequelcigarette smokingsingingpunctuation in titlecorpsedigit in titlecar accidentslow motion scenefalling from heightheld at gunpointsecond partapostrophe in titlefoot chasebound and gaggedambulancestabbed in the chesttied to a chairfalse accusationlimousinebeaten to deathelectrocutionpossessionevil manlightningdeath of husbandneck breakingthreatened with a knifefalling down stairsburned alivegothiclifting someone into the airtied to a bedtoynosebleedsevered handblack humorshovelstabbed in the legexploding headthrown through a windoweye gougingswingraised middle fingerstabbed in the eyesocial workersevered legsequel to cult favoritevoodoopajamasframed for murderevil spiritclimbing through a windowelementary schoolhanging upside downburnt facehead bashed inactress shares first name with characteryuppiedripping bloodsewing machineorchestral music scorehiding under a beddigging a gravelocked in a roomvillain not really dead clicheliquor storetrail of bloodbedtime storyfire alarmevil dollfoster homemidwestthrown through a windshieldassembly linechantfoster parentlocked in a closetfalse accusation of murderfoster mothercar phonekiller dollgruesomefoster fatheraccused of murderdisbelieving adultreference to pinocchiohiding under the coverschild smoking a cigarettenewspaper manreference to hansel and gretelscore employs electronic instrumentstoy factoryfoster parentingthrown down stairsevil smileelectric knifereflection in a car mirrorxeroxfoster sister (See All) |
The People Under the Stairs is the story of a young boy (Fool) from the ghetto and takes place on his 13th birthday. In an attempted burglary (along with two others) of the home of his family's evil landlords, he becomes trapped inside their large suburban house and discovers the secret of the "chil β¦dren" that the insane brother and sister have been "rearing" under the stairs. (Read More)
Subgenre: | psycho thrilleramerican horrorblack comedycult filmindependent filmdark comedysurvival horror |
Themes: | mental illnesspsychopathincestmurderdeathkidnappingdeceptioninsanitysadismevilhome invasiongreedcannibalismwealthstarvation β¦claustrophobia (See All) |
Mood: | darknessslashergoresatiresocial satire |
Locations: | los angeles californiaslum |
Characters: | terrorvillainpolicefather daughter relationshipmother daughter relationshipafrican americanbrother sister relationshipkiller dog |
Period: | 1990s |
Story: | psycho terrorpsycho killergrindhouse filmhomicidal maniacpsychopathic killersadistic psychopathmurder spreedeeply disturbed persondisturbed individualserial murderslashingold dark househiding in a closetbad guymadman β¦body countcellaratticgrindhousepsychomutilationmaniacbasementdollchild in perilmansionblood splatterknifeviolenceblooddogcigarette smokingtitle spoken by characterpistolcorpseshot to deathshot in the chestface slapshotgunbirthdayflashlightimpalementhousechild abusevanracial slurcharacter repeating someone else's dialoguesuburbelectrocutionevil mandeath of childskeletoncharacter says i love youcult directorterminal illnessfalling down stairsfireplacekilling an animalbreaking and enteringgothicscene during opening creditsragestabbed in the stomachspidersevered handskullsadomasochismmasked manrampagesevered fingerstabbed in the throathit in the crotchcannibalchild protagonistdynamiteghettobooby trapperversionmurder of a childsouldead boylasersightlandlordgothpervertschemeevictionhuman monsterlighterfemale psychopathclimbing through a windowanimal abusebayonetslingshotpondfuneral homemurderessroofexploding housecrowbardeformitytrapdoorwhite dresswoman slaps a manstarvingmissing girltarot cardchild with a gunfalling off a roofmoney falling through the airgold coinbitten handfemale serial killershot through a wallsecret passagewayhidden doorrobbery gone awryrottweilersevered tonguesick motherhidden treasureanthropophaguschild murderessnameless characterfurnacedragging a dead bodysickoabused childbad girlpitbullmute childtenementmutilated bodyhung by wristsbreaking through a wallfire pokerbible belttrapped in a housecrawling through an air shafthit with a brickscared to deathstepping on someone's footeyes gougedhouse of horrorscrawl spacebondage equipmenthuman eaten by a dogscalding waterskull ring (See All) |
Brian Kessler, a journalist researching serial killers, and his photographer girlfriend Carrie set out on a cross-country tour of the sites of the killings. Sharing the ride and their expenses are Early Grayce, a paroled white trash criminal, and his girlfriend Adele. As the trip progresses, Early b β¦egins to appear more and more unstable, and Brian and Carrie begin to fear that they may have a real-life killer in the back seat of their car. (Read More)
Subgenre: | psycho thrilleramerican horrorcult filmindependent film |
Themes: | murder of a police officerpsychopathmurderdeathkidnappingrapetorturetheftinsanitysadismevilphotographywritingrape and murder |
Mood: | slashergoreneo noir |
Locations: | barhelicopterdesertroad tripmotelgas stationtexasroad moviesex in a car |
Characters: | slasher killerserial murdererterrorvillainkillerboyfriend girlfriend relationshippolicewriterhostagewaitresschinese foodshooting a police officer |
Story: | psycho terrorpsycho filmhomicidal maniacpsychopathic killersadistic psychopathdisturbingbloody violencecrime spreebutcheryserial murderkillbad guymadmanpsychoticbody count β¦dark humorbutcherpsychomutilationmaniackillingmurdererstabbed to deathblood splatterviolencesexfemale nuditynuditybloodmale nudityone word titlemale rear nuditybare chested malegunfightcigarette smokingphotographtitle spoken by characterpistolshot to deathcar accidentshot in the chesturinationshot in the headshotgunbare buttbeerdead bodysex standing upgay slurjournalistcalifornianarrationjourneyblack pantiesstabbed in the backon the roadevil manautomobilearsontape recorderragestabbed in the stomachvictimrape victimrapistmale underwearrampagerednecktensionstabbed in the throatgash in the faceblack brabilliardsperversionrainstormsexual assaultkilling spreeblack bra and pantiesphysical abusepervertpistol whiphuman monsterpolice officer shot in the chestsexual violenceknocked unconscioushillbillyyuppietrailer parkwhite trashcactusgraphic violencehit with a shovelintentionally misspelled titlecross countryabusive boyfriendlunaticmass murdererbreaking a bottle over someone's headpittsburgh pennsylvaniasoutherncreeppolicewoman killingserial rapistexposed breastparole officerfemale photographerpolice officer shot in the backyo yogory violencepolice officer shot through the heartgruesomemurder of a policewomandead policewomanheavy pettinghickbrutalsports brapolice officer shot in the leghair stylemale with earringserial rapepolicewoman shottwisted mind (See All) |
When the Chase family moves to an isolated house in the middle of nowhere in Detroit, Arkin is hired to fix the windows and the doors. Later he meets his daughter and his wife that has a debt with dangerous sharks and needs money, but his week payment is not enough to pay her debts. Arkin plots to h β¦eist the safe of Michael Chase during the night to raise the necessary money. However, when he arrives in the house, he finds that a sadistic criminal has imprisoned the family and planted traps everywhere. Arkin seeks a way out of the deadly house to save his life. (Read More)
Subgenre: | independent horroramerican horrorsuspenseindependent filmsadistic horrorslasher horrorhorror b movie |
Themes: | murder of a police officerpsychopathmurderdeathtortureescapebrutalityinsanitysadismevilhome invasionexploitationcruelty |
Mood: | slashergorenightblood and gore |
Locations: | strip clubtrying to escape |
Characters: | mysterious villainmysterious killerserial killerterrorvillainkillerhusband wife relationshipfather daughter relationshipteenagermother daughter relationshipteenage girlhostagethiefself mutilationtalking to oneself in a mirror β¦the familykiller dogdirector of photography (See All) |
Story: | psycho killermultiple homicidegrindhouse filmhomicidal maniacmystery killerpsychopathic killersadistic psychopathgiallo esquemurder spreedeeply disturbed personcrime spreebutcherycarnageserial murderslashing β¦mysterious manbad guycharacters killed one by onepsychoticbody countslaughterbutcherhomicidepsychomutilationmaniacscreamchild in perilscantily clad femalestabbed to deathstabbingblood splattersurprise endingknifetwo word titleviolencefemale nuditycharacter name in titlebloodbare breastsfemale frontal nudityflashbackfightcigarette smokingnippleslesbian kisspistolbeatingcorpsemirrorshotgunslow motion scenepunched in the faceshowdownheld at gunpointcar crashdead bodyhandcuffsgood versus evilsurvivalfoot chasegay slurflashlightimpalementstabbed in the chesthousetied to a chairhit by a cardangerscreamingelectrocutiondebtevil manactor shares first name with characterisolationneck breakingtrapfirst partthreatened with a knifeex convictblood spattercrime bossfalling down stairskilling an animallooking at oneself in a mirrortape recorderhammerhidingspiderdesperationcovered in bloodvictimteddy bearhomeanimal attackmasked maneaten aliverampagewoman in jeopardyburglartrappedsevered fingermobile phoneburglarymercilessnessgash in the facepsychotronicescape attemptscissorsscene after end creditsdisembowelmentperversiontitle at the endknife throwinggasolinestabbed in the eyeboxbloodbathmasked killerdead dogfemale female kissinterrupted sexblood on camera lensintestinesbarbed wirewifestabbed in the handset upconstruction workerpistol whiphuman monsterlightervery little dialogueacidclimbing through a windowself defensehead bashed incigarettepredatorbowling alleyman kills a womanheld captivechandelierfinger cut offretroex conmacabrebloodshedmasked villaindead cattrickcut into piecesjewelpsychotronic filmcut handhouse on firedragging a bodyviolent deathex wifeexploitation filmcaptivityclothes rippingbear traphung upside downthroat rippingsliced in twobandaged handblack glovesgutsexterminatordeadlineheld hostagewasptea partydark and stormy nightburnt hand911 calllock pickpreylasciviousnesscaptive womancold blooded killerear bleedingteeth knocked outtrip wiremutilated bodydead body in a bathtubman murders a womanmouth sewn shutstabbed in the earbotoxobjectificationtrapped in a houseblouse rippingpolice officer neck brokenblack gloved killerevil doginsane manslashed to deathdisturbed personcut to piecesfalling through a staircaseisolatedhome intruderfemale in perilfish hookhidden safelaundry chuteboarded up windowburned handknife through handhung by a hookpick lockduct tape over eyeskept in a boxruthless killer (See All) |
When three girls are kidnapped by a man with 23 different personalities, they have to work out which of those personalities will help them escape and which of those personalities will try to stop them.
Subgenre: | psycho thrilleramerican horrorpsychological thrillersuspenseblack comedysuperherotragedysurvival horrorteen horror |
Themes: | mental illnesspsychopathvoyeurismmurderdeathfriendshipsurrealismkidnappingrapebetrayalfearescapefuneralmonsterdeception β¦death of fatherbrutalityparanoiainsanitysurveillancepaniccannibalismhuntingcampingnear death experienceobsessive compulsive disorderself harm (See All) |
Mood: | slashergoreneo noir |
Locations: | trainforesttaxiwoodskitchenapartmentpolice cartaxi drivermuseumtunneltrain stationart museum |
Characters: | slasher killerserial murdererserial killerterrorvillainkillerfather daughter relationshipteenagerafrican americandoctorteenage girlpolice officerhostagesecurity guardpsychiatrist β¦uncle niece relationshippolice dog (See All) |
Period: | 2010s |
Story: | psycho terrorpsycho killerhomicidal maniacpsychopathic killersadistic psychopathdisturbed childhooddisturbingbloody violenceweirdodisturbed individualsplit personalityserial murderbad guycharacters killed one by onebody count β¦dark pastpsychomaniackillingmurdererbasementstalkingmissing personcharacter's point of view camera shotsubjective cameravoyeursurprise endingknifeviolencebloodone word titlesequelflashbackdogbare chested maledancingtitle spoken by characterpartychasepantiescell phonecorpseshot to deathshot in the chestshotgunrescuewatching tvcomputerwritten by directorpaintingrifleheld at gunpointsecond partbirthdayneighborriversurvivalorphanbedroomflashlightambulancedeath of frienddinernonlinear timelinechild abuseman with glassesanimaldisarming someonedrawingdouble crossbirthday partynews reportold womannecklacetransformationtrainingattempted murderstalkerdangertentevil manknocked outbaseball batflowersscarinjectiontragic eventhigh school studentlaptoploss of fathersuspicionrevelationhypodermic needleheavy rainlooking at oneself in a mirrorcagesociopathrageloss of friendsecurity cameracaptivewalkie talkiehuntercaucasiantherapisteccentricpart of trilogyvictimrapistschizophreniainterracial friendshipcrushed to deatheaten alivegas maskrampagepump action shotgunwoman in jeopardydamsel in distresscameohaunted by the paststealing a carcannibalmercilessnesspower outagezooshopping mallsuper villainescape attemptpedophilee mailcapturedeertigerphiladelphia pennsylvaniafemale doctorlonerkilling spreechloroformtorso cut in halfhit with a baseball batvillain played by lead actormental patientdirector cameopedophiliaforced to stripmental breakdownscene before opening creditshuman monsterspiral staircasetwist endingchild molestationjournallockerhuman sacrificeworld dominationmegalomaniacyoung version of charactersuper powersbeastkidnapperpearl necklaceguardiansole black character dies clichemacabreopen endedsuperhuman strengthtragic pastchild molestersole survivorwhite brafemale victimschizophreniclocked in a roommolestationchild rapefade to blacksinistercreepabusive motherboom boxvideo diarysexual predatorhit with a chairbritish actor playing american characterflower shopskypeconferencepower drillpepper sprayflesh eatingdead teenagercaged humancrawlingkidnappedmultiple personality disorderman dressed as a womananthropophaguseast coastair venteating human fleshblood on mouthlispvirtualitydissociative identity disorderlocked in a cageclimbing up a walldrawingsstereodreadzookeepersuperhuman speedcrawlspacereference to skypebookshelfviolentvideo conferencingvideoconferencingcoat hangerfemale victimsvillain escapeswrist cuttinggauzeteleconferencingunder the bedchild rapist (See All) |
In the green woods of Silver Falls, Oregon, Aaron Hallam, a trained assassin AWOL from the Special Forces, keeps his own brand of wildlife vigil. After Hallam brutally slew four deer hunters in the area, FBI Special Agent Abby Durrell turns to L.T. Bonham-- the one man who may be able to stop him. A β¦t first L.T. resists the mission. Snug in retirement, he's closed off to his past, the years he spent in the Special Forces training soldiers to become skilled killers. But when he realizes that these recent slaying is the work of a man he trained, he feels obligated to stop him. Accepting the assignment under the condition that he works alone, L.T. enters the woods, unarmed--plagued by memories of his best student and riddled with guilt for not responding to Aaron's tortured letters to him as he began to slip over the edge of sanity. Furious as he is with his former mentor for ignoring his pleas for help, Aaron knows that he and L.T. share a tragic bond that is unbreakable. And, even as they go into their final combat against each other, neither can say with certainty who is the hunted and who is the hunter. (Read More)
Subgenre: | psycho thrilleramerican horrorsuspensemartial arts |
Themes: | psychopathmurderdeathescapelonelinessevilhunting |
Mood: | slashergorenightmarecar chaseblood and gore |
Locations: | barforesthelicoptersnowbicyclewoodssewer |
Characters: | slasher killerserial murdererserial killerterrorvillainkillertough guysniperex boyfriend ex girlfriend relationshipsniper riflepolice chaseex soldierolder man younger man relationship |
Period: | 1990s2000s |
Story: | psycho terrorpsycho killerpsycho filmhomicidal maniacpsychopathic killersadistic psychopathknife murdermurder spreedisturbingbloody violencedeeply disturbed persondisturbed individualcrime spreebutcheryserial murder β¦slashingbad guymadmancharacters killed one by onebody countdark pastslaughterbutchercrime scenepsychomutilationmaniackillingobscene finger gesturemurdererthroat slittingstabbingstrangulationblood splatterknifeviolencebloodflashbackchasepistolshootoutcorpseshot to deathfistfightmachine guncar accidentshot in the headcatgunfightbrawlfalling from heightvomitingshowdownhand to hand combathandcuffsrivercombatshot in the backf wordswimmingmassacredeath of friendbridgeimpalementstabbed in the chestone man armypolice officer killedshot in the foreheadduelkaratefbifugitiveevil mancabinwaterfallsevered armdismembermentsubtitled scenewolfstabbed in the stomachhunterswat teamvictimhonorhaunted by the pastu.s. armystabbed in the throatmanhuntpost traumatic stress disorderspecial forcesstabbed in the legbooby trapknife fightcommandocaptureknife throwingwar veteransevered legkilling spreefountainpostcardhuman monsterstabbed in the armyugoslaviamilitary uniformsole black character dies clicheextreme violenceoregongraphic violencestabbed in the facemilitary trainingmass graveportland oregonsevered foothoodauto theftjumping off a bridgebritish columbiapacific northwestkosovobalkanbiblical quoteanimal trapgory violencetrackingsurvivalistbloody spraygruesomebasic trainingbody partsethnic cleansingdart gunskate parkbrutalnaturistrogue soldierwar buddyarrowheadyugoslavian army (See All) |
Alice, having survived the previous installment of the Nightmare series, finds the deadly dreams of Freddy Krueger starting once again. This time, the taunting murderer is striking through the sleeping mind of Alice's unborn child. His intention is to be "born again" into the real world. The only on β¦e who can stop Freddy is his dead mother, but can Alice free her spirit in time to save her own son? (Read More)
Subgenre: | slasher flickamerican horrorcult filmindependent filmsuperherosupernaturalparanormalstop motion animationbody horrorurban fantasy |
Themes: | psychopathpregnancymurderdeathfriendshiprapeghostfearmonsterinvestigationbrutalitysupernatural powerdepressioninsanitysadism β¦eviltrauma (See All) |
Mood: | slashergorenightmare |
Locations: | hospitalchurchswimming poolcarmotorcyclewatercar on firedeath in a car accident |
Characters: | slasher killerserial murdererserial killerterrorvillainalcoholickillerboyfriend girlfriend relationshipfather son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipafrican americanfriend β¦doctorboyfemale protagonistgirlnursebabyartistreference to godlittle girlsingle motherwaitresslittle boyfathercrying babyalcoholic fatherpregnant from rapemysterious girlcomic book characterbaby monster (See All) |
Period: | 1980s1940s |
Story: | psycho terrorpsycho killerpsycho filmgrindhouse filmhomicidal maniacpsychopathic killersadistic psychopathtelephone calldrive in classicmurder spreebloody violencecarnagebroken windowserial murderslashing β¦mysterious mankillbad guymadmancharacters killed one by onepsychoticbody countdark pastslaughtermass murdermutilationmaniackillingmurdererstalkingscreamdollstabbinghallucinationblood splattersurprise endingknifeviolencesexfemale nudityf ratednuditybloodbare breastssequelflashbackbare chested malegunfemale rear nudityphotographpartychasepistolshowertopless female nuditycryingdreamfoodcar accidentslow motion scenewatching tvbare buttfalling from heightshootingplace name in titlebedcar crashdemongood versus evilfoot chaseflashlightdisguiseambulancedeath of friendimpalementdinerweaponaccidentapologynunchilddream sequencepart of seriesdrawinghit by a carunderwater scenetransformationpaingunshotlibrarydangerscreaminglocker roomfantasy sequencechampagnepossessionevil manskeletonautomobilepremarital sexsevered armhaunted housedismembermentredheadundeadsplatterfreeze framewaiterfalling down stairsteen angstwarehousebeer drinkinggay characterfaintingcomic booklifting someone into the airmutantloss of friendspidercrying womanvictimskateboardbirthfollowing someonepicnicback from the deadcelebrationmental institutionrampagedamsel in distresstensionplaygroundblood on faceanimated sequencemental hospitalblack and white sceneskateboardinghot tubmurder of a childdisfigurementbarefoot femalegay stereotypeasylumfifth partkilling spreenewspaper clippingmale objectificationvillain played by lead actortaking a showergiving birthmental patienttaking a photographreturning character killed offohioassumed identitytowerevil spiritdomineering motherhospital roommasturbation referencelistening to a radionewspaper articlehit by a trucklollipopdripping bloodlocked doorbreaking a windowjockdeath of boyfriendcrying femaleeating disordertraffic accidentfacial scarjumping into watermysterious womanshape shifterclawreference to shakespeare's romeo and julietcut into piecesswimmerpsychotronic filmwet clothescut handfetusghoulbroken bottledeath of loverplant in titlebody partscreaming womanhigh school graduationdrinking from a bottleglovearm ripped offhysterical womanbad dreammental asylumfemale in a showersecretly observingposing for a photographbossy womanhand injurypretending to be someone elsesuperhero costumehand kissingfalling asleeploss of lovermidwestultrasoundchild killerhysterical outburstbaby carriagechild murdererhand through chestbreaking a car windowcarrying someonelifting a female into the airplace in titleloss of boyfriendscarred facedemonicmidnight moviestreet in titleboiler roomsadisticsequel to cult filmboogeymanhorror iconfantasy sceneoff screen rapeserial child killerdrinking winediving boardnursery rhymeindoor swimming poolpart time jobprivate investigationfainting manforce feedinglifting a male into the aircomic book artgruesomehand bandageseeing dead peoplefeeding someonemysterious eventdream within a dreambody partspost coital sceneshape shiftingairplane ticketmutilated bodycharacter appears in newspaperjumping into a swimming pooldrinking champagnehole in the wallnightmare becomes realitybaby strollerdepressed womangraduation partyriding a motorbikechoked to deathkilled in a car accidentriding a motorcyclechild born of rapeserial teen killersleeping shirtlessbrutalcamera shot from inside human bodyfusiongroup hugviolent mankissing someone's handbossy mothervictim invited to dinnertv show within a filmdream sequence within a dream sequencefainting womanmurder disguised as accidentserial child murderelm streetopen endingslashed to deathspringwood ohioreformed alcoholicactor reprises previous rolecrying for helpdrawing comes to lifefamily relationshippushy motherbreaking a bottlechild ghostserial child murdererhole in the floormale antagonistmother issuesbroken car windowfather issuesbroken dollconflict between friendssitting on the floordeformed babyspitting out a drinkwaking up someonecrashed carlifting a boy into the airpossessed boydrinking coffeelying on the floorcutting oneselfoperation roomrunning latesleeping fully clothedteam workcreepy childforced to eatgag reflexpicture comes to lifepushy father (See All) |
40 years ago, five youths on a weekend getaway in the Texas countryside fell prey to a butcher in a mask made of human skin and his cannibalistic family, and horror cinema would never be the same. Violent, confrontational, and shockingly realistic, director Tobe Hooper's THE TEXAS CHAIN SAW MASSACRE β¦ terrified audiences in a way never thought possible when it was unleashed on a politically and socially tumultuous America in 1974. Facing a storm of controversy, censorship, and outcry throughout its troubled release, this masterpiece of horror has stood the test of time to become a landmark motion picture and cultural milestone. To celebrate the film's 40th anniversary and its enduring ability to scare audiences both new and old, Dark Sky Films proudly presents THE TEXAS CHAIN SAW MASSACRE in an all-new 4k digital transfer and with a newly created 7.1 surround sound mix supervised by Tobe Hooper. Get ready to experience fear in a whole new way. (Read More)
Subgenre: | psycho thrillerslasher flickindependent horroramerican horrorsuspenseblack comedycult filmindependent filmtragedysurvival horrorteen horror |
Themes: | psychopathmurderdeathfriendshipkidnappingfeartortureescapebrutalityparanoiadysfunctional familyinsanitysadismevilexploitation β¦paniccannibalisminheritancemadnessnear death experience (See All) |
Mood: | ambiguous endingdarknessslasheravant garde |
Locations: | carcemeterykitchenwheelchairfarmroad triptruckgas stationtexascountryback country |
Characters: | slasher killerserial murdererserial killerterrorvillainkillerboyfriend girlfriend relationshipfamily relationshipsteenagerbrother brother relationshipbrother sister relationshipteenage girlteenage boyhostageself mutilation β¦truck driverself inflicted injury (See All) |
Period: | 1970syear 1973 |
Story: | horror movie remadepsycho filmgrindhouse filmhomicidal maniacpsychopathic killerdrive in classicmurder spreeremadedisturbingbloody violencecreepyweirdodisturbed individualbutcheryserial murder β¦slashingold dark househead woundbad guymadmancharacters killed one by onebody countdark humorbutcherlow budgetgrindhousepsychomutilationmaniackillingmurdererstalkingblondeblood splattersurprise endingknifeviolencebloodphotographchasevoice over narrationbeatingcorpseurinationcamerawritten by directorfalling from heightvomitingsunglassesrunninglow budget filmcollegedecapitationsurvivalfoot chaseflashlightbound and gaggedambushmassacredeath of friendimpalementstabbed in the chesttied to a chairdinnerman with glassesradiodouble crosscontroversyvangraveyardnews reportfive word titlegravebeaten to deathdangerscreamingattackfirst of seriesproduct placementevil manknocked outskeletonscardeath of brotherhairy chestcountrysidetragic eventglassespigtied upfirst partthreatened with a knifechickendirectorial debutgrandmothercult directorcross dressingcowsplatterfreeze framepickup truckchainsawropegothiclifting someone into the airgroup of friendsbarnloss of friendcookvandalismbeardhammerspiderblockbustercovered in bloodvictimproduced by directorskullhitchhikerhitchhikingmasked manfull moonrampageredneckwoman in jeopardydamsel in distresstensiongrandfatherhippiecannibalmercilessnessmutepsychotronicescape attemptcigarette lighterhit on the headjumping through a windowone dayvegetarianswingbarbecuelens flarelaughingkilling spreetank toploss of brotherbloodbathmasked killersouthern accentclose up of eyescar troublehysteriayellingface maskminimal castvomiturban legendscene before opening creditshuman monstermeatestatetexanabandoned housefarmhouseanimal crueltycar washfilm starts with texthit by a truckhillbillyoffscreen killingheld captiveeyeballsummer vacationdeath of boyfriendwheelchair boundwindmillmacabrefacial scarmasked villainslaughterhousepsychological tortureshrineradio newshit with a hammersole survivorpolaroid camerafemale victimpsychotronic filmsledgehammercut handclose up of eyeastrologyfurniturebonelifting person in airsocial decaybludgeoningextreme close upwoman in dangerleg injuryscreaming womansinisterstraight razorcryptcreepman in a wheelchairbroomno endingtoothcaged animalwrenchstate name in titlejumping out a windowsouthbird cagegas station attendantdecomposing bodyrunning out of gaswriting in bloodcut armscreaming in feardinner tablefrozen bodypocket knifeskinbanned filmdead teenagergeneratorstate in titleboneslifting a female into the airruralhuman skulltorturergrave diggermidnight moviehensadisticscreaming in horrorfinger cutbirdcagetroubled productionanthropophagushand woundsouthern gothicreference to draculagrave robbinghoroscopemalletevil laughterhypothermiascream queenyelling for helpsickoburning a photographeating human fleshcontroversialpolaroid photographinbreedinggruesomehell on earthman eatermeat hookrotting corpsesummertimeporch swingarmadillochainsaw murderdreadatonal music scoredesecrationmeat grindermisdirectionfrozen alivedisorientationpower toolbrutalleatherfacebased on ed gein18 wheelervictim invited to dinnercontemporary settingfarmlandrolling down a hillheadlightspower generatorshot in sequencehuman bonemad familybell bottomscut fingerpenknifewearing human skinbroomstickhead traumahouse of horrorsreference to zorroevil smilehaving picture takengroup of fivehit on the head with a hammerdesolateeighteen wheelersoda machinesucking bloodflashbulbfood trayforeshadowstrapped to a tablecutting the palm of one's handhit with a broomrolling downhillscreen doorblowing a raspberrycannibal familycut legevil familytool in title (See All) |
A new family moves into the house on Elm Street, and before long, the kids are again having nightmares about deceased child murderer Freddy Krueger. This time, Freddy attempts to possess a teenage boy to cause havoc in the real world, and can only be overcome if the boy's sweetheart can master her f β¦ear. (Read More)
Subgenre: | slasher flickamerican horrorcult filmsupernaturalparanormalparanormal phenomenateen horrorbody horrorsupernatural horrorurban fantasylgbt horrorcult classichorror b movie |
Themes: | mysterious deathpsychopathvoyeurismmurderdeathfriendshiprevengesurrealismkidnappingghostfearescapemonsterbrutalitysupernatural power β¦paranoiasadismevilpanicshower murder (See All) |
Mood: | darknessslashergorerainhigh schoolnightmarepoetic justice |
Locations: | small townbarschoolswimming poolbusdesertbaseballstormgay barschool busbus driverabandoned factoryschool bus driver |
Characters: | slasher killerserial murdererserial killerterrorvillainkillerboyfriend girlfriend relationshipfamily relationshipshusband wife relationshiphomosexualfather son relationshipmother son relationshipfather daughter relationshipteenager β¦mother daughter relationshipfriendbrother sister relationshipteenage girlteenage boyteachergirlstudentpolicemanlittle girlself mutilationdrivergay teacher (See All) |
Period: | 1980syear 1985 |
Story: | psycho terrorpsycho killergrindhouse filmhomicidal maniacpsychopathic killersadistic psychopathtelephone callobscene gesturedrive in classicmurder spreebutcherysplit personalitybroken windowserial murderslashing β¦bad guymadmanbody countcellarbutchergrindhousepsychomass murdermutilationmaniacobscene finger gesturemurdererbasementscreamcharacter's point of view camera shotchild in perilstabbed to deathstabbingsubjective cameravoyeurhallucinationblood splattersurprise endingknifeviolencecharacter name in titlenuditynumber in titlebloodmale nuditysequelmale rear nuditybondagedogbare chested malefightcigarette smokingpartychaseshowerfirecryingdreamdigit in titleunderwearface slapshotgunslow motion scenewatching tvundressingbikinibare buttsunglassessecond partplace name in titledead bodyneighbornumbered sequeldemonclassroomcriminalf wordfoot chasename in titlemassacrebasketballimpalementfootballstabbed in the chestsnakeapologydream sequencebirdcreaturespankingtransformationbartenderpublic nuditylegendstabbed in the backscreaminglocker roomperson on firepossessionevil mankicked in the facelightningdiaryconvertiblegymhigh school studentexploding bodyratcharacter says i love youthreatened with a knifeclasshaunted housewhippingbare chested male bondagenewspaper headlineredheadundeadcoachapplauseidentityteen angstburned alivekilling an animalnipples visible through clothingelectronic music scorewoundbeer drinkinggothicgay characterlooking at oneself in a mirrorlistening to musiclifting someone into the airjoggingmousestabbed in the stomachbarefoot malevisitcovered in bloodsadomasochismteenage protagonistcrying mans&mback from the deadmale underwearfull moonrampagedamsel in distressseriesblood on faceunderage drinkinggash in the faceescape attempthit on the headmurder of a childrainstormdisfigurementraised middle fingerhomoeroticismsuspectbarbecuebriefskilling spreealarm clocktelekinesisnewspaper clippingmale objectificationtaking a showerbarking doghigh school teacherstuffed animalohiocafeteriaurban legendassumed identitysecond in seriesevil spiritfish tankbroken mirrorbus stopburnt facepush upshearing voicesnewspaper articlevolleyballbare chested boyjock strapteenage sexualitymale name in titlelocked doorbreaking a windowpool partykicked in the headstabbed in the shoulderwhite briefsmoving inmurder suspectcrotch grabreading a newspaperawkward situationjumping into watershape shifterclawwoman in a bikinidance sceneheatriding a bikedead birdundressing someonepsychotronic filmwet clothesbaseball teambreaking through a doorfeet on tabledragging a bodyvillain not really dead clichebreaking a mirrorsleepwalkingplant in titlearms tied overheadleg injuryidentity crisisdomineering fatherno endingglovecaged animalcrying maleshower roomwagontalking to oneselfboom boxbad dreampassive aggressive behaviortoastercut armsecretly observinghand injuryrepeated eventlifted by the throatlocked inchild killerjumping ropechild murdererhand through chestgym classinvisible mansocial outcastblood on handsgay subtextgym teacherplace in titlescarred facedemonicstreet in titleboiler roomsadisticsequel to cult filmclassmate classmate relationshipgarden partykidnapped girlpower planthorror iconburnt handtaking off shoeswalking in the rainhomoerotic fightserial child killertennis racketcoors beerfurnacescreaming mantaking off pantsgory violencemale in a showernursery rhymetennis ballsleep deprivationwatching someone sleeplong tonguemelting facelifting a male into the airexposed brainhand bandagehell on earthmale bare buttmysterious eventburn scarcaged birdkidnapped womanshape shiftingskin rippingarm injuryscience teacherbaseball coachoverweight manteen sexualityfreddy kruegerjumping into a swimming poolnightmare becomes realitybird in a cageraw meatpossessed manclimbing a laddermale female fightsleeping shirtlessbad guy winsbiology teacherbiting someonegrillgroundedspurting blooddragging someoneattempted child murderescape out a windowclothes torn offpet birdsleep disorderclothes ripped offlocking a doorunpunished antagonistcracked mirrorhigh school coachkidnapped boymurder of a nude manscore employs electronic instrumentsserial child murdertaking off socksurban gothicbarred windowelm streetopen endingslashed to deathspringwood ohiothrowing something at someonehit on the head with a ballsleeping in classactor reprises previous rolebloody footprintcrying for helpmale bondagemistaken belief that someone is deadrunning barefoottrampled to deathdomineering husbandschoolmate schoolmate relationshipserial child murderercar over a cliffexploding animalleather barmale antagonistbandaged armescape by the windowface injuryhomophobic remarkreference to jack kerouacsleeping in underwearwrapped in a blanketbiology classburned handfalling asleep in classreading someone's diaryschool gymserial teen murdererarm bandagebroken doorhijacked busleg bandageplaying baseballpossessed boys&m clubsadistic teacherscar tissuecrotch grabbingdrinking coffeeface scarkilled in a showerlying on the floorripped off clothestowel snappingburning oneselffemale voyeurkidnapped manlocked in a carquestioning sexualitybiting legcutting someonedriving off roadhead rippingintroverted boymass panicmurder in a showerpassive aggressive manpouring rainsleeping fully clothedbossy fathergrabbing one's crotchscreaming boytalking with one's mouth full (See All) |
Dr. Miranda Grey is a psychiatrist who works in a penitentiary, in the mental institution sector. She is married with Dr. Douglas Grey, the chief of department where Dr. Pete Graham also works. Chloe Sava, a patient of Dr. Miranda formerly abused by her stepfather, claims that she is frequently rape β¦d by the devil in her cell. After leaving the asylum in a stormy night, Dr. Miranda has a car accident, and when she wakes up, she is an inmate of the institution, being accused of an horrible crime and having no memory of the incident. (Read More)
Subgenre: | psycho thrillersuspensesupernaturalparanormal |
Themes: | mental illnesspsychopathsuicidemurderdeathkidnappingmarriagerapeghostprisonfeartortureescapememorysupernatural power β¦paranoiadrug useinsanitysurveillanceevilunrequited lovepanicdeath of daughtermissing childescape from prisonthe devilmurder of husbandrape and murder (See All) |
Mood: | darknessslashergorerainneo noirnightmare |
Locations: | police stationhospitalswimming poolcarbathtubtaxipolice car |
Characters: | slasher killerserial murdererserial killerterrorvillainkillerfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipdoctortattoofemale protagonist β¦nursepolicemanlawyerreference to godsecurity guardpsychiatristsheriffself mutilationdoctor patient relationshipstepfather stepdaughter relationshipself immolationself cuttingsuicide by jumping off a bridge (See All) |
Story: | psycho terrorpsycho killerpsycho filmhomicidal maniacpsychopathic killersadistic psychopathtelephone callbloody violencedisturbingserial murderslashingkillbad guymadmandead girl β¦cellarpsychomaniackillingmurderersuicide attemptstalkingthroat slittingsubjective camerahallucinationblood splattersurprise endingknifeviolencesexfemale nudityf ratedbloodfemale frontal nudityinterviewflashbackbare chested malegunkissfightphotographexplosionchasepistolshowerfirecryingcell phonedreamcorpsecar accidentmirrorshotgunwatching tvcomputershootingrifletearsrunningcar crashreporterswimmingsurvivalfoot chaseflashlightaxevideo camerawomanbridgeprisonerfalse accusationunderwater scenecigar smokingshot in the foreheadattempted murdermicrophonescreamingperson on firefantasy sequencepay phonefugitiveumbrellapossessionevil manlightningattempted rapeinjectionpursuitdeath of husbandtrusttherapypizzasyringehypodermic needlegothicheavy rainbarnsecurity camerajail cellpatientbuttocksdesperationrape victimrapistmental institutionbarefootwoman in jeopardyjanitorprison guardpillssurveillance camerathunderdeath threatmental hospitalco workerdelusionmedicationframe uptime lapse photographythunderstormwomen's prisonabsent fatherevidencerainstormfemale doctoraxe murdernervous breakdownkilling spreereckless drivingowlnewspaper clippingframed for murdermemory lossintimidationgothvideo tapemental patientelectricitymental breakdownblackoutsatanismblood stainspreadeagledenialhearing voiceslistening to a radiostethoscopescalpelfallingwrist slittingroadblockseizurepsychiatric hospitalshockextreme violencecamcordergraphic violenceinmateman on firetrapdoorfemale victimpurgatoryprophetelectric chairchainssolitary confinementgas explosionmurder victimcircumcisionsecret roomserial rapistflickering lightcar wreckconnecticutdead husbandjumping off a bridgerepressed memoryhospital gownbreaking glassfingerprintsdemonicnew hampshiresedativepenitentiarysadisticdefense attorneyconfinementpsychiatric wardlogiccatatoniatwo killerssinkholeblood pressurecutterinstinctneurosurgeonspontaneous combustionlistening to a car radioholding one's breath underwatercriminally insanedetourfrench shock cinemadependencefreaking outfemale victimsbrake failurehighway patrolmanurban gothicwrist bandagecovered bridgeelectric generatorfootprintsswimming gogglescell blockchained to a bedwoman on firedistorted soundanimal tortureserial rapetemporary insanitymedical restraintsfloodlightbroken car headlight (See All) |
The story centers on a corporate climber who gets stuck working late on Christmas Eve and finds herself the target of an unhinged security guard. With no help in sight, the woman must overcome physical and psychological challenges to survive.
Subgenre: | holiday horrorpsycho thrillerslasher flickchristmas horrorpsychological thrillersuspenseblack comedyindependent film |
Themes: | mental illnessobsessionpsychopathdrunkennesschristmasmurderdeathrevengekidnappinginfidelitybetrayalfearescapeinvestigationdeception β¦lonelinessparanoiainsanitysurveillanceabductioncrueltypanicmadnessnear death experience (See All) |
Mood: | one nightdarknessslashergoreneo noircar chase |
Locations: | citynew york citycarsnowwatertaxielevatorurban settingpolice caroffice |
Characters: | slasher killermysterious villainpolice detectivepolicefemale protagonistpolice officerpolicemanhostagesecurity guard |
Period: | winter |
Story: | christmas lightschristmas evechristmas treetelephone calldeeply disturbed personcharacters killed one by onebody countholidaymaniacobscene finger gesturestalkingcharacter's point of view camera shotstabbingstrangulationsubjective camera β¦cleavagevoyeurblood splattersurprise endingknifeviolencenumber in titlebloodone word titledogfightexplosionpartychasefirecryingcell phonehigh heelsbeatingcorpsedigit in titlefistfightcar accidentmirrorpunched in the facebrawlplace name in titlerunningcar crashhandcuffsmanhattan new york cityf wordsurvivalfoot chasenewspaperflashlightbound and gaggedwineaxevideo cameraambulancewomantied to a chairnonlinear timelineexploding carfalse accusationapologyhit by a cardouble crossduelattempted murderargumentstalkerorganized crimestabbed in the backscreamingperson on fireelectrocutionattackproduct placementknocked outkicked in the faceattempted rapebodyguardexploding bodyisolationdie hard scenariorecord playerpickup truckeavesdroppinganswering machineburned alivekilling an animalsociopathsecurity cameracaptivekicked in the stomachvideotapeimpersonationcovered in bloodteddy bearfaked deathparking garageanimal attackcrushed to deathduct tape over mouthbarefootwoman in jeopardydamsel in distresstensionfloodstealing a cartrappedbloody nosesurveillance cameramisunderstandingpower outagebusinesswomantitle appears in writingco workerescape attemptstabbed in the headsexual harassmentdisembowelmentaerial shotblood on shirtdead manone daybuildinggasolinestabbed in the eyelonerduct tapenervous breakdownburned to deathreckless drivingchloroformphysical abuseflat tiredead dogintimidationintestinesreference to elvis presleyaccountantcar troubleyellingchristmas presenttaserdisposing of a dead bodyanimal abusemind gamebody in a trunkdruggedhandcuffedwoman kills a manstabbed in the shouldermurder witnesssexual frustrationcar set on firetow truckgropingoverturning carmenacenervousnesshomeless personwoman fights a mantormentcrowbarpsychological torturefemale victimwhite dressimprovised weapontrunklocked in a roommolestationanimal killingdoormanman hits a womanstupid victimfake accentreal timesurveillance footagechrysler building manhattan new york citycat and mousecrime of passiontauntingchristmas decorationstragic villainwrench911power failurebipolar disorderwoman punches a mancrushed by a carforkman fights a womanhomeless womannight watchmanrottweilerman punches a womansingle set productionwoman hits a mandog bitehandcuffed womanrental carnew york city skylinetire ironfire hosechased by a dogno cellphone signalduct tape gaglock pickdumb policesprinkler systempettingflipping carstabbed with a forksleeping womanclaustrophobicderangedemployee employee relationshippersonality disorderstuck in an elevatorattacked with a knifefingernail cut offdragged by a carelvis presley impersonatorsanta costumevictim invited to dinnercar showroomdeath of a petvideo screenkilling a petflooded roomwet dressburned up cartitle appears on screenbitten in the legbroken cameratitle appears in text on screenchicken racerace impersonation (See All) |
Serial Killer Michael Myers is not finished with Laurie Strode, and their rivalry finally comes to an end. But is this the last we see of Myers? Freddie Harris and Nora Winston are reality programmers at DangerTainment, and are planning to send a group of 6 thrill-seeking teenagers into the childhoo β¦d home of Myers. Cameras are placed all over the house and no one can get out of the house... and then Michael arrives home! (Read More)
Subgenre: | slasher flickamerican horrorcult filmindependent filmteen horror |
Themes: | murder of a police officerpsychopathmurderdeathrevengefeardeceptionsurveillanceevil |
Mood: | slashergoresatire |
Locations: | forestwoodskitchenwheelchairrooftopfire truck |
Characters: | slasher killerserial killervillainkillerteenage girlteenage boynursesecurity guardpsychiatristcoroner |
Period: | 2000s |
Story: | homicidal maniacpsychopathic killersadistic psychopathpolice officer throat slitcrime spreeserial murderold dark househiding in a closetbad guycharacters killed one by onebody countmaniackillingobscene finger gesturemurderer β¦character's point of view camera shotstabbed to deaththroat slittingstrangulationsubjective camerablood splattersurprise endingknifetwo word titleviolencefemale nuditybloodsequelflashbackfightchasefirecell phonecorpsefistfightmirrorwatching tvcomputercameraundressingbrawlfalling from heightmaskshowdownf worddecapitationgood versus evilhalloweenfoot chaseflashlightaxeambulancemontageimpalementstabbed in the chestinternetsevered headpolice officer killednews reportstabbed in the backelectrocutionproduct placementevil mankicked in the facecollege studentlightningskeletondisappearanceneck breakingthreatened with a knifesevered armchainsawheavy rainlifting someone into the airsecurity cameraloss of loved onemorgueskullfatebroken legmasked manmental institutionrampagestabbed in the throatstabbed in the headblack brae mailrainstormraised middle fingergasolineaxe murdercasual sexsequel to cult favoritekilling spreemasked killernewspaper clippinghalloween partytext messaginginterrupted sexvideo surveillancereturning character killed offhuman monsterabandoned housewebcamclimbing through a windowwhodunithanging upside downlocked doorbreaking a windowjockbody baghanged manhead cut offfilmed killingmurder attemptbutcher knifeman on firelocked in a roombreaking through a doorpeep holestupid victimbreaking a mirrorx rayed skeletonsecret roomleg woundcamera focus on female buttimpersonatoreighth partmichael myersdead teenagerlifting a female into the airboogeymandeath by electrocutionskull crushingjumpsuitsee you in hellcult film referencedecomposed bodybutt grabserial teen killerclown maskovernight in a haunted housereality tv productioneyes wide openwhite maskair hornreal movie shown in fictional situationcord (See All) |
Picking up where the original Nightmare left off, Nancy has grown up and become a psychiatrist specializing in dream therapy. She meets a group of children at a local hospital facing Freddy Krueger, the same demon she once encountered in her sleep. One of them is Kristen, who has the power to draw o β¦ther people into her dreams. Working with a male doctor assigned to the case, Nancy helps the kids realize their special abilities within the nightmare world. When Freddy captures one of her charges, she leads a rescue attempt into Krueger's domain, in hopes of putting his spirit to rest once and for all. (Read More)
Subgenre: | psycho thrilleramerican horrorcult filmindependent filmsupernaturalstop motion animation |
Themes: | psychopathmurderdeathghostfuneralmonstersupernatural powerinsanitysadismevil |
Mood: | slashergorenightmare |
Locations: | barchurchcemeteryschool boy |
Characters: | slasher killerserial murdererserial killerterrorvillainkillerfather daughter relationshipteenagermother daughter relationshipdoctornursetough guylittle girlsingle motherself mutilation β¦alcoholic fatherevil nurse (See All) |
Period: | 1980s |
Story: | psycho killerhomicidal maniacpsychopathic killersadistic psychopathdrive in classicmurder spreebloody violencedisturbingcreepybutcherycarnageserial murderslashingbad guymadman β¦characters killed one by onebody countdead childbutchermaniackillingmurdererbasementsuicide attemptdollchild in perilstabbed to deathstabbingblood splattersurprise endingviolencefemale nuditynumber in titlesequelbondagebare chested malecigarette smokingfiredreamcorpsedigit in titleslow motion scenethongfalling from heightbedrock musicbathroomnumbered sequeldemondecapitationfoot chasenewspaperdeath of friendimpalementstabbed in the chestnundream sequenceradiotonguethird partcharacter repeating someone else's dialoguestabbed in the backscreamingpuppetpay phoneevil manskeletonisolationcharacter says i love youundeadsplatterfalling down stairsteen angstelectronic music scorelifting someone into the aircomaragetied to a bedcrucifixvictimback from the deadclockdrug overdoserampageswitchbladetrappedwindmutefalling to deathhypnosisstairsstabbed in the legschool uniformjumping through a windowknife fightfogdisfigurementstabbed in the eyekilling spreepajamassmokealleyreturning character killed offohioevil spiritabandoned housestabbed in the armgroup therapyboy with glassesburnt facebody in a trunkscalpelone linerdruggedwrist slittingrazor bladedisembodied headwheelchair boundsuper powerpsychiatric hospitalaspiring actresshit with a shovelclawthird in seriestelevision setdigging a gravemattressgymnasticsvillain not really dead clicheghoulsolitary confinementbreaking a mirrorsleepwalkingpitholy waterchantingfedoraglovetroubled teensexual innuendopayphonecut armreanimationfalling asleeplifted by the throattricyclechild killerjumping ropehospital gownmarionetteorderlychild murdererdead teenagerboneslifting a female into the airbad motherhanged boydemonicsedativestreet in titleboiler roomforced suicidesadisticboogeymansexy nursegluereference to edgar allan poeserial child killerfurnacedungeons and dragonsnursery rhymehanged girlbourbonmohawkpunk girljump scarelong tongueolder woman younger manexperimental drugteen smokingburn scardream within a dreamskipping ropescaredshared dreamscratchingfreddy kruegerburned with a cigarettependulumgroup of teenagersstabbed with glassfootstepsserial teen killerdead pigpromiscuous motherbegins with a quotebossy motherinanimate object comes to lifespeaking spanishsleep disordernewton's cradleex drug addictfeathersserial child murderelm streetspringwood ohiofalling leavespapier macheserial child murdererteenager in dangerveinhomemade weaponstabbed with a needleselective mutismbreaking through wallphysical harmbicycle bellchase scenecommitted to asylumdiet cokeisolation cellkids playingscar tissuewidowed motherbathroom sinkminiature modelshoutteenager murderedunfit mothercarrying a childchasing a girlforced drug usenegligent motherteardrop tattoocarrying a girldisabled characterdisabled teenagerinstant coffeeolder woman younger boypopsicle sticktendon (See All) |
A film about two homicide detectives' ('Morgan Freeman (I)' (qv) and ('Brad Pitt' (qv) desperate hunt for a serial killer who justifies his crimes as absolution for the world's ignorance of the Seven Deadly Sins. The movie takes us from the tortured remains of one victim to the next as the sociopath β¦ic "John Doe" ('Kevin Spacey' (qv)) sermonizes to Detectives Somerset and Mills -- one sin at a time. The sin of Gluttony comes first and the murderer's terrible capacity is graphically demonstrated in the dark and subdued tones characteristic of film noir. The seasoned and cultured but jaded Somerset researches the Seven Deadly Sins in an effort to understand the killer's modus operandi while the bright but green and impulsive Detective Mills (Pitt) scoffs at his efforts to get inside the mind of a killer... (Read More)
Subgenre: | psycho thrilleramerican horrorcult filmtragedy |
Themes: | psychopathmurderdeathrevengerapereligionjealousytortureinvestigationangerinsanityevilgreedmurder investigation |
Mood: | slashergorerainneo noir |
Locations: | police stationhospitalbarhelicopternightclubdeserttaxiurban settingapartmentrooftopbrothel |
Characters: | slasher killerserial murdererserial killerterrorvillainpolice detectivekillerhusband wife relationshippoliceprostituteteacherdetectivephotographerlawyerinterracial relationship β¦lustsecurity guardbiblepolice shootoutpimppregnant womanself mutilationcoronersuicide by cop (See All) |
Story: | psycho terrorhomicidal maniacpsychopathic killersadistic psychopathmurder spreedisturbingcreepycrime spreeserial murderkillbad guymadmanbody counthomicidepsycho β¦mutilationmaniackillingmurdererscantily clad femaleblood splattersurprise endingviolencenumber in titlebloodone word titleinterviewdogbare chested malephotographtitle spoken by characterchasepantiespistolshootoutcorpsedigit in titleshot to deathcar accidentshot in the headshotgunarrestheld at gunpointinterrogationprostitutionhandcuffsrevolvercriminaldecapitationfoot chasegay slurflashlightambulancedinersubwaywhite pantiessevered headhit by a carnews reportshot in the foreheadattempted murderlibraryevil mansadnesstied uptypewriterfreeze framegirl in pantiestv newscard gamepokergothictape recordersociopathtied to a bedfbi agentcrucifixloss of wifeblockbusterswat teamsevered handrapistswitchbladeobesitypedophileprideautopsybulletproof vestdisfigurementknife throwingboxkilling spreeage differencedead dogalleycartoon on tvhuman monsterspiral staircasecockroachinformanturban decayenvypolice captaindistrict attorneyoffscreen killingscene of the crimewrathrazor bladefashion modelcluedarkroomtwo way mirrorhomeless personhitchcockianintentionally misspelled titlepsychological torturespaghettibarbershopmass murdererinnocent person killedstairwellpolice partnerjumping from a rooftopwriting in bloodel trainswatpolice protagonistbreaking down a doorsleeping pillsreference to ernest hemingwayfingerprintstorturerreference to jack the ripperforced suicidegluttonywearing a sound wirenumber as titlemetronomeseven deadly sinstenementslothmixed alpha numeric titleabandoned apartmentnumber 7 in titleplea bargaindart boardbad guy winshyperventilationstar wars referencevictim invited to dinnercredits rolling downphoto laburban gothicdelivery serviceblack detectivereference to jodie fosterair freshenerbody shavingface bandageforced eatingreference to geoffrey chaucerreference to marquis de sadereference to st. thomas aquinas (See All) |
The film follows Jennifer, a writer who is working on a new novel and needs to get out of the city to finish it. She rents a riverside cabin in upstate New York to work on her novel, attracting the attention of a number of rowdy male locals. They catch Jennifer one day and strip her naked for the vi β¦llage idiot (Matthew) and rape her. Jennifer is later attacked and raped a further two times by the four degenerates, and her novel is also destroyed. But Jennifer recovers, and in her now-twisted, psychotic state, she begins to seek revenge on the men. (Read More)
Subgenre: | american horrorcult filmindependent filmb movievideosadistic horrorhorror b movie |
Themes: | psychopathvoyeurismmurderdeathrevengekidnappingrapefeartortureseductionangerbrutalityhumiliationsadismevil β¦exploitationcrueltyvengeancerape and revengerevenge murder (See All) |
Mood: | slashergore |
Locations: | citysmall townnew york citychurchforestcarbathtubbicyclewaterlakegas stationcountry |
Characters: | serial murdererserial killervillainkillerfemale protagonistgirlwriterlustself justicesex with a stranger |
Period: | 1970s |
Story: | psycho killermultiple homicidegrindhouse filmpsychopathic killersadistic psychopathdrive in classicmurder spreedisturbingcreepycarnageserial murderkillcharacters killed one by onepsychoticbody count β¦low budgetgrindhousemutilationkillingmurdererscantily clad femalecleavagetelephonevoyeurknifeviolencefemale nuditybloodmale nuditybare breastsfemale frontal nuditymale frontal nuditybare chested malegunfemale rear nudityfemale full frontal nuditycigarette smokingnipplesmale full frontal nudityleg spreadingpantiesfondlingcryingbeatingmirrorbikinilow budget filmmale pubic hairriveralcoholnewspapergangnew yorkaxefemale pubic hairwhite pantiesdrivingman with glassescontroversydrowningjeanspublic nudityone against manysmokinggraveauthorscreamingunderground filmevil manhangingfemale removes her clothesglassesthreatcabinhandgunvigilanterecord playereyeglassesclaim in titlenipples visible through clothinginjurysexual abuseragedesperationvictimrape victimrapistfemale killerredneckwoman in jeopardymercilessnessdeath threatdark herosexploitationpanties pulled downgang rapeperversioncastrationaxe murderbruisekilling spreemisogynywoman in bathtubpervertviolence against womenvigilantismmisogynisthuman monstercanoefemale removes her dressmental retardationsexual perversionsexual violencefemale psychopathloserharmonicadegradationanal rapebubble bathheld captivewhite trashwrathmotorboatfemale villainatrocitywoman wearing only a man's shirtbleeding to deathhammockextreme violencegraphic violencemurderesssmall breastsfemale prisonerfemale victimshared bathone woman armyviolent deathdelivery boynoisesexual humiliationsuspendersfemale writersex on the floorgenital mutilationdeath by hangingmistreatmentconnecticutdebaucheryfemale serial killersexual sadismsexual crueltybanned filmhanged boysadisticeye candyinfamygory violenceeast coastmisandryvideo nastyfemale murderergruesomelasciviousnessreference to coca colawoman murders a manoral rapefemale vigilantereading in bedrevenge killingextreme filmman forced to stripturning the tableswriter as protagonistmaking lovewoman haterpredator turns victimcut off penisderanged manpredator becomes preyrapist comeuppancetorture threatjean jacketsexy legsunpunished crimeforced fellatiopucciniloss of peniswoman's revengewoman on all foursbag of groceriesbottle rapemale genital mutilationrepetitive rape victimdisgusting (See All) |
Following up the previous Nightmare film, the dream demon Freddy Krueger is resurrected from his apparent demise, and rapidly tracks down and kills all three of the surviving Elm Street kids. However, Kristen (who has the ability to draw others into her dreams) wills her special ability to her frien β¦d Alice before her demise. Afterwords, Alice soon realizes that Freddy is taking advantage of that unknown power she now wields to pull a new group of teenage children into his foul domain. (Read More)
Subgenre: | american horrorsuspenseblack comedycult filmindependent filmmartial artssupernaturalparanormal |
Themes: | psychopathmurderrevengefuneralsupernatural powerevil |
Mood: | slashergorerainhigh schoolnightmare |
Locations: | small townhospitalbeachcemeteryelevatorschool nurseblood in water |
Characters: | slasher killerserial murdererserial killerterrorvillainkillerfather son relationshipfather daughter relationshipteenagermother daughter relationshipafrican americanbrother sister relationshiptough guylittle girlwaitress |
Period: | 1980s |
Story: | psycho killerhomicidal maniacpsychopathic killersadistic psychopathdrive in classicmurder spreedisturbingbutcheryserial murderslashingold dark housebad guybutchermutilationwoman with glasses β¦maniackillingmurdererstabbed to deathblood splattersurprise endingnumber in titlebloodsequelfemale frontal nuditydogbare chested malecigarette smokingphotographfiredreamcorpsedigit in titleurinationface slappunched in the faceplace name in titlerock musiccar crashneighbornumbered sequeldemonambulancedeath of frienddinerstabbed in the chestsevered headcoffincharacter repeating someone else's dialoguelocker roomwidowerperson on firepay phoneevil mankicked in the faceskeletondeath of brothercheerleaderdeath of songlassesunderwatersevered armsleepingundeadpizzasurgeryteen angstelectronic music scoreslow motionlifting someone into the airstabbed in the stomachkicked in the stomachfourth partmovie theatercrushed to deathback from the deadrampageseriesresurrectionstabbed in the headblack and white scenedaydreamsouldisfigurementabusive fatherlooking at self in mirrorbroken armkilling spreevillain played by lead actorreturning character killed offneedlejunkyardohiodefecationcockroachevil spiritbugweightliftingclimbing through a windowfish tankbroken mirrorasthmaburnt facebody in a trunkdripping bloodafrican american womanpunching bagjockdeath of boyfriendhome videoclawburn victimtime loopplant in titlehead ripped offreturning character with different actorwater fountainfedoralifting female in airbandanaglovetroubled teendeja vufalling through the floorman dressed as womanpayphonereanimationcrushed by a cardaydreamingrepeated eventfalling asleepchild killersleeping pillsbitten on the armchild murdererhand through chesttorturerafrican american mandemonicoverprotective fatherstreet in titleboiler roomsadisticsequel to cult filmreference to aristotleserial child killerwaterbedlucid dreamdead body in waterthrown through a wallburn scarpin upsandcastlefreddy kruegerreflection in watertumbleweeddart boardserial teen killerbitten by a doghand through headnunchuckreflection in car mirrordog urinationtheatre marqueeasleep at the wheelloss of best friendhole through torsoserial child murderelm streetspringwood ohiofilm starts with a quotepin up girlserial child murdererfemale stuck in sticky substanceproducer cameofalling asleep in classscar tissuevolkswagen cargrumpy father (See All) |
A group of young adults set up tent near the abandoned summer camp where a series of gruesome murders are said to have taken place back in 1980. The perpetrator was a grieving mother, driven insane by the drowning of her child, Jason, whom she believed was neglected by the camp counselors. As legend β¦ has it, the last survivor of the attacks beheaded the woman. But then Jason came back, and now he is a vengeful and inexorable killer, wielding crossbows, swords, axes and other sharp instruments. The legend proves horribly true, as these campers quickly discover. Six months later, the brother of one of those campers distributes posters of his missing sister. The police believe she took off with her boyfriend; but he knows better. The brother crosses paths with an uptight young rich guy who is having his girlfriend and friends over at his parents' cabin. The brother ends up at the cabin himself just before his sister's attacker sets upon them all. (Read More)
Subgenre: | psycho thrillerslasher flick |
Themes: | murder of a police officerpsychopathdrunkennessmurderdeathrevengetorturebrutalitydeath of motherevil |
Mood: | darknessslashergorehorror movie remake |
Locations: | forestmotorcycleboatbathtubbicyclewaterwoodspolice carlakecampfiretunnelschool busbackwoodssex in a tent |
Characters: | serial murderermysterious villainterrorvillainkillerboyfriend girlfriend relationshipafrican americantattoobrother sister relationshipteenage girlsheriffasian americanblonde girlgirl nudity |
Period: | 1980s |
Story: | psycho terrorpsycho killerhomicidal maniacpsychopathic killersadistic psychopathknife murdertelephone callfireplace pokerweirdoserial murderslashingbad guycharacters killed one by onepsychoticbody count β¦psychomutilationmaniacstalkingmissing personscantily clad femalestabbed to deaththroat slittingstabbingstrangulationcandlehallucinationblondeblood splattersurprise endingviolencefemale nuditynuditynumber in titlebloodbare breastsfemale frontal nuditymasturbationdogbare chested malesex scenefemale rear nuditynippleschasepistolfiretopless female nuditywoman on topcorpsedigit in titleurinationremakeshot in the headbare buttmaskdead bodymarijuanaalcoholswimmingdecapitationflashlightbratoplessaxemassacrevideo cameradeath of friendimpalementstabbed in the chestsevered headcultbreast fondlingdrowningskinny dippingstalkerstabbed in the backprologuescreamingmini skirtmoaningtentevil manopening action scenedisappearancepremarital sexsuspicionlove interestkissing while having sexpot smokingfireplacebow and arrowburned aliveelectronic music scoremachetescene during opening creditscaptivewalkie talkiebuttockscampcovered in bloodmasked manrampagerear entry sexgrocery storenew jerseybackpackstabbed in the throatpower outageconvenience storenipplestabbed in the headstabbed in the leghit on the headjumping through a windowperversioncellphonedisfigurementbody landing on a carstabbed in the eyeaxe murdersevered legarrowburned to deathmasked killermannequinplantvillain played by lead actorbeheadingporn magazinestabbed in the handbonghuman monstercanoestaircaseabandoned houserear nuditydisposing of a dead bodyshot with an arrowfemale psychopathloud sexno title at beginningbroken mirrorblood stainnude girlbaseball capheld captivedripping bloodday in titletopless girlcowgirl sex positionhanged manhead cut offburnt bodycountry housesole black character dies clichebra removinggraphic violenceopen endedcheating boyfriendmurderessmasked villainspitting blooddeformitytelevision setpool of bloodfemale victimold housenakedsilhouettestupid victimvillain not really dead clichejerklocketpsychosissex from behindwoman in dangerleg woundcreepbudweiserfalling through the floorgpsbear trapsleeping bagwoman moaning from pleasurewoman moaningsevered earmoaning womanfreezerstabbed in the footbutt nakeddrinking from the bottleremake of american filmfemale serial killerscrewdrivernaked buttwoman's bare buttdrinking gamewater skiingteenager fighting adultbreaking glassgirl toplesshockey maskkitschvideotaped sexmissing person posterhockey stickheavy drinkingtouching someone's breastsdeath by impalementgirl in brasource musictouching breastsremake of cult filmsickounderwater photographylake housefemale bare footstabbed through the chestcamp counselorhearing noisescampfire storymissing sistersummer housepower cutshower curtainunderground tunneldisobediencehands covering breastsleg cut offbouncing breastsmutilated bodyfriday the thirteenthleg ripped offatonal music scoreaxe in the chestcampgroundmachete mutilationhead chopped offhickremoving a braman and woman naked in bedtaking off braglow sticktouching breastcowgirl sexnaked woman in bedtopless swimmingwoodchipperaxe in the backbug zappermale with earringdoggie style sex positionstabbed through backwoman on top sexdo not disturb signboat dockwessex county new jerseycrystal lake new jerseywakeboardingarrow through the headblood bathimpaled through the headnude female silhouettebleeding headserial teen murdererbreasts bouncingbroken chairkilled by machetewoman covering nudity with her handswoman removes her bracreaking doorwoman covering breastsreference to macgyver (See All) |
As the centennial of the small town of Antonio Bay, California approaches, paranormal activity begins to occur at midnight. 100 years ago, the wealthy leper Blake bought the clipper ship Elizabeth Dane and sailed with his people to form a leper colony. However, while sailing through a thick fog, the β¦y were deliberately misguided by a campfire onshore, steering the course of the ship toward the light and crashing it against the rocks. While the town's residents prepare to celebrate, the victims of this heinous crime that the town's founders committed rise from the sea to claim retribution. Under cover of the ominous glowing fog, they carry out their vicious attacks, searching for what is rightly theirs. (Read More)
Subgenre: | american horrorcult filmindependent filmparanormalcreature feature |
Themes: | murderdeathrevengeghostfearescapemonstersupernatural powerevil |
Mood: | darkness |
Locations: | small townbarbeachchurchwaterrural settingseashipcampfirefishing boatghost ship |
Characters: | mysterious villainterrorvillainmother son relationshipchildrenboyzombiepriestsingle motherlittle boysheriffemployer employee relationshipcatholic priest |
Period: | 1970s1980syear 1979 |
Story: | horror movie remadegrindhouse filmdrive in classicremadedisturbingcreepyhookbutcheryslashingmysterious manbad guydark pastslaughterbutchergrindhouse β¦mass murdermutilationkillingchild in perilstabbed to deathstabbingsurprise endingknifetwo word titleviolencebloodchasecorpsesworddead bodydemondecapitationcaliforniawomanimpalementcursemicrophonestorytellingevil manspeechcrosscult directorundeadrecord playerpirategoldelectronic music scoregothictape recorderlifting someone into the airstabbed in the stomachcrucifixtreasurevictimhitchhikercelebrationwoman in jeopardyreverse footagepower outagepsychotronicautopsyfogeye gougingpierkilling spreelighthousedjliving deadspiral staircasejournalevil spiritblackoutradio stationcoastlistening to a radioscalpelhand over mouthvolkswagenmaggotghoulradio broadcasttragic villainmistphonograph recorddocksmusic score composed by directorstained glass windowdemonicbayfemale hitchhikercampfire storyhell on earthmutilated bodyleperticking clockgrimfemale djcorpscentennialfoghornwitching hour (See All) |
Just when the streets seemed safe, a serial killer with a fetish for scalps is back and on the hunt. Frank is the withdrawn owner of a mannequin store, but his life changes when young artist Anna appears asking for his help with her new exhibition. As their friendship develops and Frank's obsession β¦escalates, it becomes clear that she has unleashed a long-repressed compulsion to stalk and kill. (Read More)
Themes: | obsessionpsychopathmurderdeathfeartorturelonelinessbrutalitydepressiondrug useinsanitysadismunrequited lovephotographychildhood trauma β¦psychological trauma (See All) |
Mood: | slashergoreneo noir |
Locations: | restaurantlos angeles californiasex in public |
Characters: | mysterious villainserial killerterrorvillainkillerhomosexualmother son relationshiptattooprostitutephotographer |
Period: | 1980s2010s |
Story: | psychopathic killerknife murdermurder spreedisturbed individualserial murderslashinghiding in a closetkillbad guysuffocationdead woman with eyes opendark pastmaniacstalkingstabbed to death β¦strangulationsubjective cameravoyeurhallucinationblood splatterknifeviolencebloodone word titlethreesomeflashbackfemale rear nudityphotographcell phonecorpseurinationremakecomputercameravomitingcar crashbathroomneighborfoot chasebound and gaggedwinecocainestabbed in the chestsubwaychild abusehit by a carbreast fondlingvannews reportlooking at the cameranecklacetalking to the cameracharacter repeating someone else's dialoguestabbed in the backevil mankicked in the facetragic eventthreatened with a knifesevered armdismembermentlooking at oneself in a mirrorscene during opening creditsragemovie theatervictimart galleryschizophreniaapartment buildingrampagepillsrejectiondeath of protagonistdisembowelmentwedding dresstied feetnervous breakdownsevered legmisogynymannequinwoman in bathtubvillain played by lead actorconfusionstabbed in the handhuman monstersubway stationsexual perversionbroken mirrorwoman in bra and pantiesballerinadripping bloodtattooed womanmeat cleaverextreme violencetied up while barefootfemale victimstrangled to deathschizophrenicbreaking through a doormurder of a nude womanonline datingbreaking a mirrorarm ripped offexhibitiondrugstorestabbed in the mouthtalent agentremake of american filmstabbed in the sidegutsdead woman on bedreference to frankensteinwoman strangled to deaththrown through a windshieldscalpingsevered faceoedipus complexstabbed through the chinmigraineleg ripped offpharmaceuticalsachilles tendon cutbased on ed geinbridal gowninner monologuebug spraystabbing a womanreflection in a car mirrorhiding under a carmirror above bedlip piercingnasal spray (See All) |
Suzy Bannion travels to Germany to perfect her ballet skills. She arrives at the Tanz dance academy in the pouring rain and is refused admission after another woman is seen fleeing the school. She returns the next morning and this time is let in. She learns that the young woman she saw fleeing the p β¦revious evening, Pat Hingle, has been found dead. Strange things soon begin to occur. Suzy becomes ill and is put on a special diet; the school becomes infested with maggots; odd sounds abound; and Daniel, the pianist, is killed by his own dog. A bit of research indicates that the ballet school was once a witches' coven - and as Suzy learns, still is. (Read More)
Subgenre: | psychological thrillersuspensecult filmindependent filmcoming of ageconspiracysupernaturalfish out of waterarthouseart horrorsupernatural horroritalian horror |
Themes: | mysterious deathvoyeurismdrunkennessmurderdeathfriendshipsurrealismfearescapedancedeceptionbrutalitysupernatural powerparanoiaillness β¦sadismevilunrequited lovecrueltypanicblindnessself sacrifice (See All) |
Mood: | darknessslasheravant gardegorerainnightstylization |
Locations: | schoolswimming poolforesttaxiairportwoodsapartmentgermanytaxi driver |
Characters: | mysterious killerkillerteenagerfrienddoctorboyteenage girlfemale protagonistteachergirlpolice officerstudentsister sister relationshippsychiatristprofessor β¦witchgermanamericanamerican abroadself mutilationaunt nephew relationshipevil witchnew student (See All) |
Period: | 1970syear 1977 |
Story: | grindhouse filmunknown killerpsychopathic killerknife murdertelephone calldrive in classicremadebloody violenceslashingdead woman with eyes openatticdead womangrindhousekillingmurderer β¦pianistscreammissing personcharacter's point of view camera shotstabbed to deaththroat slittingstabbingstrangulationsubjective cameratelephonevoyeurhallucinationpianoblood splattersurprise endingknifeviolencebloodone word titleflashbackdogcigarette smokingdancingexplosionchasefirevoice over narrationcorpseslow motion scenesecretfalling from heightshowdownbathroomdemonswimminggood versus evilfoot chasewineambushdeath of friendimpalementtoiletstabbed in the chestcoffinritualattempted murderlegendcharacter repeating someone else's dialoguedangerprologuescreaminglocker roomcover upcollege studentlightninghangingdisappearanceinjectionsuspicionfirst partthreatened with a knifeballetcult directorpubeuropeitalianocculteavesdroppingburned alivekilling an animalnipples visible through clothingelectronic music scorehypodermic needlegothicheavy rainlooking at oneself in a mirrorfaintingcookexploding buildingwitchcraftnosebleedgossipservantvisitcovered in bloodvictimanimal attackschizophreniafull moonreverse footagebloody noseblood on facestabbed in the throatfemale leadmercilessnesspower outagestabbed in the neckmutebroken glasspsychotronicescape attemptcigarette lighterheartaerial shotshadowblood on shirttitle at the endrainstormdisfigurementnotedressing roomblind manopening a doorroomlightbatpiano playerbarbed wireinvisibilityspiral staircasegerman shepherdmetaphorevil spiritpiano playingclimbing through a windowsleepschool principalwhisperinghearing voiceswormwhistlingrazoroffscreen killingbitten in the neckmacguffinpsychiatryrazor bladebreaking a windowhallwaygraphic violencemaggotcoughing blooddog attacklocked in a roomsecret passageheadmasterhouse on firesilhouetteanimal killingfade to blackghoulglowing eyesnoiseextreme close upzippo lightersinisterwethorror artbitten in the throatblond boythroat rippingflickering lightacademydrinking bloodleotardtaxi ridehidden doorexterminatorgargoyleevil powerfragments of glasshanged womanitalian cinemademonicmale dancerstabbed in the heartknife woundprogressive rockfiendwiredance instructorcovengory violencesatanichanged girlindoor swimming poolhell on earthrotting corpsehole in chestdrugged foodemployee dismissalreanimated corpsestabbed with glassfootstepsseeing eye dogballet schoolballet teacherbitten by a dognauseahallucinogenicwall paintingmultiple stabbingshiding behind a doorballet shoesfalling through a glass roofrotten foodattacked by a dogmusical sceneguide dogstained glassstudy abroadcolor blindnesspsychiatric treatmentknife in throatserving traywoman hangedraspy voiceblind musiciandance academypainting fingernailsempty worldthematic cinema (See All) |
"Sorority Row" sees a group of sorority sisters try to cover up the death of their house-sister after a prank gone wrong, only to be stalked by a serial killer.
Subgenre: | black comedy |
Themes: | drunkennessmurderdeathfriendshipbetrayalguilt |
Mood: | slashergorehorror movie remake |
Locations: | kitchenfire truck |
Characters: | mysterious killerserial killeralcoholickillerboyfriend girlfriend relationshipfather son relationshipbrother sister relationshipinterracial relationshipdeath of a friend |
Story: | sorority housesororityhiding in a closetcharacters killed one by onedead woman with eyes opendead womanbasementstalkingscreamscantily clad femalethroat slittingstrangulationcleavagevoyeurhallucination β¦blondeblood splattersurprise endingknifeviolencefemale nuditybloodfemale frontal nuditymale rear nuditybare chested malefemale rear nuditypartychasepantiesshowerfirecell phonecorpsemirrorshot in the chestremakeshotgunslow motion scenepunched in the facebare buttsecretvomitingheld at gunpointlingeriecollegehandcuffsalcoholflashlightaxeambulancedeath of friendimpalementstabbed in the chestaccidentwhite pantieshit by a carpublic nudityblack pantiescharacter repeating someone else's dialogueperson on firemini skirtchampagnecover upcollege studentbraceletpranklong takecharacter says i love youburned alivelooking at oneself in a mirrorsociopathfaintingscene during opening creditscatfightloss of friendtherapistnosebleedbroken legpump action shotgunwoman in jeopardystabbed in the throatironygash in the facestabbed in the neckstabbed in the headsenatorstabbed in the legaccidental killinghot tubraised middle fingercanered pantiesmisogynyfemale in showerlyingfirefighterlaptop computervodkatext messagingintimidationgraduationfire extinguishermolotov cocktailreference to facebookmisogynistwebcamdisposing of a dead bodyconstructionjacketbubble bathwoman in bra and pantieswrist slittingreference to youtubeshot through the mouthfilmed killingcheating boyfriendbutt slapcamera phoneflare gunhouse on firemurder of a nude womandragging a bodycomeuppancefalling through the floortied to a treegpsdiscovering a dead bodystabbed in the mouthhooded figureaxe in the headcprdrink thrown into someone's facetire ironmine shafthandcuffed to a bedhit on the head with a fire extinguisherfoaming at the mouthwoman stabbedrotting corpsestabbed through the chinbeer kegprank gone wrongsorority girlcalling for helpcollege graduationwild partyreference to lindsay lohanrunning out of ammosoap bubblevaledictorianflare gun as weaponfalling down a shaftshot glassstabbed through the mouthfoamshot in the mouthbeer bongluncheonsorority partyfall through floorpleading for helpjust desserts (See All) |
1 year after her mother's death, Sydney Prescott (Neve Campbell), and her friends started experiencing some strange phone calls. They later learned the calls were coming from a crazed serial killer, in a white faced mask and a large black robe, looking for revenge. His phone calls usually consist of β¦ many questions, the main one being: Whats your favorite scary movie? Along with many scary movie trivia, ending with bloody pieces of innocent lives scattered around the small town of Woodsboro. (Read More)
Subgenre: | slasher flickpsychological thrillersuspenseblack comedycult filmcoming of ageconspiracypost modernteen movieteen horrorhorror spoof |
Themes: | psychopathdrunkennessmurderdeathfriendshiprevengeinfidelitybetrayalfearescapeinvestigationextramarital affairdivorcebrutalitydeath of mother β¦paranoiahome invasionnear death experiencedeath of daughter (See All) |
Mood: | darknessslashergoresatirehigh school |
Locations: | police stationsmall townforestwoodskitchenschool bus |
Characters: | slasher killerserial killervillainkillerboyfriend girlfriend relationshipfamily relationshipshusband wife relationshipfather son relationshippolicefather daughter relationshipteenagermother daughter relationshipbrother sister relationshipteenage girlteenage boy β¦female protagonistsheriffsingle fatherself referential (See All) |
Period: | 1990s |
Story: | telephone terrorphone terrormystery killerhiding in a closetcharacters killed one by onecrime scenehomicidestalkingscreamcharacter's point of view camera shotstabbed to deaththroat slittingsubjective cameratelephoneblonde β¦blood splattersurprise endingknifeviolencef ratedbloodone word titlebare chested malecigarette smokingtitle spoken by characterpartychasepistolfirecell phonecorpseshot to deathcar accidentshot in the chestface slapshot in the headrescueslow motion scenepunched in the facewatching tvcomputercatarrestfalling from heightmaskshowdownheld at gunpointbeercar crashinterrogationhandcuffstelevisionf wordsurvivalfoot chaseflashlightbound and gaggedcaliforniadisguiseambulancedeath of friendstabbed in the chestweapontied to a chairbrunettefalse accusationno opening creditsdisarming someonevannews reportshot in the foreheadstalkervirgindangerstabbed in the backsuburbwidowerelectrocutionfirst of seriesproduct placementhangingprankshot in the shoulderamerican flaghigh school studentcheerleaderpremarital sexsuspicionfirst partthreatened with a knifecult directorgaragesingle parentstrong female charactereavesdroppingropeanswering machinefalling down stairsteen angstrevelationnipples visible through clothingloss of virginityheroinelifting someone into the airgroup of friendskicked in the stomachvideotapegossipcovered in bloodfaked deathstrong female leadcrushed to deathsocial commentarymasked manpresumed deadduct tape over mouthdamsel in distresscameohaunted by the paststealing a carunderage drinkingpower outageevacuationplot twistescape attemptframe upstabbed in the legfat manjumping through a windowdisembowelmentblood on shirtconvictlens flarefemale reportermasked killerframed for murdermedia coveragenews reporterintestinesanniversaryyellingdirector cameohigh school teacherhomagevideo storediscoverypopcornclimbing through a windowwhodunitcameramandeputycrushed headjockdeath of boyfriendrepeated linetragic pasttabloidpsychological torturewrongful imprisonmenttelevision reporterfamous linevillain not really dead clichewrongful arrestbreaking a bottle over someone's headwoman in dangerquestionred herringwater fountainsittingfalling off a roofdutch anglerookie copgeneration xcut armcurfewloss of girlfriendaccomplicehigh school principalabandoned cardead teenagerhomoeroticteen violencefake bloodmurderer duovideo store clerkthreatening telephone callhanged bodyend credits roll callknife in backreflection in eyemotivehit with a doorhiding in a bathroomtrailer narrated by don lafontainemetafictionreference to richard gerevoice changerreference to freddy kruegerwatching horror movie on tvintestinereference to meg ryanbeer bongbased on paintingfilm geekreference to anthony perkinsreference to ricki lakewatching a horror moviereference to jamie lee curtis (See All) |
Johnny Smith wakes from a coma due to a car accident, only to find he has lost five years of his life, and yet gained psychic powers. Foreseeing the future appears to be a 'gift' at first, but ends up causing problems...
Subgenre: | psycho thrillercanadian horroramerican horrorsuspensecult filmindependent filmsupernaturaltragedyparanormalparanormal phenomena |
Themes: | psychopathchristmassuicidemurderdeathlovesurrealismrapefearinvestigationdeceptionsupernatural powerdeath of motherparanoiablackmail β¦death of wifepanicapocalypsedisabilitymadnessmurder investigationunlikely heronuclear holocaust (See All) |
Mood: | slasherneo noir |
Locations: | hospitalschoolchurchsnowwheelchairpolice cartrucktunnelschool teacherfire truck |
Characters: | serial murdererserial killervillainboyfriend girlfriend relationshiphusband wife relationshipfather son relationshipmother son relationshipdoctorteacherpolice officernursephotographerbabylittle boy β¦psychiatristsnipersheriffgermanex boyfriend ex girlfriend relationshipsniper rifleself mutilation (See All) |
Period: | 1970sworld war two1980swinterseeing the future |
Story: | grindhouse filmhomicidal maniacpsychopathic killerchristmas treedrive in classicserial murderslashingbad guybody countslaughterdead childcrime scenegrindhousemutilationchild murder β¦maniacmurdererchild in perilmansiontelephoneblood splattersurprise endingfemale nuditybased on novelbloodflashbackkissphotographtitle spoken by characterexplosionchasepistolfireshootoutdreamcorpseshot to deathcar accidentshot in the chestrescueslow motion scenewatching tvbattlegunfightfalling from heightletterrifleheld at gunpointcar crashhandcuffsrevolverf wordreportergood versus evilflashlightambulancepoliticianstabbed in the chestman with glassesassassinationunderwater scenepolice officer killednews reportmarriage proposaldrowningflash forwardattempted murderdangerprotestwidowerpay phoneproduct placementdeath of childrabbitlightningshot in the shoulderscarbodyguardtragic eventisolationpremarital sexcharacter says i love youloss of mothergenerallove interestcult directorsacrificepsychicnewspaper headlinecorrupt copbattlefieldheart attackhenchmancold waricedestinydesireassassination attemptelectronic music scorereference to adolf hitlergothicheavy rainsociopathcomaexploding buildingloss of wifepress conferencesevered handambitionpresumed deadrampagevisionmercilessnessevacuationpsychotronicscissorssenatordeath of protagonistdark herorainstormsexual assaultmoral dilemmaarrogancemain character diesfirefightersouthern accentteachingswastikacrutchesroller coastermegalomaniacold flameelection campaignbillboardpolitical campaigndeputykiss on the lipsreluctant heropremonitionhead injuryrallycorrupt politicianshot in the handpolitical candidatestar crossed loversbra removingpsychic poweroverturning cartitle same as booktragic endingpresidential candidatemainepsychotronic filmcar rolloverheadachehouse on fireassassination plotstabbed with scissorsnuclear threatcandidatechild killeddental bracesstabbed in the mouthpolitical assassinationsexual predatorpayphonescreaming in feartorture chamberextrasensory perceptionfrozen lakewalking stickchild killerworld war threecharacter appears on tvchild murderernew hampshiregazebobased on the works of stephen kingreference to edgar allan poeserial child killerpolitical rallyhuman shieldsubterfugesee through brachild's bedroomevil politicianneurologistwaking up from a comadental headgearparanormal phenomenonnuclear attackkissing in the rainpsychiatrist patient relationshipcharacter appears on magazine coverromantic kisscontemporary settingclothes ripped offkiller copstormy nightserial child murderstuffed toy rabbitserial child murderergirl in periltoy rabbitex fiance ex fiancee relationshipserial teen murderersecond sightaltering the futurepsychic detectivereading lessontruck car collisionaspiring politician (See All) |
In Ruggsville, Texas, the police under the command of Sheriff John Quincy Wydell attack the house of the sadistic serial killers Firefly family (a.k.a. The Devil's Reject) and they arrest mother Firefly, but Otis B. Driftwood and Baby Firefly escape from the siege. Tiny is wandering nearby the house β¦ and also escapes. Otis and Baby call their patriarch, the mad clown Captain Spaulding and they schedule to reunite at an isolated motel in the desert. When Otis and Baby arrive, they kidnap two families of singers, using sadism and violence against the harmless persons. Meanwhile, Sheriff Wydell promises to capture and kill the runaways, seeking revenge for the death of his brother, the Deputy George Wydell. (Read More)
Subgenre: | psycho thrillerblack comedycult filmindependent filmsadistic horror |
Themes: | murder of a police officerpsychopathsuicidemurderdeathfriendshiprevengekidnappingrapebetrayalfeartortureescapedeceptionseduction β¦angerdeath of fatherbrutalitydeath of motherparanoiainsanityhumiliationsadismevilexploitationcrueltycannibalismvengeanceself sacrificepolice brutalitymadnessnear death experiencemurder of family (See All) |
Mood: | ambiguous endinggorenightmare |
Locations: | police stationbarbathtubfarmroad tripmotelgas stationtexasbrothel |
Characters: | serial killerterrorvillainboyfriend girlfriend relationshipfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshiptattoobrother brother relationshipbrother sister relationshipprostitute β¦police officernursehostagetough guymaidsheriffpolice shootoutpimpaunt niece relationshipsuicide by copmurder of a prostitute (See All) |
Period: | 1970syear 1978 |
Story: | multiple homicidegrindhouse filmhomicidal maniacpsychopathic killerknife murdermurder spreecrime spreebutcheryserial murderkillbad guymadmanbody countslaughterbutcher β¦crime scenegrindhousemass murdermaniacobscene finger gesturemurdererbasementchild in perilstabbed to deaththroat slittingstrangulationblood splatterknifeviolencebloodsequelflashbackmale rear nuditydogbare chested malesex scenefemale rear nudityfemale full frontal nuditycigarette smokingphotographtitle spoken by characterexplosionchasepantiespistolshowerfireshootoutwoman on topbeatingdreamcorpseshot to deathmachine gunhorseshot in the chestface slapshot in the headshotgunrescueslow motion scenepunched in the facewritten by directorarrestgunfightsex in bedbare buttvomitingshowdownrifleheld at gunpointbeersecond partdead bodylow budget filminterrogationmarijuanajailhandcuffsrevolvercriminalshot in the backf wordsurvivalfoot chasegay slurbound and gaggedambushaxedeath of frienddrug dealerimpalementcocainestabbed in the chestfemale pubic hairtied to a chairwhite pantiescultdream sequenceanti herodouble crosspolice officer killednews reportcigar smokingshot in the legshot in the foreheadracial sluron the runbeaten to deathstabbed in the backscreamingclownelectrocutionpay phonefugitiveevil manknocked outopening action sceneattempted rapefarmershot in the shouldermanipulationdeath of brothersplit screendeath of sonpigneck breakingthreatened with a knifechickenprofanityshot in the armwhippingcult directorcowfreeze framestylized violencehead buttlooking at oneself in a mirrorscene during opening creditsragecowboy hatstabbed in the stomachkicked in the stomachphone boothcovered in bloodrapistfemale killerinterracial friendshipmasked mangas maskwatching televisionrampageredneckstealing a carstabbed in the throathatredhit in the crotchcannibalmercilessnessstabbed in the neckescape attemptreference to satancigarette lighterstabbed in the legdeath of protagonistpunched in the chestjumping through a windowthrown through a windowwisecrack humorblood on shirtone daybounty hunterhighwaybulletproof vesttough copdisfigurementknife throwinggasolinebarbecueaxe murderranchsexual assaultsevered legkilling spreedeath of loved onefemale in showernewspaper clippingmedia coveragesouthern accentclose up of eyesnews reportershot through a windowgothmarijuana jointpervertreference to elvis presleyprayingface maskreturning character killed offstabbed in the handnecrophiliaforced to stripshot in the neckspit in the facehomagepistol whipmisogynisthuman monstersexual violencestandoffvulgarityfemale psychopathtrailer homefilm starts with texthit by a truckdeputyman kills a womantrailer parkman punching a womanfemale villainsole black character dies clichemacabreshot in the throatcarjackinggraphic violenceexploding housedeath of familyreference to star warsbutt slappsychological torturecross countryfilm criticfemale victimcocaine snortinghouse on firemass murdererevil clownbilingualisminnocent person killedreturning character with different actorknife in the chestserial rapistslow motion action sceneno survivorssouthdutch anglemodern westernsuit of armorcult figurerunning out of gaskiller clownwriting in bloodred light districtcmnffemale serial killersexual torturepossebody armorman punches a womantrailer trashpolice vigilantismblockadegas grenaderoadkillreference to jack the rippersevered faceclown makeupentrailssatanicroadiereference to mark twainviolence against a womannail through handoral rapecattle prodmutilated bodynecrophiliacpig maskderanged womanreference to groucho marxderanged manblood bathforced nudityrape with a gun barrel (See All) |
It's October 30, 1988 and Michael Myers has been in a coma since his pursuit of Laurie Strode, 10 years ago, was finally stopped (events of H1 and H2). However when he is transfered from Richmond Mental Institute to Smith's Grove he awakes when he hears that he has a niece in Haddonfield and after k β¦illing the transfer crew he escapes. In Haddonfield, the niece, Jamie, has been adopted by the Carruthers family but keeps having nightmares about Michael (but she doesn't know who he is). On Halloween night, Jamie goes out trick and treating, little knowing that her murdering Uncle is following her and her step-sister Rachel. Rushing to her aid is Dr. Loomis and with the help of Sheriff Meeker starts to search the town for Michael and to find Jamie to protect her. But can anything stop Michael this time? (Read More)
Subgenre: | holiday horrorslasher flickamerican horrorcult filmindependent film |
Themes: | psychopathmurderevilpanic |
Mood: | slashergore |
Locations: | police stationsmall townschoolcarrooftop |
Characters: | slasher killermysterious villainserial killerteenagerteenage girlgirlsister sister relationshipcrying girl |
Period: | 1980syear 1988 |
Story: | psycho killerhomicidal maniacpsychopathic killerknife murdermurder spreecrime spreeserial murdermadmancharacters killed one by onebody countatticmaniackillingcharacter's point of view camera shotthroat slitting β¦subjective camerasurprise endingknifecharacter name in titlenumber in titlebloodsequeldoggundigit in titleshot in the chestfalling from heightmasknumbered sequelgood versus evilhalloweenflashlightambulanceimpalementanimalpart of serieshit by a carpolice officer killedelectrocutionevil manhalloween costumepickup truckfalling down stairslifting someone into the airfourth parthitchhikingrampagepump action shotgunchild's point of viewseven word titlemanhuntpower outagekilling spreemasked killerdead dogreturning character killed offhuman monstertrick or treatingalarmelementary schoolteasingkiss on the lipsmatchillinoismasked villainoff screen murdervillain not really dead clicheescaped mental patientlifting female in airfalling off a rooffoster childlifted by the throatwalking stickniecesmall town sheriffmichael myerschild murdererlifting male in airscarred facehalloween prankboogeymandeath by electrocutionskull crushingpiggy back ridescreaming girl7 year oldjumpsuitthrown through a glass doorexploding gasoline stationdolly zoomfather dislikes daughter's boyfriendtrailer narrated by don lafontainetrapped in a housereturn to hometownnightmare sequencelimping mannumber 4 in titlegirl in dangersmashing a windowoctoberkilling the wrong personteenager in dangersanitorium31 year oldpurposely hit by a car10 years latersprayed with fire extinguisherejected from a moving vehiclefoster sistergirl hits a boygas station explosionhit on the head with a gun buttteenager murderedhitching a rideejected from a moving carpunch catch (See All) |
On the eve of her seventeenth birthday, Mari Collingwood tells her parents that she is going to the concert of underground band Bloodlust in New York with her friend Phyllis Stone. She borrows the family's car and heads with her friend to a dangerous neighborhood in the city. Meanwhile, the sadistic β¦ and cruel escapees Krug Stillo and Fred 'Weasel' Podowski are hidden in a hideout with their partners Sadie (Jeramie Rain) and Krug's addicted son Junior Stillo (Marc Sheffler) after killing two guards and one shepherd in their runaway. The two girls seek marijuana near the theater and meet Junior that offers some Colombian grass to them. They go to his apartment and are subdued by the criminals that rape Phyllis. On the next morning, they hide the girls in the trunk of their convertible and head to Canada. However, they have a problem with the car's rod and they stop on the road close to Mari's house. When Phyllis tries to escape, the gang stabs her to death and shots Mari after humiliating and raping them. They seek shelter in Mari's home, but during the night, her mother overhears a conversation of the criminals telling that they have killed her daughter. She tells her husband and they plot a scheme to revenge the death of their princess. (Read More)
Subgenre: | american horrorcult filmindependent filmsadistic horror |
Themes: | psychopathvoyeurismsuicidemurderdeathrevengekidnappingrapetortureescapeinvestigationseductionbrutalityinsanityhumiliation β¦sadismevilabductioncrueltyvengeancemadnessrape and revengerape and murder (See All) |
Mood: | slashergorehigh schoolnightmare |
Locations: | cityswimming poolforestcemeterylakerunning through the woods |
Characters: | slasher killerserial murdererserial killerterrorvillainkillerfamily relationshipsfather son relationshippoliceteenage girlreference to godsheriffself justice |
Period: | 1970s |
Story: | horror movie remadehomicidal maniacpsychopathic killersadistic psychopathdrive in classicbloody violencedisturbingdisturbed individualcarnageserial murderbad guymadmandead girlgrindhousemutilation β¦maniackillingmurdererscantily clad femalestabbed to deaththroat slittingstabbingvoyeurblood splatterknifeviolencefemale nuditybloodfemale frontal nuditydoggunfemale rear nudityfightfemale full frontal nuditypantiesshowershot to deathurinationremakeshootingbeerbirthdaymarijuanafoot chasebound and gaggedgangconcerttoiletfemale pubic hairwhite pantiesbathcontroversycigar smokingnecklacelatex glovespublic nuditydrug addictstabbed in the backscreamingsuburbelectrocutionevil manringconvertiblefemale removes her clotheschickendirectorial debutsevered armhandgunbased on filmcult directordismembermentbralesschainsawnipples visible through clothingbeer drinkingmachetesexual abuseice creamvictimrape victimrapistpeeping tomfemale killerhitchhikingwoman in jeopardyswitchbladerock concertsufferingcynicismhippiepet dogjunkiepedophiledisembowelmentperversionmurder of a childcastrationducksexual assaultfemale in showerbloodbathshot multiple timespervertprayingcannabisforced to striprunning awayspit in the facemisogynisthuman monsterphysiciansexual perversionsexual violenceelectronic musicfemale psychopathdegradationdouble barreled shotgunescaped convictwetting pantsfilm starts with textparentheld captiverazor bladefemale villainatrocitystation wagonshot through the mouthgraphic violencereading a newspaperchild molesterbakingstreamlong haired maleserial rapistbitingpaybacksexual predatorstabbed multiple timesrunning out of gasrunning for your lifemistreatmentescaped prisonerfemale serial killerperson in a car trunkpocket knifebased on supposedly true storysexual crueltypokiesbanned filmsex offenderforced suicidesadisticstabbed in the bellyhands tied behind backrefugeserial child killerinfamybloody handmutilated corpsecheckersvideo nastysickocandlelight dinnerbad girlpsychological tormentcaged birdreference to j. edgar hoovertrip wiregraphic raperotten teethserial teen killerlocked in a car trunkescaped killerlive chickenhair curlersfemale victimsengine troublereference to the grand canyonserial child murdererplaying checkersstuffed in a car trunkbaking a cakeprison escapeewoman smoking a cigarmedical gownserial teen murdererice cream barsmoking in bathtubwoman in a trunkremake of swedish film (See All) |
Two years after the events of Scream, Sidney Prescott and Randy are attending Windsor college. They are trying to get on with their lives...Until a new Ghostface killing spree begins. With the help of Dewey and Gale, Sidney must find out who's behind the murders. As the body count goes up, the list β¦of suspects goes down. (Read More)
Subgenre: | slasher flicksuspenseblack comedycult filmconspiracypost modernteen movieteen horrorhorror spoof |
Themes: | murder of a police officerpsychopathvoyeurismdrunkennessmurderdeathloverevengebetrayalfearescapeinvestigationdeceptionparanoiainsanity β¦sadismtheatrenear death experience (See All) |
Mood: | slashergoresatire |
Locations: | police stationhospitalbicyclepolice carfire truck |
Characters: | serial killerpolice detectivekillerboyfriend girlfriend relationshippoliceteenagerfemale protagonistpolice officerdetectivehostageex boyfriend ex girlfriend relationshipself referential |
Period: | 1990s |
Story: | telephone terrorsorority housephone terrormystery killersororityhiding in a closetcharacters killed one by onebody countcrime scenekillingstalkingscreamstabbed to deaththroat slittingstabbing β¦telephonevoyeurhallucinationblood splattersurprise endingknifeviolencef ratednumber in titlebloodsequelinterviewbare chested malekisscigarette smokingsingingpartychasepistolcell phonebeatingcorpsedigit in titleshot to deathcar accidentshot in the chesturinationface slapshot in the headrescueslow motion scenepunched in the facewatching tvcomputerbrawlmaskshowdownheld at gunpointsunglassessecond partcar crashcollegetelevisionf wordreportergood versus evilsurvivalfoot chasegay slurbedroomflashlightjournalistambushaxevideo cameraambulancedeath of friendimpalementstabbed in the chestinternetfalse accusationno opening creditsdisarming someonehit by a cardouble crosspolice officer killedvannews reportshot in the legnecklaceshot in the foreheadracial slurattempted murderlibraryauthorstalkercharacter repeating someone else's dialoguemicrophonestabbed in the backcostumescreamingattackpay phoneproduct placementstatuecover upknocked outkicked in the facecollege studentlightningprankscarbodyguardfilm within a filmisolationsuspicionstagecharacter says i love youthreatened with a knifeshot in the armbare chested male bondagecult directorstrong female characterpizzatwenty somethingeavesdroppingtv newsfalling down stairsheroineshot in the stomachfamecatfightsurvivorgroup of friendsstabbed in the stomachcrucifixmovie theatervillainessvideotapeblockbusterrehearsalpress conferencestrong female leadinterracial friendshipcrushed to deathsocial commentarymasked manpresumed deadfemale warriorduct tape over mouthcameohaunted by the pastconstruction sitestabbed in the throatmercilessnessevacuationfalling to deathescape attemptstabbed in the heade maillens flarefemale reporterplayethnic slursequel to cult favoritekilling spreemasked killermedia coverageclose up of eyesenglishman abroadintimidationnews reporterdirector cameoreturning character killed offex copohiocafeteriafake identitypolice chieffemale psychopathpopcornwhodunitcameramanfraternitybusiness cardman kills a womanoffscreen killingfemale villainwoman kills a mandeath of boyfriendstabbed in the shouldershot in the throatcollege campusstabbed in the facetragic pastreference to star warslimpwoman slaps a manfamous linestupid victimvillain not really dead clicheclimbing out a windowvcrthrown from a car555 phone numberred herringfemale journalistsittingfilm schoolwoman punching a mangeneration xcult figurecut armfilm studentmob of reportersbroken handaccomplicereference to charles mansonthrown from heightdeath by impalementauditoriumstab woundthreatening telephone callthrown through a glass doorinstant messagingprank callreference to quentin tarantinoreference to o.j. simpsonstabbed in the earreference to jeffrey dahmerreference to ted bundytheater directorcopycatvalley girlmetafictionthrown off a balconytv cameramanvoice changerreference to kevin costnerreference to the godfatherfake knifemise en abymereference to jennifer anistonreference to kevin baconreference to the terminatorbreaking bottle over headcopycat killerreference to sandra bullocktalking during a moviewoman kills a womanfalling off a stagesorority partysorority sisterfilm geekreference to james cameronsoundproof roomimpaled by pipestage director (See All) |
In the Town of Derry, the local kids are disappearing one by one, leaving behind bloody remains. In a place known as 'The Barrens', a group of seven kids are united by their horrifying and strange encounters with an evil clown and their determination to kill It.
Subgenre: | american horrorsupernatural |
Themes: | psychopathmurderdeathfearmonstermemoryracismbrutalitysupernatural powersadismbullyingabductionhomophobiacrueltychildhood β¦cannibalismmadnessmissing childunlikely friendshipschool bullyingsupernatural powers (See All) |
Mood: | gore |
Locations: | small townschoolforestbicyclesewernew boy in town |
Characters: | serial killervillainpoliceteenagerchildrenzombiebullylittle boyjewchildhood friendbar mitzvahboy in underwearevil father |
Period: | 1980ssummeryear 1989year 1988 |
Story: | psycho killerhomicidal maniacsadistic killerpsychopathic killersadistic psychopathinhalerbloody violencedisturbingdeeply disturbed personkillbad guycellarbutcherpsychomutilation β¦maniackillingmurdererbasementmissing personchild in perilpianoblood splatterviolencebased on novelbloodone word titleflashbackkisstitle spoken by charactercatbattlepaintingbookbathroomdemongay slurnewspaperchild abusechildcoffincreaturelibraryclowndeath of brotherbrotherfirst partsevered armgaragesplattersistereyeglassesballoonstreetsexual abuseoverallscovered in bloodinterracial friendshipeaten aliveswitchbladebraverystabbed in the throatpedophilemurder of a childturtleabusive fatherbroken armkilling spreeloss of brotherheroismunderdogpervertspittinggirl in bra and pantiesoutcastwoodabandoned housebicyclingwellpharmacybare chested boypatricideparentraininggraphic violencejumping into watercleaningchild molesterfourth of julystutteringteenage girl in underwearpool of bloodreference to michael jacksonoverbearing motherold houseghoulglowing eyesevil clowncreepsidewalkarm ripped offchild swearingchild killeddutch angleflickering lightkiller clownscreaming in fearpocket knifechild killercamaraderiemonsterschild murdererhypochondriachit with a rockmissing person posterscreaming in horrorsinkserial child killerfamily lifechild smoking cigaretteimplied incestadultererbitten in the facehell on earthtraumatic childhoodviolence against a childeaster eggstorm drainslideshowdark killerheadless corpseleperplaster castreference to metallicaserial teen killerarm in a casthiding in a bathroomprojectortraumatic childhood experienceblood oathson kills fatherred balloonchildhood crushserial child murderevil creaturefear of clownscutting own hairmissing boystuttering characterthrowing stonesserial child murdererserial killerssexual child abuseslut shamingboy wearing glassesclosed doorreference to clark kentbullying victimfloating in the airpainting comes to lifecutting one's own hairdisappearance of a childflooded basementkilling a sheepreference to molly ringwaldthrown down a wellcutting the palm of one's handpaper boatreference to lois lanereference to new kids on the blockarm bitten offcarving into human fleshchild eaterchild rapistclown dollcursessheep farm (See All) |